| Basic Information | |
|---|---|
| Family ID | F013708 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 269 |
| Average Sequence Length | 41 residues |
| Representative Sequence | SQAKSEIASDNIEDRLAALEKEDRIEQLLAELKTKRGA |
| Number of Associated Samples | 217 |
| Number of Associated Scaffolds | 269 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.77 % |
| % of genes from short scaffolds (< 2000 bps) | 91.45 % |
| Associated GOLD sequencing projects | 201 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.721 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.152 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.420 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.416 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.55% β-sheet: 0.00% Coil/Unstructured: 45.45% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 269 Family Scaffolds |
|---|---|---|
| PF01850 | PIN | 5.95 |
| PF02646 | RmuC | 4.83 |
| PF13211 | DUF4019 | 4.46 |
| PF10282 | Lactonase | 2.97 |
| PF01402 | RHH_1 | 2.23 |
| PF04014 | MazE_antitoxin | 1.86 |
| PF01370 | Epimerase | 1.49 |
| PF12802 | MarR_2 | 1.12 |
| PF04239 | DUF421 | 1.12 |
| PF04613 | LpxD | 1.12 |
| PF00588 | SpoU_methylase | 0.74 |
| PF00561 | Abhydrolase_1 | 0.74 |
| PF14602 | Hexapep_2 | 0.74 |
| PF00795 | CN_hydrolase | 0.74 |
| PF05532 | CsbD | 0.74 |
| PF01904 | DUF72 | 0.37 |
| PF01261 | AP_endonuc_2 | 0.37 |
| PF03706 | LPG_synthase_TM | 0.37 |
| PF00990 | GGDEF | 0.37 |
| PF14534 | DUF4440 | 0.37 |
| PF13751 | DDE_Tnp_1_6 | 0.37 |
| PF01058 | Oxidored_q6 | 0.37 |
| PF07883 | Cupin_2 | 0.37 |
| PF02550 | AcetylCoA_hydro | 0.37 |
| PF13366 | PDDEXK_3 | 0.37 |
| PF01987 | AIM24 | 0.37 |
| PF00483 | NTP_transferase | 0.37 |
| PF01928 | CYTH | 0.37 |
| PF02580 | Tyr_Deacylase | 0.37 |
| PF00226 | DnaJ | 0.37 |
| PF03721 | UDPG_MGDP_dh_N | 0.37 |
| PF00144 | Beta-lactamase | 0.37 |
| PF04455 | Saccharop_dh_N | 0.37 |
| PF02129 | Peptidase_S15 | 0.37 |
| PF12146 | Hydrolase_4 | 0.37 |
| PF00117 | GATase | 0.37 |
| PF03544 | TonB_C | 0.37 |
| PF10129 | OpgC_C | 0.37 |
| PF06713 | bPH_4 | 0.37 |
| PF01569 | PAP2 | 0.37 |
| PF12158 | DUF3592 | 0.37 |
| PF05016 | ParE_toxin | 0.37 |
| PF04392 | ABC_sub_bind | 0.37 |
| PF01557 | FAA_hydrolase | 0.37 |
| PF09957 | VapB_antitoxin | 0.37 |
| COG ID | Name | Functional Category | % Frequency in 269 Family Scaffolds |
|---|---|---|---|
| COG1322 | DNA anti-recombination protein (rearrangement mutator) RmuC | Replication, recombination and repair [L] | 4.83 |
| COG2323 | Uncharacterized membrane protein YcaP, DUF421 family | Function unknown [S] | 1.12 |
| COG1044 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Cell wall/membrane/envelope biogenesis [M] | 1.12 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.74 |
| COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.74 |
| COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 0.74 |
| COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 0.74 |
| COG1490 | D-aminoacyl-tRNA deacylase | Translation, ribosomal structure and biogenesis [J] | 0.37 |
| COG3260 | Ni,Fe-hydrogenase III small subunit | Energy production and conversion [C] | 0.37 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.37 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.37 |
| COG2013 | AIM24 protein, required for mitochondrial respiration | Energy production and conversion [C] | 0.37 |
| COG1941 | Coenzyme F420-reducing hydrogenase, gamma subunit | Energy production and conversion [C] | 0.37 |
| COG1915 | Uncharacterized conserved protein AF1278, contains saccharopine dehydrogenase N-terminal (SDHN) domain | Function unknown [S] | 0.37 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.37 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.37 |
| COG1740 | Ni,Fe-hydrogenase I small subunit | Energy production and conversion [C] | 0.37 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.37 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.37 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.37 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.37 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.37 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.37 |
| COG0427 | Propionyl CoA:succinate CoA transferase | Energy production and conversion [C] | 0.37 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.37 |
| COG0377 | NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductase | Energy production and conversion [C] | 0.37 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.37 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.72 % |
| Unclassified | root | N/A | 25.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000891|JGI10214J12806_10099477 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300000955|JGI1027J12803_105668537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 826 | Open in IMG/M |
| 3300001151|JGI12713J13577_1007654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 980 | Open in IMG/M |
| 3300001356|JGI12269J14319_10006556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10087 | Open in IMG/M |
| 3300001471|JGI12712J15308_10154783 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300001527|A3513AW1_1102039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300001546|JGI12659J15293_10047876 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100402379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1248 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100484429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1114 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101188447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 651 | Open in IMG/M |
| 3300003351|JGI26346J50198_1014049 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300004092|Ga0062389_101691207 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
| 3300004153|Ga0063455_101686672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 502 | Open in IMG/M |
| 3300004480|Ga0062592_101340057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300004603|Ga0068918_1245664 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300005337|Ga0070682_101070291 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300005439|Ga0070711_100707497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 849 | Open in IMG/M |
| 3300005450|Ga0066682_10100013 | All Organisms → cellular organisms → Bacteria | 1820 | Open in IMG/M |
| 3300005456|Ga0070678_100896011 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300005458|Ga0070681_10069376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3491 | Open in IMG/M |
| 3300005468|Ga0070707_100601425 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300005534|Ga0070735_10741438 | Not Available | 580 | Open in IMG/M |
| 3300005536|Ga0070697_102119897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 503 | Open in IMG/M |
| 3300005541|Ga0070733_10955527 | Not Available | 575 | Open in IMG/M |
| 3300005559|Ga0066700_10271126 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300005563|Ga0068855_100991188 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300005575|Ga0066702_10146684 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300005602|Ga0070762_10120184 | All Organisms → cellular organisms → Bacteria | 1543 | Open in IMG/M |
| 3300005602|Ga0070762_11236414 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300005602|Ga0070762_11308075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300005921|Ga0070766_11040096 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300006028|Ga0070717_11030264 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300006031|Ga0066651_10090873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1520 | Open in IMG/M |
| 3300006041|Ga0075023_100109643 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300006046|Ga0066652_101132180 | Not Available | 741 | Open in IMG/M |
| 3300006052|Ga0075029_100081856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1913 | Open in IMG/M |
| 3300006052|Ga0075029_100195436 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300006059|Ga0075017_100189538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1482 | Open in IMG/M |
| 3300006059|Ga0075017_101004443 | Not Available | 650 | Open in IMG/M |
| 3300006059|Ga0075017_101367864 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium RIFCSPLOWO2_12_FULL_39_13 | 556 | Open in IMG/M |
| 3300006086|Ga0075019_10256361 | Not Available | 1045 | Open in IMG/M |
| 3300006102|Ga0075015_100015785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3264 | Open in IMG/M |
| 3300006163|Ga0070715_10594899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 647 | Open in IMG/M |
| 3300006173|Ga0070716_100863617 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300006173|Ga0070716_101532854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300006175|Ga0070712_100668598 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300006176|Ga0070765_100807725 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300006354|Ga0075021_11012068 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300006640|Ga0075527_10075774 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300006755|Ga0079222_12299400 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300006796|Ga0066665_10924984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300006800|Ga0066660_10726852 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300006904|Ga0075424_101654482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 678 | Open in IMG/M |
| 3300009012|Ga0066710_101696547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 961 | Open in IMG/M |
| 3300009012|Ga0066710_102868615 | Not Available | 678 | Open in IMG/M |
| 3300009038|Ga0099829_11014772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300009038|Ga0099829_11425412 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila | 572 | Open in IMG/M |
| 3300009093|Ga0105240_10030350 | All Organisms → cellular organisms → Bacteria | 7026 | Open in IMG/M |
| 3300009137|Ga0066709_104495215 | Not Available | 509 | Open in IMG/M |
| 3300009148|Ga0105243_11878759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 631 | Open in IMG/M |
| 3300009521|Ga0116222_1187840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 890 | Open in IMG/M |
| 3300009522|Ga0116218_1172428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 980 | Open in IMG/M |
| 3300009523|Ga0116221_1054308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1854 | Open in IMG/M |
| 3300009525|Ga0116220_10029906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2226 | Open in IMG/M |
| 3300009547|Ga0116136_1016025 | All Organisms → cellular organisms → Bacteria | 2570 | Open in IMG/M |
| 3300009551|Ga0105238_10281197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1645 | Open in IMG/M |
| 3300009551|Ga0105238_12062781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 604 | Open in IMG/M |
| 3300009634|Ga0116124_1177163 | Not Available | 594 | Open in IMG/M |
| 3300009683|Ga0116224_10124542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1245 | Open in IMG/M |
| 3300009698|Ga0116216_10358730 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300009700|Ga0116217_10144770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1591 | Open in IMG/M |
| 3300009824|Ga0116219_10137327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1418 | Open in IMG/M |
| 3300010043|Ga0126380_10775966 | Not Available | 781 | Open in IMG/M |
| 3300010046|Ga0126384_11809210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300010048|Ga0126373_10467129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1299 | Open in IMG/M |
| 3300010048|Ga0126373_11481409 | Not Available | 744 | Open in IMG/M |
| 3300010320|Ga0134109_10050390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1377 | Open in IMG/M |
| 3300010335|Ga0134063_10383724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
| 3300010341|Ga0074045_10404783 | Not Available | 884 | Open in IMG/M |
| 3300010361|Ga0126378_10316808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1665 | Open in IMG/M |
| 3300010366|Ga0126379_13112612 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300010371|Ga0134125_11774466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300010375|Ga0105239_12489621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300010376|Ga0126381_100675861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1475 | Open in IMG/M |
| 3300010376|Ga0126381_101295576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1053 | Open in IMG/M |
| 3300010376|Ga0126381_102304061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
| 3300010376|Ga0126381_102842049 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300010376|Ga0126381_103392888 | Not Available | 627 | Open in IMG/M |
| 3300010376|Ga0126381_105069626 | Not Available | 505 | Open in IMG/M |
| 3300010376|Ga0126381_105117011 | Not Available | 502 | Open in IMG/M |
| 3300010379|Ga0136449_103327795 | Not Available | 617 | Open in IMG/M |
| 3300010379|Ga0136449_103470326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300010379|Ga0136449_104504484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300010399|Ga0134127_13263688 | Not Available | 530 | Open in IMG/M |
| 3300010937|Ga0137776_1423632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2195 | Open in IMG/M |
| 3300011120|Ga0150983_10193101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 831 | Open in IMG/M |
| 3300011120|Ga0150983_12329729 | Not Available | 544 | Open in IMG/M |
| 3300011120|Ga0150983_12545124 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300011270|Ga0137391_10853487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300011270|Ga0137391_11521089 | Not Available | 514 | Open in IMG/M |
| 3300012019|Ga0120139_1195433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 536 | Open in IMG/M |
| 3300012189|Ga0137388_11776984 | Not Available | 549 | Open in IMG/M |
| 3300012201|Ga0137365_10845588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
| 3300012206|Ga0137380_11079230 | Not Available | 684 | Open in IMG/M |
| 3300012208|Ga0137376_10842383 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
| 3300012208|Ga0137376_11767443 | Not Available | 509 | Open in IMG/M |
| 3300012209|Ga0137379_10114304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2597 | Open in IMG/M |
| 3300012210|Ga0137378_10487877 | Not Available | 1139 | Open in IMG/M |
| 3300012210|Ga0137378_11219962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter | 668 | Open in IMG/M |
| 3300012349|Ga0137387_10011869 | All Organisms → cellular organisms → Bacteria | 5152 | Open in IMG/M |
| 3300012354|Ga0137366_10182248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1574 | Open in IMG/M |
| 3300012356|Ga0137371_11360544 | Not Available | 523 | Open in IMG/M |
| 3300012357|Ga0137384_10502855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 995 | Open in IMG/M |
| 3300012363|Ga0137390_10173180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2145 | Open in IMG/M |
| 3300012363|Ga0137390_11583955 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300012469|Ga0150984_107795800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5587 | Open in IMG/M |
| 3300012469|Ga0150984_122879771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300012917|Ga0137395_10232835 | Not Available | 1290 | Open in IMG/M |
| 3300012917|Ga0137395_10237098 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
| 3300012930|Ga0137407_12250678 | Not Available | 521 | Open in IMG/M |
| 3300012930|Ga0137407_12308184 | Not Available | 514 | Open in IMG/M |
| 3300012944|Ga0137410_10456849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1038 | Open in IMG/M |
| 3300012944|Ga0137410_10951834 | Not Available | 729 | Open in IMG/M |
| 3300012948|Ga0126375_10952188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300012986|Ga0164304_10395115 | Not Available | 980 | Open in IMG/M |
| 3300012986|Ga0164304_10612080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
| 3300012988|Ga0164306_11464747 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300013296|Ga0157374_11934229 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300013296|Ga0157374_12506552 | Not Available | 543 | Open in IMG/M |
| 3300013307|Ga0157372_12082575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300014158|Ga0181521_10527780 | Not Available | 561 | Open in IMG/M |
| 3300014169|Ga0181531_10244072 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300014169|Ga0181531_10338203 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300014498|Ga0182019_10155751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1450 | Open in IMG/M |
| 3300014502|Ga0182021_12113676 | Not Available | 678 | Open in IMG/M |
| 3300014654|Ga0181525_10172794 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1182 | Open in IMG/M |
| 3300015193|Ga0167668_1059891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 779 | Open in IMG/M |
| 3300015374|Ga0132255_102100604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 861 | Open in IMG/M |
| 3300016341|Ga0182035_11883779 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300016702|Ga0181511_1311348 | Not Available | 721 | Open in IMG/M |
| 3300017823|Ga0187818_10064787 | All Organisms → cellular organisms → Bacteria | 1573 | Open in IMG/M |
| 3300017823|Ga0187818_10112973 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300017932|Ga0187814_10396400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. 73-21 | 537 | Open in IMG/M |
| 3300017946|Ga0187879_10336494 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300017970|Ga0187783_10126041 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
| 3300017970|Ga0187783_10209145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1432 | Open in IMG/M |
| 3300017972|Ga0187781_10576418 | Not Available | 810 | Open in IMG/M |
| 3300017975|Ga0187782_10357577 | Not Available | 1106 | Open in IMG/M |
| 3300017995|Ga0187816_10507788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300018007|Ga0187805_10381248 | Not Available | 653 | Open in IMG/M |
| 3300018025|Ga0187885_10063147 | All Organisms → cellular organisms → Bacteria | 1865 | Open in IMG/M |
| 3300018062|Ga0187784_10036964 | All Organisms → cellular organisms → Bacteria | 3950 | Open in IMG/M |
| 3300018085|Ga0187772_11508475 | Not Available | 500 | Open in IMG/M |
| 3300018090|Ga0187770_10036362 | All Organisms → cellular organisms → Bacteria | 3481 | Open in IMG/M |
| 3300018468|Ga0066662_12554686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300019278|Ga0187800_1644518 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300019887|Ga0193729_1271492 | Not Available | 521 | Open in IMG/M |
| 3300019888|Ga0193751_1075629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1361 | Open in IMG/M |
| 3300019890|Ga0193728_1285589 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300019890|Ga0193728_1288630 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300020021|Ga0193726_1018596 | All Organisms → cellular organisms → Bacteria | 3562 | Open in IMG/M |
| 3300020580|Ga0210403_10548151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
| 3300020580|Ga0210403_10614122 | Not Available | 877 | Open in IMG/M |
| 3300020581|Ga0210399_11546447 | Not Available | 513 | Open in IMG/M |
| 3300021168|Ga0210406_10064316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3171 | Open in IMG/M |
| 3300021168|Ga0210406_10585665 | Not Available | 873 | Open in IMG/M |
| 3300021171|Ga0210405_10205781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1560 | Open in IMG/M |
| 3300021171|Ga0210405_10787656 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300021178|Ga0210408_10797043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
| 3300021180|Ga0210396_10700819 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300021181|Ga0210388_10170354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1898 | Open in IMG/M |
| 3300021181|Ga0210388_11112551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300021401|Ga0210393_11448096 | Not Available | 548 | Open in IMG/M |
| 3300021404|Ga0210389_10261374 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300021405|Ga0210387_10525798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1052 | Open in IMG/M |
| 3300021432|Ga0210384_10002534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 22195 | Open in IMG/M |
| 3300021432|Ga0210384_10786118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 849 | Open in IMG/M |
| 3300021433|Ga0210391_10903977 | Not Available | 689 | Open in IMG/M |
| 3300021474|Ga0210390_10727615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 826 | Open in IMG/M |
| 3300021474|Ga0210390_10731216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 823 | Open in IMG/M |
| 3300021478|Ga0210402_11593866 | Not Available | 580 | Open in IMG/M |
| 3300021559|Ga0210409_10061024 | All Organisms → cellular organisms → Bacteria | 3523 | Open in IMG/M |
| 3300021559|Ga0210409_11366467 | Not Available | 584 | Open in IMG/M |
| 3300021560|Ga0126371_12381346 | Not Available | 640 | Open in IMG/M |
| 3300022734|Ga0224571_101023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1696 | Open in IMG/M |
| 3300025908|Ga0207643_10966122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300025910|Ga0207684_11205448 | Not Available | 627 | Open in IMG/M |
| 3300025911|Ga0207654_10266564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1154 | Open in IMG/M |
| 3300025913|Ga0207695_10340543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1387 | Open in IMG/M |
| 3300025916|Ga0207663_11169111 | Not Available | 619 | Open in IMG/M |
| 3300025922|Ga0207646_10393611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1252 | Open in IMG/M |
| 3300025939|Ga0207665_10811706 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300026023|Ga0207677_10259686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1415 | Open in IMG/M |
| 3300026142|Ga0207698_10771821 | Not Available | 961 | Open in IMG/M |
| 3300026309|Ga0209055_1288205 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300026315|Ga0209686_1062686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1335 | Open in IMG/M |
| 3300026316|Ga0209155_1080329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1218 | Open in IMG/M |
| 3300026333|Ga0209158_1069484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1391 | Open in IMG/M |
| 3300026334|Ga0209377_1329222 | Not Available | 512 | Open in IMG/M |
| 3300026354|Ga0257180_1020733 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300026538|Ga0209056_10575350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300027570|Ga0208043_1140630 | Not Available | 633 | Open in IMG/M |
| 3300027575|Ga0209525_1096569 | Not Available | 700 | Open in IMG/M |
| 3300027575|Ga0209525_1128215 | Not Available | 589 | Open in IMG/M |
| 3300027674|Ga0209118_1034861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1530 | Open in IMG/M |
| 3300027674|Ga0209118_1072502 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300027678|Ga0209011_1062763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1117 | Open in IMG/M |
| 3300027698|Ga0209446_1185913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300027738|Ga0208989_10096666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1006 | Open in IMG/M |
| 3300027773|Ga0209810_1138682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1030 | Open in IMG/M |
| 3300027842|Ga0209580_10082967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1535 | Open in IMG/M |
| 3300027854|Ga0209517_10215119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1175 | Open in IMG/M |
| 3300027867|Ga0209167_10127018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1324 | Open in IMG/M |
| 3300027867|Ga0209167_10159167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1189 | Open in IMG/M |
| 3300027889|Ga0209380_10793047 | Not Available | 537 | Open in IMG/M |
| 3300027894|Ga0209068_10367235 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300027903|Ga0209488_10113823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2033 | Open in IMG/M |
| 3300027905|Ga0209415_10512453 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300027910|Ga0209583_10136370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 988 | Open in IMG/M |
| 3300027911|Ga0209698_10142390 | All Organisms → cellular organisms → Bacteria | 1972 | Open in IMG/M |
| 3300027911|Ga0209698_10722141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
| 3300028379|Ga0268266_10205455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1804 | Open in IMG/M |
| 3300028792|Ga0307504_10484660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 501 | Open in IMG/M |
| 3300028798|Ga0302222_10057495 | Not Available | 1572 | Open in IMG/M |
| 3300028874|Ga0302155_10213034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 841 | Open in IMG/M |
| 3300028906|Ga0308309_10649487 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300029636|Ga0222749_10690123 | Not Available | 559 | Open in IMG/M |
| 3300029953|Ga0311343_10288137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1605 | Open in IMG/M |
| 3300030007|Ga0311338_10307976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1745 | Open in IMG/M |
| 3300030014|Ga0302175_10023481 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300030043|Ga0302306_10302143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300030339|Ga0311360_11388618 | Not Available | 550 | Open in IMG/M |
| 3300030519|Ga0302193_10411078 | Not Available | 684 | Open in IMG/M |
| 3300030618|Ga0311354_11375684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300030632|Ga0210250_10332471 | Not Available | 581 | Open in IMG/M |
| 3300030707|Ga0310038_10361360 | Not Available | 640 | Open in IMG/M |
| 3300030737|Ga0302310_10277445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 950 | Open in IMG/M |
| 3300030862|Ga0265753_1109071 | Not Available | 569 | Open in IMG/M |
| 3300031231|Ga0170824_116149154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 645 | Open in IMG/M |
| 3300031231|Ga0170824_125500115 | Not Available | 585 | Open in IMG/M |
| 3300031249|Ga0265339_10084024 | All Organisms → cellular organisms → Bacteria | 1678 | Open in IMG/M |
| 3300031446|Ga0170820_13951228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 929 | Open in IMG/M |
| 3300031708|Ga0310686_114652231 | Not Available | 618 | Open in IMG/M |
| 3300031715|Ga0307476_10940127 | Not Available | 637 | Open in IMG/M |
| 3300031715|Ga0307476_11243224 | Not Available | 544 | Open in IMG/M |
| 3300031771|Ga0318546_10440164 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300031833|Ga0310917_10193943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1356 | Open in IMG/M |
| 3300031890|Ga0306925_11894196 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300031942|Ga0310916_10693284 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300031946|Ga0310910_11167037 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300032059|Ga0318533_10382376 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1027 | Open in IMG/M |
| 3300032160|Ga0311301_10125026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4818 | Open in IMG/M |
| 3300032160|Ga0311301_10504416 | All Organisms → cellular organisms → Bacteria | 1792 | Open in IMG/M |
| 3300032180|Ga0307471_100833983 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1089 | Open in IMG/M |
| 3300032261|Ga0306920_101926305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 830 | Open in IMG/M |
| 3300032783|Ga0335079_12089125 | Not Available | 543 | Open in IMG/M |
| 3300032828|Ga0335080_10402004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1469 | Open in IMG/M |
| 3300032829|Ga0335070_11707175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300032892|Ga0335081_10522584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae → unclassified Propionibacteriaceae → Propionibacteriaceae bacterium | 1486 | Open in IMG/M |
| 3300032893|Ga0335069_10566211 | Not Available | 1308 | Open in IMG/M |
| 3300032895|Ga0335074_11305212 | Not Available | 599 | Open in IMG/M |
| 3300033004|Ga0335084_10879632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
| 3300033134|Ga0335073_10145508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3008 | Open in IMG/M |
| 3300033158|Ga0335077_10453106 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
| 3300033158|Ga0335077_11738017 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300033402|Ga0326728_10012598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 18719 | Open in IMG/M |
| 3300033475|Ga0310811_10261462 | All Organisms → cellular organisms → Bacteria | 2037 | Open in IMG/M |
| 3300033480|Ga0316620_10754801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 930 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.15% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.29% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.06% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.58% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.58% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.46% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.46% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.46% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.60% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.60% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.23% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.23% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.86% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.86% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.12% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.12% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.12% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.12% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.12% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.49% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.49% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.49% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.74% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.74% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.74% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.74% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.74% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.74% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.37% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.37% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.37% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.37% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.37% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.37% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.37% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.37% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.37% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.37% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.37% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.37% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001151 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001527 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-5cm-13A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003351 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004603 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3 | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028874 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030014 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030519 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3 | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030632 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR004SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10214J12806_100994772 | 3300000891 | Soil | HSQAKSEIAADDVEERLAALEKEDRIEQLLTELKAKRGA* |
| JGI1027J12803_1056685371 | 3300000955 | Soil | SQAKSEIATDNIEDRLAALEKQDRIEQLLAELKSKRGA* |
| JGI12713J13577_10076541 | 3300001151 | Forest Soil | EEAISGAKAQLLADDVEDRLAALEREDRIEQLLAELKTKRGA* |
| JGI12269J14319_1000655613 | 3300001356 | Peatlands Soil | QAKSEIAADNIDDRLAALEKQDRIERLLAELKTQRGA* |
| JGI12712J15308_101547831 | 3300001471 | Forest Soil | MKRKVAHSEAVSQAKSEIAGDNLEDRLAALGKEDRIEQLLAELKTKRGA* |
| A3513AW1_11020392 | 3300001527 | Permafrost | AFDRLKRKVAHNEAVSQAKSELGEEDVEDRLTAIEKDDRIEQLLAEMKAKHA* |
| JGI12659J15293_100478761 | 3300001546 | Forest Soil | VSQAKSEIASDNIEDRLAALEKEDRIEQLLAELKSKRGA* |
| JGIcombinedJ26739_1004023792 | 3300002245 | Forest Soil | ANSEIAADNVEERLAALEKEDRIEQLLVELKTKRGA* |
| JGIcombinedJ26739_1004844292 | 3300002245 | Forest Soil | KRKVAHSEAVSQAKSEIAGDNLEDRLAALDKQDRIEQLLAELKSKRGA* |
| JGIcombinedJ26739_1011884472 | 3300002245 | Forest Soil | REQAIGGAKAQLLADDVEDRLAALEKEDRIEQLLAELKTKRGA* |
| JGI26346J50198_10140491 | 3300003351 | Bog Forest Soil | SEEAIGGAKAQLLADDVEDRLAALEKEDRIEQLLTELKTKRGA* |
| Ga0062389_1016912072 | 3300004092 | Bog Forest Soil | KRKVDREEALSEAKVQLLADDVEDRIAALEKQDRIEQLLTELKTKRGA* |
| Ga0063455_1016866721 | 3300004153 | Soil | VAHNEAVSHAKSELGADDVEDRLSAIEKEDRIEQLLAEMKSKHA* |
| Ga0062592_1013400571 | 3300004480 | Soil | AEAHSQAKSEIAADDVEERLAALEKEDRIEQLLTELKAKRGA* |
| Ga0068918_12456642 | 3300004603 | Peatlands Soil | IGGAKAQLLADDVEDRLAALEKEDRIEQLLTELKTKRGA* |
| Ga0070682_1010702911 | 3300005337 | Corn Rhizosphere | DRMKRKVAHAEALSQAKSEIAAEDMEGRLAGLEKEDRIEQLLAELKAKHA* |
| Ga0070711_1007074972 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VREEAVSQAKADIAVDDVEDRLAALEKEDRIEQLLGELKAKRRA* |
| Ga0066682_101000131 | 3300005450 | Soil | SQAKSEIALADDVEGRFAALEKEDRIEQLLAELKARRGG* |
| Ga0070678_1008960112 | 3300005456 | Miscanthus Rhizosphere | HAEAHSQAKSEIAADDVEERLAALEKEDRIEQLLTELKAKRGA* |
| Ga0070681_100693761 | 3300005458 | Corn Rhizosphere | AHAEAHSQAKSEIAADDVEERLAALEKEDLIEQLLTELKAKRGA* |
| Ga0070707_1006014253 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | EAVSQAKSEIAGDNLEDRLAALEKEEHIDKLLAELKTRRGVA* |
| Ga0070735_107414382 | 3300005534 | Surface Soil | AHSEALSQAKSEIAGDNIEDRLAALEKQDRIEQLLAELKTKRGA* |
| Ga0070697_1021198972 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | EATSQAKSELAADDVEDRLAALEREDRIEQLLSELKTKRGA* |
| Ga0070733_109555272 | 3300005541 | Surface Soil | QAKAEIAGDNMEDRLAALEKEDRIEQLLAELKGKRGA* |
| Ga0066700_102711263 | 3300005559 | Soil | MSQAKSEIAADNVEERLAALEKEDRIEQLLVELKAKRGA* |
| Ga0068855_1009911881 | 3300005563 | Corn Rhizosphere | LSQAKGEIASDNIEDRLAALEKEDRIEHLLAELKSKRGA* |
| Ga0066702_101466841 | 3300005575 | Soil | KSEIAGDNLDDRLAALEKEDRIEQLLVELKTKRGA* |
| Ga0070762_101201843 | 3300005602 | Soil | ALGEAKVQLLADDVEDRIAALEKEDRIEQLLTELKAKRGA* |
| Ga0070762_112364141 | 3300005602 | Soil | SGAKAQILADDVEDRLAALEKEDRIEQLLAELKTRRGA* |
| Ga0070762_113080751 | 3300005602 | Soil | EAASQAKSEIAGDNLDDRLAALEKEDRIEQLLADLKSKRGA* |
| Ga0070766_110400961 | 3300005921 | Soil | KVAHSEALSHAKSEIAADNMEERLAALEKEDRIEQLLVELKTKRGA* |
| Ga0070717_110302642 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | IHSEAVSQAKSEIAGDNMEDRLAALAKEDRIEQLLAELKTRKAAERTT* |
| Ga0066651_100908731 | 3300006031 | Soil | VAHAEAHSHAKAQIAAEDIEHRLSALEKEDRIEQALVELKTRRGA* |
| Ga0075023_1001096431 | 3300006041 | Watersheds | AEAHSQAKSEIAADDVEERLAALEKEDRIEQLLTELKTKRGA* |
| Ga0066652_1011321803 | 3300006046 | Soil | VSQAKSELGADDVEDRLTAIEKEDRIEQLLAEMKAKRA* |
| Ga0075029_1000818561 | 3300006052 | Watersheds | REEAIGGAKAQLLADDVEDRLAALEKEDRIEQLLTELKTKRGA* |
| Ga0075029_1001954365 | 3300006052 | Watersheds | VSQAKSEIAGDNLDDRLAALEKEDRIEQLLVELKSKRGA* |
| Ga0075017_1001895381 | 3300006059 | Watersheds | AHSEAVSQAKSEIASDNIEDRLAALEKEDRIEQLLTELKTKRGA* |
| Ga0075017_1010044432 | 3300006059 | Watersheds | SQAKSEIASDNIEDRLAALEKEDRIEQLLAELKTKRGA* |
| Ga0075017_1013678642 | 3300006059 | Watersheds | AVGQAKAELLADDVDDRLAALEKEDRIEHLLAELKAKRGA* |
| Ga0075019_102563613 | 3300006086 | Watersheds | SQAKSEIAGDNLDDRLAALEKEDRIEQLLADLKAKRGA* |
| Ga0075015_1000157851 | 3300006102 | Watersheds | VSQAKSEIASDNIEDRLAALEKEDRIEQLLTELKTKRGA* |
| Ga0070715_105948991 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | KSEIAADNIEDRLAALEKQDRIEQLLVELKSRRGA* |
| Ga0070716_1008636172 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | EAVSQAKGEIASDNMEDRLAALEKEDRIEHLLAELKSKRGA* |
| Ga0070716_1015328542 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | KRKVAHNEAVSHAKSELGADDVEDRLTAIEKEDRIEQLLAEMKSKHA* |
| Ga0070712_1006685983 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | HSEAVSQAKGEIASDNMEDRLAALEKEDRIEHLLAELKSKRGA* |
| Ga0070765_1008077251 | 3300006176 | Soil | VGQAKAEIAGDNMEDRLAALEKEDRIERLLAELKGKRGA* |
| Ga0075021_110120681 | 3300006354 | Watersheds | SQAKAELAVDNVEDRLAALEKEDRIDQLLGELKAKRGV* |
| Ga0075527_100757743 | 3300006640 | Arctic Peat Soil | SQAKSEIAGDNLDDRLAALEKEDRIEQLLADLKSKRGA* |
| Ga0079222_122994002 | 3300006755 | Agricultural Soil | AHSEAISQAKSEIAADNIEDRLAALEKQDRIEQLLAELKTKRGA* |
| Ga0066665_109249841 | 3300006796 | Soil | KAEIAADDMEDRLAALEKEDRIEQLLADMKARRGA* |
| Ga0066660_107268521 | 3300006800 | Soil | EAHSQGKSEIAADNIEERLAALEKEDRIEQLLAELKTRRGA* |
| Ga0075424_1016544822 | 3300006904 | Populus Rhizosphere | KSEIASDNLEDRLSALEKEDRIEQLLNDLKAKRGA* |
| Ga0066710_1016965471 | 3300009012 | Grasslands Soil | NEAVSQAKSELGADDVEDRFMAMEKSDRIEQLLAEMKARHA |
| Ga0066710_1028686151 | 3300009012 | Grasslands Soil | AAEDMEDRLAALEKEDRIEQLLAEMKAKRGAERTT |
| Ga0099829_110147721 | 3300009038 | Vadose Zone Soil | KAQLLADDVEDRLAALEKEDRIEQLLTELKTKRGA* |
| Ga0099829_114254121 | 3300009038 | Vadose Zone Soil | SQAKSEMAGDNLDDRLAALEKEEHIDKLLAELKTRRGVA* |
| Ga0105240_100303501 | 3300009093 | Corn Rhizosphere | MKRKVAHNEAVSHAKSELGADDVEDRLTAIEKEDRIEQLLAEMKSKHA* |
| Ga0066709_1044952151 | 3300009137 | Grasslands Soil | NEAVSQAKSEIGAEDIEDRLTAIEKEDRIEQLLAEMKAKRA* |
| Ga0105243_118787591 | 3300009148 | Miscanthus Rhizosphere | AHSQAKSEIAADDVEERLAALEKEDRIEQLLTELKVKRGA* |
| Ga0116222_11878401 | 3300009521 | Peatlands Soil | AHSEAVSQAKSEIAADNIDDRLAALEKQDRIERLLAELKTQRGA* |
| Ga0116218_11724281 | 3300009522 | Peatlands Soil | VAHASALSQAKSELAADDMEGRLAQLEKDDRIEQLLGELKMKRGE* |
| Ga0116221_10543081 | 3300009523 | Peatlands Soil | EAIGGAKAQLLADDVEDRLAALEKEDRIEQLLTELKTKRGA* |
| Ga0116220_100299061 | 3300009525 | Peatlands Soil | AREEAIGGAKAQLLADDAEDRLAALEKEDRIEQLLTELKTKRGA* |
| Ga0116136_10160256 | 3300009547 | Peatland | DRMKRKVAHSEALSEAKSEIAGDNMEDRLAALDKEDRIEQLLAELKGKRA* |
| Ga0105238_102811973 | 3300009551 | Corn Rhizosphere | FDRMKRKVAHNEAVSHAKSELGTDDIEDRLTANEKEDRIEQLLAEMKSKHA* |
| Ga0105238_120627811 | 3300009551 | Corn Rhizosphere | HVEAHSQAKSEIATDDVEERLAALEKEDRIEQLLTELKTKRGA* |
| Ga0116124_11771632 | 3300009634 | Peatland | AKAQLLADDVEDRLAALEKEDRIEQLLTELKTKRGA* |
| Ga0116224_101245421 | 3300009683 | Peatlands Soil | EAVSQAKSEIAADNIDDRLAALEKQDRIERLLAELKTQRGA* |
| Ga0116216_103587301 | 3300009698 | Peatlands Soil | AKSEMAADNLDDRLAALEKEDRIEQLLAELKTKRGA* |
| Ga0116217_101447701 | 3300009700 | Peatlands Soil | AREEAIGGAKAQLLADDVEDRLAALEKEDRIEQLLTELKTKRGA* |
| Ga0116219_101373271 | 3300009824 | Peatlands Soil | SQAKSEIAADNIDDRLAALEKQDRIERLLAELKTQRGA* |
| Ga0126380_107759661 | 3300010043 | Tropical Forest Soil | QAKSELAIDEVEDRLAALEKEDRIEQLLGELKAKRGA* |
| Ga0126384_118092102 | 3300010046 | Tropical Forest Soil | EATSQAKSELVVDNVEDRLAALEKEDRIEQLLAELKSRRA* |
| Ga0126373_104671294 | 3300010048 | Tropical Forest Soil | AKSEIAAENIEDRLAALDKQDRIEQLLAELKSRRGA* |
| Ga0126373_114814093 | 3300010048 | Tropical Forest Soil | FDRMKRKVAHNEAVSQAKSELSAADIEDRLTAIEKEDRIEQLLAELKAKHA* |
| Ga0134109_100503901 | 3300010320 | Grasslands Soil | HSHAKAQIAAEDIEHRLSALEKEDRIEQALVELKTRRGA* |
| Ga0134063_103837241 | 3300010335 | Grasslands Soil | EAVSQAKSELGADDVEDRFMAMEKSDRIEQLLAEMKARHA* |
| Ga0074045_104047831 | 3300010341 | Bog Forest Soil | AHSEAVSQAKSEIEGDNLDDRLAALEKEDRIEQLLAELKTKRGA* |
| Ga0126378_103168081 | 3300010361 | Tropical Forest Soil | AHNEAVSQAKSEMGAEDVEDRLTAMEKEDRIEQLLAEMKAKQG* |
| Ga0126379_131126121 | 3300010366 | Tropical Forest Soil | TEAQSKAKSEITSEHLEDRLSELEKEDRIEQLLKDLKAKRGA* |
| Ga0134125_117744662 | 3300010371 | Terrestrial Soil | QAKSELGADDVEDRFATIEKADRIEQLLAEMKAKRA* |
| Ga0105239_124896212 | 3300010375 | Corn Rhizosphere | DRMKRKVAHTSALSQAKSEIAADDVEDRLAAVEKEDKIEQLLAELKAKQA* |
| Ga0126381_1006758611 | 3300010376 | Tropical Forest Soil | EAVSQAKSELATDDVEDRLAALEKEDRIEQLLGELKAKRGG* |
| Ga0126381_1012955762 | 3300010376 | Tropical Forest Soil | VSQAKSEIGAEDVEDRLTAMEKEDRIEQLLAEMKAKQG* |
| Ga0126381_1023040611 | 3300010376 | Tropical Forest Soil | MKRKVAHAEAVSQAKSEIAAENIEDRLAALEKQDRIEQLLAELKSRRGA* |
| Ga0126381_1028420492 | 3300010376 | Tropical Forest Soil | FDRMKHKVAHSEAMSQAKSEIAADNIEDRLAALEKQDRIEQLLADLKTKRGA* |
| Ga0126381_1033928881 | 3300010376 | Tropical Forest Soil | SEIAAESIDDRLAALEKQDRIEQLLAELKTKRGA* |
| Ga0126381_1050696261 | 3300010376 | Tropical Forest Soil | DRMKHKVAHSEAVSQAKSEIAADNIEDRLAALEKQDRIEQLLAELKTKRGA* |
| Ga0126381_1051170111 | 3300010376 | Tropical Forest Soil | LSQAKSEIAADNMEERLAALEKQDRIEQLLVELKTKRGA* |
| Ga0136449_1033277952 | 3300010379 | Peatlands Soil | SQAKSEIAGDNLDDRMAALEKQDRIEQLLAELKQKRGA* |
| Ga0136449_1034703261 | 3300010379 | Peatlands Soil | RMKRKVAHSEAVSQAKSEIAAANLDDRLAALEKQDRIEQLLAELKTKRGA* |
| Ga0136449_1045044842 | 3300010379 | Peatlands Soil | GGAKAQLLAEDVEDRLAALEKEDRIEQLLAELKTKRGA* |
| Ga0134127_132636881 | 3300010399 | Terrestrial Soil | MKRKVAHNEAVSQAKSELGADDVEDRFATIEKADRIEQLLAEMKAKHA* |
| Ga0137776_14236321 | 3300010937 | Sediment | SQAKAEIAADDVEGRLAALEKEDRIEQLLAELKTKRGA* |
| Ga0150983_101931011 | 3300011120 | Forest Soil | SLAKSEIASDNMEERLAALEKEDRIEQLLVELKSKRGA* |
| Ga0150983_123297291 | 3300011120 | Forest Soil | HSEALSQAKSEIAADNMEERLAALEKEDRIEQLLVELKTKRGA* |
| Ga0150983_125451241 | 3300011120 | Forest Soil | SQAKSEMAADDVDDRLAALEKEDKIERLLVELKAKRGA* |
| Ga0137391_108534871 | 3300011270 | Vadose Zone Soil | EEAIGGAKAQLLADDVEDRLAALEKEDRIEQLLTELKTKRGA* |
| Ga0137391_115210891 | 3300011270 | Vadose Zone Soil | QRNEAVSQAKSEMGAEDIEDRLTAIEKEDRIEQLLAEMKAKRG* |
| Ga0120139_11954331 | 3300012019 | Permafrost | VSADGRGLKRGRAEAHSQAKSEIASDNVEERLAALEKEDRIEQLLVEMKAKRGA* |
| Ga0137388_117769842 | 3300012189 | Vadose Zone Soil | SQAKSEIAADNVEERLAALVKEDRIEQLLVELKTKRGA* |
| Ga0137365_108455883 | 3300012201 | Vadose Zone Soil | VAHNEAVSQAKSELGADDVEDRFMAMEKSDRIEQLLAEMKARHA* |
| Ga0137380_110792302 | 3300012206 | Vadose Zone Soil | VSQAKSELGDEDIEGRLTAIEKEDRIEQLLAEMKAKQA* |
| Ga0137376_108423831 | 3300012208 | Vadose Zone Soil | KRKVAHAEAHSHAKAQVAAEDIEHRLSALEKEDRIEQALVELKTRRGA* |
| Ga0137376_117674431 | 3300012208 | Vadose Zone Soil | AMSQAKSEIAADNVEERLAALEKEDRIEQLLVELKAKRGA* |
| Ga0137379_101143047 | 3300012209 | Vadose Zone Soil | VSQAKSEIAGDNLDDRLAALEKEDRIEQLLVELKTKRGA* |
| Ga0137378_104878772 | 3300012210 | Vadose Zone Soil | RNEAVSQAKSEIGAEDIEDRLTAIEKEDRIEQLLAEMKAKRA* |
| Ga0137378_112199623 | 3300012210 | Vadose Zone Soil | QAKAELLADDVDDRFAAIEKEGEIDRLLAEIKSKRR* |
| Ga0137387_100118696 | 3300012349 | Vadose Zone Soil | EAMSQAKSEIAGDNVEERLAALEREDRIEQLLVELKAKRGA* |
| Ga0137366_101822481 | 3300012354 | Vadose Zone Soil | MSQAKSEIASDNIEDRLAALEKHDRIEQLLAELKEKRGA* |
| Ga0137371_113605441 | 3300012356 | Vadose Zone Soil | AKSEIGAEDIEDRLTAIEKEDRIEQLLAEMKANRA* |
| Ga0137384_105028552 | 3300012357 | Vadose Zone Soil | DRMKRKVAHNEAVSQAKSELGADDVEDRFMAMEKSDRIEQLLAEMKARHA* |
| Ga0137390_101731803 | 3300012363 | Vadose Zone Soil | RMKRKVAHADAHSQAKSEIAVEDLEERLAVLEKEDRIEQLLAELKTKRGA* |
| Ga0137390_115839552 | 3300012363 | Vadose Zone Soil | VAREEAIGGAKAQLLADDVEDRLAALEKEDRIEQLLTELKTKRGA* |
| Ga0150984_1077958002 | 3300012469 | Avena Fatua Rhizosphere | MKRKVAHSEAVSQAKGEIVADNIEDRLAALEKQDRIEQLLAELKAKRGA* |
| Ga0150984_1228797711 | 3300012469 | Avena Fatua Rhizosphere | QAKSEMAADNVEDRLAELEKEDRIEQLLAELKTKRGA* |
| Ga0137395_102328351 | 3300012917 | Vadose Zone Soil | FDRMKNKVQRNEAVSQAKSEIGAEDIEDRLTAIEKEDRIEQLLAEMKAKRA* |
| Ga0137395_102370981 | 3300012917 | Vadose Zone Soil | KRKVTHSEAVSQAKSEIAGDNMEDRLAALAKEDRIEQLLAELKTRKAAERTT* |
| Ga0137407_122506781 | 3300012930 | Vadose Zone Soil | KAELLADDVEDRLAALEKEDRIEQLLTDLKTKRGA* |
| Ga0137407_123081841 | 3300012930 | Vadose Zone Soil | SQAKSEIAADDVEDRLAALEKEDRIEQLLVELKAKQGA* |
| Ga0137410_104568491 | 3300012944 | Vadose Zone Soil | SEVATDDVEERLAALEKEDRIDQLLAELKTKRGA* |
| Ga0137410_109518341 | 3300012944 | Vadose Zone Soil | HAQAHSQAKSEIAADDMEERLAALEKEDRIEQLLAELKTKRGV* |
| Ga0126375_109521881 | 3300012948 | Tropical Forest Soil | KVAHSEAMSQAKSEIAADNIEDRLAALEKQDRIEQLLAELKTKRGA* |
| Ga0164304_103951151 | 3300012986 | Soil | HSQAKSEIAADDVEERLAMLEKGDRLEQLLAELKTKRGA* |
| Ga0164304_106120802 | 3300012986 | Soil | HSQAKSESAADDVEERLAALEKEDRIEQLLTELKAKRGA* |
| Ga0164306_114647472 | 3300012988 | Soil | AEAHSQAKSEIAADDVEERLAALEKEDLIEQLLTELKAKRGA* |
| Ga0157374_119342292 | 3300013296 | Miscanthus Rhizosphere | SQAKSELAANDVEDRLAALEKEDQLDKLLADLKARRGVTA* |
| Ga0157374_125065521 | 3300013296 | Miscanthus Rhizosphere | RNVAHSEAVSQAKSEIASDNLEDRLAALEKQDRIEQLLSDLKAKRGA* |
| Ga0157372_120825751 | 3300013307 | Corn Rhizosphere | EAVSHAKSELGADDVEDRLTAIEKEDRIEQLLAEMKSKHA* |
| Ga0181521_105277802 | 3300014158 | Bog | GGAKAQLLADDVEDRLAALEKEDRIEQLLTELKTKRGA* |
| Ga0181531_102440721 | 3300014169 | Bog | KRKVAHSEALSQAKSEIAGDNLDDRLAALEKHDRIEQLLAELKGKRGA* |
| Ga0181531_103382031 | 3300014169 | Bog | AREEAVGQAKTELLADDVEDRLAALEKENRIEQLLTELKTKRGA* |
| Ga0182019_101557512 | 3300014498 | Fen | KSELAANDMEGRLAILEKQDRIEQLLAEMKAKRSLTS* |
| Ga0182021_121136761 | 3300014502 | Fen | AKSEVAAGDMEDRLAALEKEDRIEQLLADLKAKRGA* |
| Ga0181525_101727941 | 3300014654 | Bog | SIPQGEAKAEIAGDNMEDRLAALEKEDRIEQLLAELKGKRGA* |
| Ga0167668_10598911 | 3300015193 | Glacier Forefield Soil | KRKVARSEAVSQAKSEIAGDNLEDRLAALDKEDRIEQLLAELKTKRGA* |
| Ga0132255_1021006042 | 3300015374 | Arabidopsis Rhizosphere | VASAEAHSQAKSEIAVDNVEERLAALEKEDRIEQLLAELKTRRGA* |
| Ga0182035_118837791 | 3300016341 | Soil | RMKRKVAHSEAVSQAKSEIAADNIEDRLAALEKQDRIEQLLAELKTKRGA |
| Ga0181511_13113481 | 3300016702 | Peatland | VSQAKSEIAADNLDDRMAALEKEDRIEQLLAELKTKRGA |
| Ga0187818_100647871 | 3300017823 | Freshwater Sediment | REEAIGGAKAQLLADDVEDRLAALEKEDRIEQLLAELKTKRGA |
| Ga0187818_101129733 | 3300017823 | Freshwater Sediment | QAKAELLADDVDDRLAALEKEDRIEQLLTELKAKRGA |
| Ga0187814_103964002 | 3300017932 | Freshwater Sediment | AREEAVGQAKAELLADDVEDRLAVLEKEDRIEQLLAELKAKRGA |
| Ga0187879_103364943 | 3300017946 | Peatland | EAKSEIAGDNMEDRLAALEKEDRVEQLLAELKGKRGA |
| Ga0187783_101260413 | 3300017970 | Tropical Peatland | AQSEVAAEDIETRLAELEKQDRIEQLLTELKAKRGV |
| Ga0187783_102091453 | 3300017970 | Tropical Peatland | EEALSHAKSEVAAEDIETRLAELEKQDRIEQLLTELKAKRGV |
| Ga0187781_105764181 | 3300017972 | Tropical Peatland | HKVAHEEALSHAKSEVAAQDIETRLAELEKQDRIEQLLTELKAKRGV |
| Ga0187782_103575773 | 3300017975 | Tropical Peatland | VSQAKSEIASDNLEDRLAVLEKEDRIEQLLAELKQKRGA |
| Ga0187816_105077882 | 3300017995 | Freshwater Sediment | EEAIGGAKAQLLAEDVEDRLAALEKEDRIEQLLAELKTKRGA |
| Ga0187805_103812481 | 3300018007 | Freshwater Sediment | RMKRKVAHSEAVSQAKSVIAAENIEDRLAALEKQDRIEQLLAELKSRRGA |
| Ga0187885_100631471 | 3300018025 | Peatland | KAQLLADDVEDRLAALEKEDRIEQLLTELKTKRGA |
| Ga0187784_100369646 | 3300018062 | Tropical Peatland | AIGGAKAQLLADDVEDRLAALEKEDRIEQLLAELKTKRGA |
| Ga0187772_115084752 | 3300018085 | Tropical Peatland | MKRKVAHSEAMSQAKSEIASDNLEDRLAKLEKEDRIEQLLAELKTKRGA |
| Ga0187770_100363621 | 3300018090 | Tropical Peatland | KAELAADNLEDRLAALEKEDRIEQLLAELKAKRGGSSN |
| Ga0066662_125546862 | 3300018468 | Grasslands Soil | MKRKVAHNEAVSQAKSELGADDVEDRLIAIEKEDRIEQLLAEMKARHA |
| Ga0187800_16445183 | 3300019278 | Peatland | VSQAKSEITGENIDDRLAALEKEDRIEQLLVELKSKRGA |
| Ga0193729_12714921 | 3300019887 | Soil | HAEAHSQAKSEIAADDVEERLAALEREDRIEQLLTELKTKRGA |
| Ga0193751_10756293 | 3300019888 | Soil | VAHSEAVGQAKSEIAGDNLEDRLAALDKEDRIEQLLAELKTKRGA |
| Ga0193728_12855891 | 3300019890 | Soil | VAHAQATSQAKSEIAADNMEDRLMALEREDRIEQLLAELKTKRGA |
| Ga0193728_12886302 | 3300019890 | Soil | QAKSELGDEDIEDRLTAFEKEDRIEQLLAEMKAKHA |
| Ga0193726_10185964 | 3300020021 | Soil | KSEIAADNMDDRLAALEKEDRIEQLLVELKSKRGA |
| Ga0210403_105481511 | 3300020580 | Soil | EEAVSQAKAEIAVDNVEDRLAALEKEDRIEQLLSELKTKRGA |
| Ga0210403_106141222 | 3300020580 | Soil | AKSEIGDDDIEGRLNAIEKDDRIEQLLAEMKAKQG |
| Ga0210399_115464471 | 3300020581 | Soil | VAHSEALSHAKSEIASDNMEERLAALEKEDRIEQLLVELKTKRGA |
| Ga0210406_100643165 | 3300021168 | Soil | EEAIGGAKAQLLADDVEDRLAALEKEDRIEQLLTELKTKRGA |
| Ga0210406_105856653 | 3300021168 | Soil | AREEAIGGAKAQLLADDVEDRLAALEKEDRIEQLLTELKTKRGA |
| Ga0210405_102057812 | 3300021171 | Soil | SQAKSEIASDNMEERLAALEKEDRIEQLLAELKTKRGA |
| Ga0210405_107876561 | 3300021171 | Soil | KSEMAADDVDDRLAALEKEDKIERLLVELKAKRGA |
| Ga0210408_107970431 | 3300021178 | Soil | KVAHSEALSHAKSEIAADNMEERLAALEKEDRIEQLLVELKTKRGA |
| Ga0210396_107008191 | 3300021180 | Soil | SQAKSEIAADNIEDRLAALEKQDRIEQLLVELKTRRGA |
| Ga0210388_101703541 | 3300021181 | Soil | QAKSEIAGDNMEERLAALEKEDRIEQLLVELKTKRGA |
| Ga0210388_111125512 | 3300021181 | Soil | AKAQILADDVEDRLAALEKEDRIEQLLAELKTRRGA |
| Ga0210393_114480961 | 3300021401 | Soil | SEAVSQAKAEIASDDVETRLAALEKEDRIEQLLTELKTRRGA |
| Ga0210389_102613743 | 3300021404 | Soil | EALSQAKSEIASDNIEDRLAALEKQDRIEQLLVELKTRRGA |
| Ga0210387_105257983 | 3300021405 | Soil | AHEEAIGGAKAQILANDVEDRLAALEKEDRIEQLLAELKTKRGA |
| Ga0210384_1000253421 | 3300021432 | Soil | LSQAKSEIAADNIEDRLAALEKQDRIEQLLVELKTRRGA |
| Ga0210384_107861182 | 3300021432 | Soil | EALSQAKSEIATDNMEERLAALEKEDRIEQLLVELKTKRGA |
| Ga0210391_109039771 | 3300021433 | Soil | VAHSEAVSQAKSEIAGDNLEDRLAALDKQDRIEQLLAELKSKRGA |
| Ga0210390_107276151 | 3300021474 | Soil | AVSQAKSEIAGDNLDDRLAALEKEDRIEQLLAELKTKRGA |
| Ga0210390_107312161 | 3300021474 | Soil | AHSEAGSQAKSEIAGDNLDDRLAALEKEDRIEQLLAELKTKRGA |
| Ga0210402_115938661 | 3300021478 | Soil | DRMKRKVAHNEAVSQAKSELGADDVEDRLTAIEKEDRIEQLLAEMKSKHA |
| Ga0210409_100610246 | 3300021559 | Soil | KSEIAADNMEARLAALEKEDRIEQLLVELKTKRGA |
| Ga0210409_113664671 | 3300021559 | Soil | AVSQAKSEIAGDNLDDRLAALEKEDRIEQLLADLKAKRGA |
| Ga0126371_123813461 | 3300021560 | Tropical Forest Soil | DRMKHKVAHNEAVSQAKSELGTDDVEDRFATIEKADKIEQLLAEMKSRHA |
| Ga0224571_1010231 | 3300022734 | Rhizosphere | KSEIAGDNMEDRLAALEKEDRIEQLLAELKTKRGA |
| Ga0207643_109661222 | 3300025908 | Miscanthus Rhizosphere | AHSQAKSEIAADDVEERLAALEKEDRIEQLLTELKAKRGA |
| Ga0207684_112054482 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VSLAKSELGADDVEDGIATIEKADRIEQLLAEMKAKRA |
| Ga0207654_102665643 | 3300025911 | Corn Rhizosphere | NEAVSQAKSELGADDVEDRFATIEKADRIEQLLAEMKAKRA |
| Ga0207695_103405432 | 3300025913 | Corn Rhizosphere | MKRKVAHNEAVSHAKSELGADDVEDRLTAIEKEDRIEQLLAEMKSKHA |
| Ga0207663_111691112 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | HNEAVSQAKSELGADDVEDRFATIEKADRIEQLLAEMKAKHA |
| Ga0207646_103936111 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | HAEAVSQAKSEIAGDNLEDRLAALEKEEHIDKLLAELKTRRGVA |
| Ga0207665_108117061 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | AVGQAKAELLADDVEDRLAALEKEDRIEQLLTDLKTKRGA |
| Ga0207677_102596861 | 3300026023 | Miscanthus Rhizosphere | AQATSELVADDVEMRLAALEKEDRINQLLAELKTKRGA |
| Ga0207698_107718214 | 3300026142 | Corn Rhizosphere | SQAKSEIAADDVEDRLAALEKEDKIEQLLAELKAKQA |
| Ga0209055_12882052 | 3300026309 | Soil | EIAGDNMEDRLAALEKEDRIEQLLAELKTKKGAERTT |
| Ga0209686_10626861 | 3300026315 | Soil | HSHAKAQIAAEDIEHRLSALEKEDRIEQALVELKTRRGA |
| Ga0209155_10803291 | 3300026316 | Soil | AHSHAKAQIAAEDIEHRLSALEKEDRIEQALVELKTRRGA |
| Ga0209158_10694841 | 3300026333 | Soil | EAHSHAKAQIAAEDIEHRLSALEKEDRIEQALVELKTRRGA |
| Ga0209377_13292221 | 3300026334 | Soil | ALSHAKAEIAADDMEDRLAALEKEDRIEQLLAEMKAKRGAERTT |
| Ga0257180_10207331 | 3300026354 | Soil | GAKAQLLADDVEDRLAALEKEDRIEQLLTELKTKRGA |
| Ga0209056_105753502 | 3300026538 | Soil | KAEIAADDMEDRLAALEKEDRIEQLLADMKARRGA |
| Ga0208043_11406302 | 3300027570 | Peatlands Soil | VSQAKSEIAADNIDDRLAALEKQDRIERLLAELKTQRGA |
| Ga0209525_10965691 | 3300027575 | Forest Soil | KSEIAGSDINDRLAALEKEDRIEQLLSELKQKRGA |
| Ga0209525_11282151 | 3300027575 | Forest Soil | AKSEIAADNIEERLAMLEKDERIEQLLAELKQKRGA |
| Ga0209118_10348613 | 3300027674 | Forest Soil | AIGGAKAQLLADDVEDRLAALEKEDRIEQLLTELKTKRGA |
| Ga0209118_10725021 | 3300027674 | Forest Soil | AKSEMAADDVEDRLTALEKEDKIERLLVELKAKRGA |
| Ga0209011_10627631 | 3300027678 | Forest Soil | GGAKAQLLADDVEDRLAALEKEDRIEQLLTELKTKRGA |
| Ga0209446_11859132 | 3300027698 | Bog Forest Soil | EEAIGEAKVQLLADNVEDRIAALEKEDRIEQLLTELKTKRGA |
| Ga0208989_100966663 | 3300027738 | Forest Soil | HSEAIGQAKAEIVADNMDDRLAALEKEDRIEQLLAELKGKRGA |
| Ga0209810_11386823 | 3300027773 | Surface Soil | NEAVSHAKSELGADDVEDRLTAMEKEDRIEQLLAEMKAKRA |
| Ga0209580_100829671 | 3300027842 | Surface Soil | AKSEIASDNIDDRLAALEKQDRIEQLLAELKTKRGA |
| Ga0209517_102151191 | 3300027854 | Peatlands Soil | EAISGAKAQLLADDVENRLAALEKEDRIEQLLSELKTKRGA |
| Ga0209167_101270181 | 3300027867 | Surface Soil | QAKSEIASDNIEDRLAALEKQDRIEQLLTELKAKRGA |
| Ga0209167_101591671 | 3300027867 | Surface Soil | QAKSEIASDNIEDRLAALEKQDRIEQLLAELKTKRGA |
| Ga0209380_107930472 | 3300027889 | Soil | VSQAKAEIAVDDVEDRLAALEKEDRIEQLLTELKTKRGA |
| Ga0209068_103672353 | 3300027894 | Watersheds | EAVGQAKAEILADDVEDRLAALEKEDRIEQLLVELKTKRGA |
| Ga0209488_101138234 | 3300027903 | Vadose Zone Soil | QAKAELLADDVEDRLAALEKEDRIEQLLTELKTKRGA |
| Ga0209415_105124531 | 3300027905 | Peatlands Soil | AKAQLLADDVEDRLAALEKEDRIEQLLTELKTKRGA |
| Ga0209583_101363703 | 3300027910 | Watersheds | AHSQAKSEIAADDVEERLAALEKEDRIEQLLTELKTKRGA |
| Ga0209698_101423901 | 3300027911 | Watersheds | VAHSEALSQAKSEIAADNIEDRLAALEKQDRIEQLLVELKSKRGA |
| Ga0209698_107221412 | 3300027911 | Watersheds | ATAQAKSELAADNLEDRLAALDKEDRIEQLLAELKTKRGA |
| Ga0268266_102054553 | 3300028379 | Switchgrass Rhizosphere | SQAKSEIAADDVEERLAALEKEDRIEQLLTELKAKRGA |
| Ga0307504_104846601 | 3300028792 | Soil | REEVVGQAKAELLADDVEDRLAALEKEDRIEQLLTDLKTKRGA |
| Ga0302222_100574954 | 3300028798 | Palsa | VGQAKAEIAGDNMEDRLAALEKEDRIEQLLAELKTRRGA |
| Ga0302155_102130342 | 3300028874 | Bog | KAQLLSEDVEDRLAALEKEDRIEQLLTELKTKRGA |
| Ga0308309_106494872 | 3300028906 | Soil | EAVSQAKAEIASDDVETRLAALEKEDRIEQLLTELKTRRGA |
| Ga0222749_106901233 | 3300029636 | Soil | GQAKAEIAGDNMEDRLAALEKEDRIEQLLAELKTRRRA |
| Ga0311343_102881371 | 3300029953 | Bog | REEAIGGAKAQLLAEDVEDRLAALEKEDRIEQLLTELKTKRGA |
| Ga0311338_103079765 | 3300030007 | Palsa | KSEIAGDNIDDRLAALEKEDRIEQLLVELKTKRGA |
| Ga0302175_100234811 | 3300030014 | Fen | QAKAELLADDVEDRLAALEKEDRIEQLLTDLKTKRGA |
| Ga0302306_103021432 | 3300030043 | Palsa | KAQLLAEDVEDRLAALEKEDRIEQLLTELKAKRGA |
| Ga0311360_113886183 | 3300030339 | Bog | KAELLADDVEDRLAALEKEDRIEQLLTDLKTKRGA |
| Ga0302193_104110781 | 3300030519 | Bog | QAKAEIAGDNMEDRLAALEKEDRIEQLLAELKTKRGA |
| Ga0311354_113756843 | 3300030618 | Palsa | AVSQAKSEIAGDNLDDRLAALEKEDRIEQLLAELKVKRGA |
| Ga0210250_103324712 | 3300030632 | Soil | LGQAKAEIAGDNMEDRLAALEKEDRIEQLLAELKGKRGAQTADRRV |
| Ga0310038_103613601 | 3300030707 | Peatlands Soil | EALSQAKSEIAADNMEERLAALEKEDRIEQLLVELKTKRGA |
| Ga0302310_102774451 | 3300030737 | Palsa | QAKSEIAGDNVEDRLAALEKEDRIERLLAELKTKRGA |
| Ga0265753_11090712 | 3300030862 | Soil | HSEALSQAKSEIATDNMEERLAALEKEDRIEQLLVELKTKRGA |
| Ga0170824_1161491543 | 3300031231 | Forest Soil | AHSAAVGQAKAEIAGDNMEDRLAALEKEDRIEQLLTELKGRRRA |
| Ga0170824_1255001152 | 3300031231 | Forest Soil | NEAVSQAKSEMGDEDIEDRLTAIEKEDRIEQLLAEMKAKQG |
| Ga0265339_100840244 | 3300031249 | Rhizosphere | KSEIAGDNIDDRLAALEKEDRIEQLLAELKTKRGA |
| Ga0170820_139512282 | 3300031446 | Forest Soil | FDRMKRKVAHNEAVSQAKSELGADDVDDRFATIEKADRIEQLLAEMKAKRA |
| Ga0310686_1146522311 | 3300031708 | Soil | VPADATSRAKLEMLGDNMDDRLAALEKDDQIEQLLAQLKAKRTG |
| Ga0307476_109401271 | 3300031715 | Hardwood Forest Soil | QAKSEIAVDDVEDRLAALEKEDRIEQLLGELKAKRGA |
| Ga0307476_112432241 | 3300031715 | Hardwood Forest Soil | HSEAVSQAKSEIAGDNLEDRLAALDKQDRIEQLLAELKSKRGA |
| Ga0318546_104401642 | 3300031771 | Soil | QAKAEIASDDVETRLAALEKEDRIEQLLSELKTRRGA |
| Ga0310917_101939431 | 3300031833 | Soil | EEAVSQAKAEIATDDVEDRLAALEKEDRIEQLLSELKAKRGA |
| Ga0306925_118941962 | 3300031890 | Soil | DRMKRKVAHSEAMSQAKSEIAADNLEDRLAALEKQDRIEQLLAELKTRRGA |
| Ga0310916_106932841 | 3300031942 | Soil | RKVAHSEAVSQAKSEIAADNIEDRLAALEKQDRIEQLLAELKTKRGA |
| Ga0310910_111670371 | 3300031946 | Soil | AHSEAISQAKSEIAADNIEDRLAALEKQDRIEQLLAELKTKRGA |
| Ga0318533_103823761 | 3300032059 | Soil | EAVSQAKAELGAEDMEDRLTAMEKEERIEQLLAELKAKQA |
| Ga0311301_101250261 | 3300032160 | Peatlands Soil | QFGQAAFEIAADDMEGRLAELEKEDRIEQLLVELKTKRGA |
| Ga0311301_105044161 | 3300032160 | Peatlands Soil | HSEALSQAKSEIAADNMEERLAALEKEDRIEQLLVELKTKRGA |
| Ga0307471_1008339831 | 3300032180 | Hardwood Forest Soil | KVELAVDDVEDRLAALEKEDRIEQLLSELKTKRGA |
| Ga0306920_1019263052 | 3300032261 | Soil | REQAVSQAKAEIAVDDVEDRLAALEKEDRIEQLLSELKSRRGA |
| Ga0335079_120891252 | 3300032783 | Soil | LLTDDVEDRLAALEKEDRIEQLLADLKTKRGTSPVIGG |
| Ga0335080_104020044 | 3300032828 | Soil | AKSELAADDVEDRLAALEKEDRIEQLLAEMKARRA |
| Ga0335070_117071753 | 3300032829 | Soil | RKVAHAEAVSDAKAEMAAANIDDRLMALEKEDKIERLLLELKGKRGA |
| Ga0335081_105225841 | 3300032892 | Soil | AKSEIAVDDMEDRLAALEKEDRIEQLLAELKSKRGA |
| Ga0335069_105662113 | 3300032893 | Soil | VSQAKSEIAADNIEDRLAALEKQDRIEQLLAELKTRRGA |
| Ga0335074_113052122 | 3300032895 | Soil | QAKSEIAAEKIEDRLAALEKEDRIEQLLAELKTKRGVAAS |
| Ga0335084_108796321 | 3300033004 | Soil | ELAAEDVEDRLAALEKEDRIEQLLAELKTKRGAERTT |
| Ga0335073_101455081 | 3300033134 | Soil | DRMKHKVAHSEAVSQAKSELAADNIEERLAALEKQDRIEQLLTELKSKRGA |
| Ga0335077_104531061 | 3300033158 | Soil | SELAADSVDERLAALEKEDRIEQLLAELKTRRGAEKPI |
| Ga0335077_117380171 | 3300033158 | Soil | AEAVSEAKSELMGDSVEERLRALERDDQIERLLAEMKARRAAK |
| Ga0335077_117919601 | 3300033158 | Soil | SEMGADSMEDRLAALEKEDKIDKLLAEIKTRRGVA |
| Ga0326728_100125981 | 3300033402 | Peat Soil | AIGGAKAQLLADDVEDRLAALEKEDRVEQLLTELKTKRGA |
| Ga0310811_102614623 | 3300033475 | Soil | VSQAKGEIASDNMEDRLAALEKEDRIEHLLAELKSKRGA |
| Ga0316620_107548011 | 3300033480 | Soil | AKAEMAGDDVEEKLAALERDDKIERMLTELKAKRQKG |
| ⦗Top⦘ |