| Basic Information | |
|---|---|
| Family ID | F013665 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 269 |
| Average Sequence Length | 45 residues |
| Representative Sequence | NDGFRMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKAASAD |
| Number of Associated Samples | 184 |
| Number of Associated Scaffolds | 269 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.25 % |
| % of genes near scaffold ends (potentially truncated) | 92.94 % |
| % of genes from short scaffolds (< 2000 bps) | 87.36 % |
| Associated GOLD sequencing projects | 168 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.539 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (29.368 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.740 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.390 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 19.18% Coil/Unstructured: 80.82% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 269 Family Scaffolds |
|---|---|---|
| PF03435 | Sacchrp_dh_NADP | 6.32 |
| PF04226 | Transgly_assoc | 6.32 |
| PF07519 | Tannase | 1.86 |
| PF13847 | Methyltransf_31 | 1.49 |
| PF00999 | Na_H_Exchanger | 1.49 |
| PF13578 | Methyltransf_24 | 1.12 |
| PF02445 | NadA | 1.12 |
| PF02687 | FtsX | 1.12 |
| PF07366 | SnoaL | 1.12 |
| PF03190 | Thioredox_DsbH | 0.74 |
| PF08543 | Phos_pyr_kin | 0.74 |
| PF06463 | Mob_synth_C | 0.74 |
| PF09969 | DUF2203 | 0.74 |
| PF10387 | DUF2442 | 0.74 |
| PF04264 | YceI | 0.74 |
| PF07238 | PilZ | 0.74 |
| PF01402 | RHH_1 | 0.74 |
| PF00903 | Glyoxalase | 0.74 |
| PF04055 | Radical_SAM | 0.74 |
| PF04255 | DUF433 | 0.74 |
| PF04972 | BON | 0.74 |
| PF13557 | Phenol_MetA_deg | 0.37 |
| PF04951 | Peptidase_M55 | 0.37 |
| PF07969 | Amidohydro_3 | 0.37 |
| PF00939 | Na_sulph_symp | 0.37 |
| PF00871 | Acetate_kinase | 0.37 |
| PF13424 | TPR_12 | 0.37 |
| PF13936 | HTH_38 | 0.37 |
| PF12704 | MacB_PCD | 0.37 |
| PF02012 | BNR | 0.37 |
| PF05185 | PRMT5 | 0.37 |
| PF07963 | N_methyl | 0.37 |
| PF14707 | Sulfatase_C | 0.37 |
| PF00005 | ABC_tran | 0.37 |
| PF05163 | DinB | 0.37 |
| PF01243 | Putative_PNPOx | 0.37 |
| PF16576 | HlyD_D23 | 0.37 |
| PF04075 | F420H2_quin_red | 0.37 |
| PF00149 | Metallophos | 0.37 |
| PF03795 | YCII | 0.37 |
| PF11746 | DUF3303 | 0.37 |
| PF00196 | GerE | 0.37 |
| PF14321 | DUF4382 | 0.37 |
| PF00294 | PfkB | 0.37 |
| PF13911 | AhpC-TSA_2 | 0.37 |
| PF13408 | Zn_ribbon_recom | 0.37 |
| COG ID | Name | Functional Category | % Frequency in 269 Family Scaffolds |
|---|---|---|---|
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 6.32 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 1.49 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 1.49 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 1.49 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 1.49 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 1.49 |
| COG0379 | Quinolinate synthase | Coenzyme transport and metabolism [H] | 1.12 |
| COG0524 | Sugar or nucleoside kinase, ribokinase family | Carbohydrate transport and metabolism [G] | 0.74 |
| COG1331 | Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains | General function prediction only [R] | 0.74 |
| COG2240 | Pyridoxal/pyridoxine/pyridoxamine kinase | Coenzyme transport and metabolism [H] | 0.74 |
| COG0351 | Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase | Coenzyme transport and metabolism [H] | 0.74 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.74 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.74 |
| COG2870 | ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.74 |
| COG2896 | GTP 3',8-cyclase (molybdenum cofactor biosynthesis protein MoaA) | Coenzyme transport and metabolism [H] | 0.74 |
| COG3426 | Butyrate kinase | Energy production and conversion [C] | 0.37 |
| COG4076 | Predicted RNA methylase | General function prediction only [R] | 0.37 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.37 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.37 |
| COG1055 | Na+/H+ antiporter NhaD or related arsenite permease | Inorganic ion transport and metabolism [P] | 0.37 |
| COG0471 | Di- and tricarboxylate antiporter | Carbohydrate transport and metabolism [G] | 0.37 |
| COG0282 | Acetate kinase | Energy production and conversion [C] | 0.37 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.54 % |
| Unclassified | root | N/A | 4.46 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig48603 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 2228664022|INPgaii200_c1046931 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101852161 | All Organisms → cellular organisms → Bacteria | 3305 | Open in IMG/M |
| 3300002909|JGI25388J43891_1000150 | All Organisms → cellular organisms → Bacteria | 13150 | Open in IMG/M |
| 3300002914|JGI25617J43924_10084367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 1150 | Open in IMG/M |
| 3300002917|JGI25616J43925_10313880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 583 | Open in IMG/M |
| 3300004152|Ga0062386_101128687 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300004633|Ga0066395_10145084 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300004633|Ga0066395_10296803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 882 | Open in IMG/M |
| 3300005174|Ga0066680_10002376 | All Organisms → cellular organisms → Bacteria | 8239 | Open in IMG/M |
| 3300005332|Ga0066388_102026862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 1033 | Open in IMG/M |
| 3300005450|Ga0066682_10385861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 899 | Open in IMG/M |
| 3300005454|Ga0066687_10890455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300005542|Ga0070732_10107014 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
| 3300005559|Ga0066700_11166072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 502 | Open in IMG/M |
| 3300005561|Ga0066699_10487727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 881 | Open in IMG/M |
| 3300005586|Ga0066691_10867392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 531 | Open in IMG/M |
| 3300005591|Ga0070761_10261157 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300005602|Ga0070762_10780135 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 645 | Open in IMG/M |
| 3300005764|Ga0066903_104334061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 758 | Open in IMG/M |
| 3300006031|Ga0066651_10041984 | All Organisms → cellular organisms → Bacteria | 2106 | Open in IMG/M |
| 3300006086|Ga0075019_10774008 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 610 | Open in IMG/M |
| 3300006176|Ga0070765_100024592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4573 | Open in IMG/M |
| 3300006755|Ga0079222_12335036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300006797|Ga0066659_10863127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 754 | Open in IMG/M |
| 3300006797|Ga0066659_11935668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 501 | Open in IMG/M |
| 3300006903|Ga0075426_11297651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 552 | Open in IMG/M |
| 3300007255|Ga0099791_10132802 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300007788|Ga0099795_10347188 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300009038|Ga0099829_10134285 | All Organisms → cellular organisms → Bacteria | 1962 | Open in IMG/M |
| 3300009038|Ga0099829_10471217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 1041 | Open in IMG/M |
| 3300009038|Ga0099829_11269475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 609 | Open in IMG/M |
| 3300009088|Ga0099830_11150377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 644 | Open in IMG/M |
| 3300009088|Ga0099830_11466181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 568 | Open in IMG/M |
| 3300009089|Ga0099828_10735613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 885 | Open in IMG/M |
| 3300009089|Ga0099828_11394884 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300009089|Ga0099828_11441254 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cesiribacteraceae → Cesiribacter → unclassified Cesiribacter → Cesiribacter sp. SM1 | 608 | Open in IMG/M |
| 3300009089|Ga0099828_11607106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 572 | Open in IMG/M |
| 3300009090|Ga0099827_11234794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 650 | Open in IMG/M |
| 3300009090|Ga0099827_11423472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 603 | Open in IMG/M |
| 3300009090|Ga0099827_11684396 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300009137|Ga0066709_103909688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300009143|Ga0099792_10611710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 696 | Open in IMG/M |
| 3300009444|Ga0114945_10117995 | Not Available | 1503 | Open in IMG/M |
| 3300009444|Ga0114945_10806943 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300009623|Ga0116133_1230279 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300010047|Ga0126382_12305955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300010048|Ga0126373_10172582 | All Organisms → cellular organisms → Bacteria | 2074 | Open in IMG/M |
| 3300010048|Ga0126373_11761864 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300010048|Ga0126373_12950552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300010048|Ga0126373_13258457 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300010159|Ga0099796_10292710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 688 | Open in IMG/M |
| 3300010322|Ga0134084_10442737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 516 | Open in IMG/M |
| 3300010343|Ga0074044_10257256 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300010359|Ga0126376_10599722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 1041 | Open in IMG/M |
| 3300010359|Ga0126376_12223197 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300010360|Ga0126372_10530353 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1113 | Open in IMG/M |
| 3300010360|Ga0126372_13295746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 502 | Open in IMG/M |
| 3300010361|Ga0126378_10060054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3591 | Open in IMG/M |
| 3300010361|Ga0126378_10208577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2033 | Open in IMG/M |
| 3300010361|Ga0126378_13384365 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300010366|Ga0126379_11844552 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300010366|Ga0126379_12952660 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300010366|Ga0126379_13117779 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300010376|Ga0126381_100006397 | All Organisms → cellular organisms → Bacteria | 13025 | Open in IMG/M |
| 3300010376|Ga0126381_101096182 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1150 | Open in IMG/M |
| 3300010376|Ga0126381_101793186 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 886 | Open in IMG/M |
| 3300010376|Ga0126381_102839036 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 691 | Open in IMG/M |
| 3300010379|Ga0136449_100672802 | All Organisms → cellular organisms → Bacteria | 1743 | Open in IMG/M |
| 3300010379|Ga0136449_103864167 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300011120|Ga0150983_11507794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 521 | Open in IMG/M |
| 3300011120|Ga0150983_12326447 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300011120|Ga0150983_13835187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 829 | Open in IMG/M |
| 3300011120|Ga0150983_15866736 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300011120|Ga0150983_16377813 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300011269|Ga0137392_10509564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 999 | Open in IMG/M |
| 3300011269|Ga0137392_10838735 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 758 | Open in IMG/M |
| 3300011269|Ga0137392_11205823 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 615 | Open in IMG/M |
| 3300011269|Ga0137392_11526721 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 527 | Open in IMG/M |
| 3300011271|Ga0137393_10318832 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300011271|Ga0137393_10752755 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300011271|Ga0137393_10993563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 715 | Open in IMG/M |
| 3300011271|Ga0137393_11535744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300012096|Ga0137389_10299367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1361 | Open in IMG/M |
| 3300012096|Ga0137389_10625602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 925 | Open in IMG/M |
| 3300012096|Ga0137389_10935819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 743 | Open in IMG/M |
| 3300012189|Ga0137388_10027469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4383 | Open in IMG/M |
| 3300012189|Ga0137388_10453565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 1189 | Open in IMG/M |
| 3300012189|Ga0137388_11102028 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cesiribacteraceae → Cesiribacter → unclassified Cesiribacter → Cesiribacter sp. SM1 | 731 | Open in IMG/M |
| 3300012189|Ga0137388_11545217 | Not Available | 600 | Open in IMG/M |
| 3300012200|Ga0137382_10004636 | All Organisms → cellular organisms → Bacteria | 6675 | Open in IMG/M |
| 3300012200|Ga0137382_10504295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 860 | Open in IMG/M |
| 3300012202|Ga0137363_10288628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1344 | Open in IMG/M |
| 3300012203|Ga0137399_10299652 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 1328 | Open in IMG/M |
| 3300012203|Ga0137399_11361187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 595 | Open in IMG/M |
| 3300012203|Ga0137399_11531348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 554 | Open in IMG/M |
| 3300012203|Ga0137399_11728819 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300012205|Ga0137362_10360463 | Not Available | 1259 | Open in IMG/M |
| 3300012205|Ga0137362_10839426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 786 | Open in IMG/M |
| 3300012206|Ga0137380_10447475 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300012206|Ga0137380_11302646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 611 | Open in IMG/M |
| 3300012209|Ga0137379_10190260 | All Organisms → cellular organisms → Bacteria | 1965 | Open in IMG/M |
| 3300012209|Ga0137379_10245608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1703 | Open in IMG/M |
| 3300012211|Ga0137377_10332427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1455 | Open in IMG/M |
| 3300012211|Ga0137377_10347801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1419 | Open in IMG/M |
| 3300012356|Ga0137371_10510856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 927 | Open in IMG/M |
| 3300012357|Ga0137384_11583570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 505 | Open in IMG/M |
| 3300012361|Ga0137360_11521742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 573 | Open in IMG/M |
| 3300012363|Ga0137390_10406656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1339 | Open in IMG/M |
| 3300012363|Ga0137390_10467245 | Not Available | 1237 | Open in IMG/M |
| 3300012363|Ga0137390_11404336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 642 | Open in IMG/M |
| 3300012683|Ga0137398_10072901 | All Organisms → cellular organisms → Bacteria | 2099 | Open in IMG/M |
| 3300012683|Ga0137398_10373104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 969 | Open in IMG/M |
| 3300012683|Ga0137398_10991713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 583 | Open in IMG/M |
| 3300012917|Ga0137395_10663344 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 754 | Open in IMG/M |
| 3300012917|Ga0137395_10813353 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 677 | Open in IMG/M |
| 3300012918|Ga0137396_11209996 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300012923|Ga0137359_10267624 | Not Available | 1524 | Open in IMG/M |
| 3300012924|Ga0137413_11514088 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300012927|Ga0137416_11853038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 552 | Open in IMG/M |
| 3300012930|Ga0137407_11368516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 673 | Open in IMG/M |
| 3300012944|Ga0137410_10599268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 910 | Open in IMG/M |
| 3300012948|Ga0126375_11804151 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300012972|Ga0134077_10337132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 640 | Open in IMG/M |
| 3300014150|Ga0134081_10405767 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300014166|Ga0134079_10677385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 523 | Open in IMG/M |
| 3300015241|Ga0137418_10260690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1466 | Open in IMG/M |
| 3300015245|Ga0137409_11011906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 668 | Open in IMG/M |
| 3300015356|Ga0134073_10049381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 1123 | Open in IMG/M |
| 3300016294|Ga0182041_11137660 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300016319|Ga0182033_11435302 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300016341|Ga0182035_10260011 | All Organisms → cellular organisms → Bacteria | 1405 | Open in IMG/M |
| 3300016371|Ga0182034_10145267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1774 | Open in IMG/M |
| 3300016387|Ga0182040_10098003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1982 | Open in IMG/M |
| 3300016445|Ga0182038_10082830 | All Organisms → cellular organisms → Bacteria | 2272 | Open in IMG/M |
| 3300016445|Ga0182038_10094625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 2152 | Open in IMG/M |
| 3300017656|Ga0134112_10530425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 502 | Open in IMG/M |
| 3300017657|Ga0134074_1358413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300017932|Ga0187814_10303064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 612 | Open in IMG/M |
| 3300017933|Ga0187801_10215584 | Not Available | 764 | Open in IMG/M |
| 3300017943|Ga0187819_10050829 | All Organisms → cellular organisms → Bacteria | 2462 | Open in IMG/M |
| 3300017955|Ga0187817_10519734 | Not Available | 760 | Open in IMG/M |
| 3300017959|Ga0187779_10699166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 685 | Open in IMG/M |
| 3300017999|Ga0187767_10011041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1773 | Open in IMG/M |
| 3300018006|Ga0187804_10255152 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300018031|Ga0184634_10078229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1417 | Open in IMG/M |
| 3300018058|Ga0187766_11351886 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300018074|Ga0184640_10080969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1389 | Open in IMG/M |
| 3300018088|Ga0187771_11299554 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300018431|Ga0066655_10000310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 15655 | Open in IMG/M |
| 3300018433|Ga0066667_11673060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 570 | Open in IMG/M |
| 3300018468|Ga0066662_11794636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 642 | Open in IMG/M |
| 3300018482|Ga0066669_10172772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1620 | Open in IMG/M |
| 3300018482|Ga0066669_11273042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 665 | Open in IMG/M |
| 3300019789|Ga0137408_1352587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 713 | Open in IMG/M |
| 3300019877|Ga0193722_1116421 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 622 | Open in IMG/M |
| 3300020021|Ga0193726_1146717 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300020199|Ga0179592_10360826 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300020199|Ga0179592_10373756 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300020579|Ga0210407_10413471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1055 | Open in IMG/M |
| 3300020579|Ga0210407_10487086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 964 | Open in IMG/M |
| 3300020579|Ga0210407_10918083 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300020579|Ga0210407_10961016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 653 | Open in IMG/M |
| 3300020580|Ga0210403_10234996 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
| 3300020581|Ga0210399_10207700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1629 | Open in IMG/M |
| 3300020581|Ga0210399_11130438 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300020581|Ga0210399_11173985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 611 | Open in IMG/M |
| 3300020582|Ga0210395_10205154 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
| 3300020582|Ga0210395_11162719 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300020582|Ga0210395_11322192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 527 | Open in IMG/M |
| 3300020583|Ga0210401_10035201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4764 | Open in IMG/M |
| 3300021088|Ga0210404_10511274 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300021088|Ga0210404_10532569 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300021088|Ga0210404_10704690 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300021168|Ga0210406_10282318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1354 | Open in IMG/M |
| 3300021170|Ga0210400_10041751 | All Organisms → cellular organisms → Bacteria | 3560 | Open in IMG/M |
| 3300021170|Ga0210400_10597369 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300021171|Ga0210405_10238852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1438 | Open in IMG/M |
| 3300021178|Ga0210408_11031693 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300021180|Ga0210396_11263613 | Not Available | 616 | Open in IMG/M |
| 3300021180|Ga0210396_11396775 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300021405|Ga0210387_10640618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 944 | Open in IMG/M |
| 3300021406|Ga0210386_11824202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 500 | Open in IMG/M |
| 3300021407|Ga0210383_10619378 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300021407|Ga0210383_11184972 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300021475|Ga0210392_10151173 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
| 3300021478|Ga0210402_10760963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 893 | Open in IMG/M |
| 3300021478|Ga0210402_11721312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300021559|Ga0210409_10050529 | All Organisms → cellular organisms → Bacteria | 3911 | Open in IMG/M |
| 3300021559|Ga0210409_10149016 | All Organisms → cellular organisms → Bacteria | 2143 | Open in IMG/M |
| 3300021560|Ga0126371_10225607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1979 | Open in IMG/M |
| 3300021560|Ga0126371_11526125 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300021560|Ga0126371_12995715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300022713|Ga0242677_1078018 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300022724|Ga0242665_10193329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 667 | Open in IMG/M |
| 3300024330|Ga0137417_1433168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1752 | Open in IMG/M |
| 3300025157|Ga0209399_10403313 | Not Available | 530 | Open in IMG/M |
| 3300026277|Ga0209350_1000027 | All Organisms → cellular organisms → Bacteria | 96391 | Open in IMG/M |
| 3300026295|Ga0209234_1079757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 1242 | Open in IMG/M |
| 3300026301|Ga0209238_1210007 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300026304|Ga0209240_1094627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 1080 | Open in IMG/M |
| 3300026310|Ga0209239_1198442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
| 3300026318|Ga0209471_1315769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 517 | Open in IMG/M |
| 3300026334|Ga0209377_1104097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 1172 | Open in IMG/M |
| 3300026334|Ga0209377_1256863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300026335|Ga0209804_1033405 | All Organisms → cellular organisms → Bacteria | 2595 | Open in IMG/M |
| 3300026482|Ga0257172_1077605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 610 | Open in IMG/M |
| 3300026496|Ga0257157_1087069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 542 | Open in IMG/M |
| 3300026497|Ga0257164_1100352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 501 | Open in IMG/M |
| 3300026498|Ga0257156_1133319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 518 | Open in IMG/M |
| 3300026542|Ga0209805_1192398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 888 | Open in IMG/M |
| 3300026557|Ga0179587_10364909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 938 | Open in IMG/M |
| 3300026557|Ga0179587_11153720 | Not Available | 510 | Open in IMG/M |
| 3300027042|Ga0207766_1022359 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300027605|Ga0209329_1032888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1079 | Open in IMG/M |
| 3300027660|Ga0209736_1043695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1293 | Open in IMG/M |
| 3300027671|Ga0209588_1003499 | All Organisms → cellular organisms → Bacteria | 4364 | Open in IMG/M |
| 3300027671|Ga0209588_1265327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 522 | Open in IMG/M |
| 3300027674|Ga0209118_1002101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8748 | Open in IMG/M |
| 3300027706|Ga0209581_1079977 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 1164 | Open in IMG/M |
| 3300027846|Ga0209180_10101201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1642 | Open in IMG/M |
| 3300027846|Ga0209180_10788487 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300027862|Ga0209701_10491394 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cesiribacteraceae → Cesiribacter → unclassified Cesiribacter → Cesiribacter sp. SM1 | 668 | Open in IMG/M |
| 3300027903|Ga0209488_10353253 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300027903|Ga0209488_10422633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 984 | Open in IMG/M |
| 3300027903|Ga0209488_10484079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 909 | Open in IMG/M |
| 3300027905|Ga0209415_10308113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1358 | Open in IMG/M |
| 3300028792|Ga0307504_10006494 | All Organisms → cellular organisms → Bacteria | 2487 | Open in IMG/M |
| 3300029636|Ga0222749_10332531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300030620|Ga0302046_11163274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300031128|Ga0170823_12952272 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300031545|Ga0318541_10085336 | All Organisms → cellular organisms → Bacteria | 1676 | Open in IMG/M |
| 3300031682|Ga0318560_10190148 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1095 | Open in IMG/M |
| 3300031718|Ga0307474_10858354 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 718 | Open in IMG/M |
| 3300031719|Ga0306917_11004894 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300031740|Ga0307468_100729307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 833 | Open in IMG/M |
| 3300031744|Ga0306918_10664118 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300031753|Ga0307477_10024867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4090 | Open in IMG/M |
| 3300031754|Ga0307475_10434768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 1055 | Open in IMG/M |
| 3300031768|Ga0318509_10394648 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300031823|Ga0307478_11016396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 693 | Open in IMG/M |
| 3300031833|Ga0310917_10114819 | All Organisms → cellular organisms → Bacteria | 1747 | Open in IMG/M |
| 3300031879|Ga0306919_10325506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1170 | Open in IMG/M |
| 3300031910|Ga0306923_10172169 | All Organisms → cellular organisms → Bacteria | 2472 | Open in IMG/M |
| 3300031912|Ga0306921_10015407 | All Organisms → cellular organisms → Bacteria | 8283 | Open in IMG/M |
| 3300031912|Ga0306921_10315151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1830 | Open in IMG/M |
| 3300031945|Ga0310913_11242373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300031946|Ga0310910_11339303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300031947|Ga0310909_10149000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1922 | Open in IMG/M |
| 3300031962|Ga0307479_10081954 | All Organisms → cellular organisms → Bacteria | 3122 | Open in IMG/M |
| 3300031962|Ga0307479_10127239 | All Organisms → cellular organisms → Bacteria | 2490 | Open in IMG/M |
| 3300031962|Ga0307479_10995970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 807 | Open in IMG/M |
| 3300031962|Ga0307479_12056108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 519 | Open in IMG/M |
| 3300031965|Ga0326597_11616356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300032001|Ga0306922_11693332 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300032076|Ga0306924_10747938 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300032076|Ga0306924_11494820 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300032160|Ga0311301_10095067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5900 | Open in IMG/M |
| 3300032160|Ga0311301_11500857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 830 | Open in IMG/M |
| 3300032174|Ga0307470_10836025 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300032180|Ga0307471_100545861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1313 | Open in IMG/M |
| 3300032205|Ga0307472_100929266 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300032261|Ga0306920_100127808 | All Organisms → cellular organisms → Bacteria | 3781 | Open in IMG/M |
| 3300032261|Ga0306920_100675588 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1523 | Open in IMG/M |
| 3300032261|Ga0306920_100982543 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1230 | Open in IMG/M |
| 3300032892|Ga0335081_11225478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 853 | Open in IMG/M |
| 3300033289|Ga0310914_10587875 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1004 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 29.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.10% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.06% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.95% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.46% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.97% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.86% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.86% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 1.12% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.12% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.49% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.74% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.74% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.37% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.37% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.37% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.37% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.37% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.37% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.37% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.37% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.37% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.37% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022713 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025157 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027042 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 68 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0603.00003580 | 2166559005 | Simulated | LKYWSAQSNDGFRMWKSKHEAFEGDGHKFAYDGTNGFLITIHYSGAAKAAPAD |
| INPgaii200_10469312 | 2228664022 | Soil | MHNLKYWGAQSNDGFRMRKSKHEAFEDDDKFAYHDTNGFLTTIHYSGMAKTSSTD |
| INPhiseqgaiiFebDRAFT_1018521611 | 3300000364 | Soil | MHNLKYWGAQSNDGFRMRKSKHEAFEDDDKFAYHDTNGFLTTIHYSGMAKTSSTD* |
| JGI25388J43891_10001502 | 3300002909 | Grasslands Soil | LKYWDAHSHDGFRMWKNKHEAFEGDGHKVSYDGKNGFVIAIHFSGTAKARSAN* |
| JGI25617J43924_100843672 | 3300002914 | Grasslands Soil | WKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNVKPASAD* |
| JGI25616J43925_103138801 | 3300002917 | Grasslands Soil | FRMWKTKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKPASAD* |
| Ga0062386_1011286872 | 3300004152 | Bog Forest Soil | NDGFRMWKSKTERYEGHNQKFEYSGTNGFLITIHFTGTAK* |
| Ga0066395_101450842 | 3300004633 | Tropical Forest Soil | RMWKNKHEAFEGDGHKFSYDGTNGFLITTHFSGNAKASSAD* |
| Ga0066395_102968031 | 3300004633 | Tropical Forest Soil | QSNNGFRMWKTKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKAASAD* |
| Ga0066680_100023763 | 3300005174 | Soil | MWKNKHEAFEGDGHKVSYDGKNGFVIAIHFSGTAKARSAN* |
| Ga0066388_1020268622 | 3300005332 | Tropical Forest Soil | NDGFRMWKSKHEEFEGKDHKFSYDGTNGFLITIHFSGKAKAAAAGN* |
| Ga0066682_103858611 | 3300005450 | Soil | GFRMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKPASAD* |
| Ga0066687_108904551 | 3300005454 | Soil | LKYWDAHSHDGFRMWKNKHEAFEGDGHKVSYDGKNGFVIAIHFSGTAK |
| Ga0070732_101070142 | 3300005542 | Surface Soil | MRSLPPGQSKHEAFEGDGYKFAYDGTNGFLITIHFPGAAKSAAAD* |
| Ga0066700_111660721 | 3300005559 | Soil | AQSNDGFRMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKPASAD* |
| Ga0066699_104877271 | 3300005561 | Soil | HESFEGDGHKFAYDGTNGFLITIHFSGNAKAGSAD* |
| Ga0066691_108673921 | 3300005586 | Soil | SKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKTASAD* |
| Ga0070761_102611571 | 3300005591 | Soil | KSRHEAFEGDGHKFSYDDTNGFLITVHFSGMAKSAPADQF* |
| Ga0070762_107801352 | 3300005602 | Soil | SKHEAFEGDGHKFSYDGTNGFLITIHYSGSAKAVSAD* |
| Ga0066903_1043340611 | 3300005764 | Tropical Forest Soil | FRMWKSKHEAFEGDGHKFSYDGTNGFLITVHFSGNAKAAPAD* |
| Ga0066651_100419844 | 3300006031 | Soil | SNDGFRMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKPASAD* |
| Ga0075019_107740081 | 3300006086 | Watersheds | VRYWNAQSNDGFRMWKSQRERYEGQGQKFDYSGTNGFLITLHFSGTPK* |
| Ga0070765_1000245921 | 3300006176 | Soil | GFRMWKNTHEAFEGAGHKFAYEGTNGFLITIHFSGNAKTASAD* |
| Ga0079222_123350361 | 3300006755 | Agricultural Soil | LKYWDAHSHDGFRMWKNKHEAFEGDGHKVSYDGKNGFVIAIHFSGNAKARSAD* |
| Ga0066659_108631272 | 3300006797 | Soil | WKSKHEAFEGDGHKFSFDGTNGFLITIHFSGNAKPASAD* |
| Ga0066659_119356681 | 3300006797 | Soil | QSNDGFRMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKPASAD* |
| Ga0075426_112976511 | 3300006903 | Populus Rhizosphere | GFRMWKSKHEEFEGKDHKFSYDGTNGFLITIHFSGMAKTAAGN* |
| Ga0099791_101328023 | 3300007255 | Vadose Zone Soil | AQSNDGFRMWKNKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKAASAD* |
| Ga0099795_103471882 | 3300007788 | Vadose Zone Soil | EVVVHNLKYWLAQSNNGFRMWKSKHEAFEGHGHNFSYDGTNGFLITIHFSGQARAAAAD* |
| Ga0099829_101342854 | 3300009038 | Vadose Zone Soil | AQSNNGFRMWKNKHEAFEGHGHNFSYDGTNGFLITIHFSGQAKAAAAD* |
| Ga0099829_104712171 | 3300009038 | Vadose Zone Soil | HEAFEGHGHNFSYDGTNGFLITIHFSGQAKAAAAD* |
| Ga0099829_112694751 | 3300009038 | Vadose Zone Soil | SKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKPASAD* |
| Ga0099830_111503771 | 3300009088 | Vadose Zone Soil | GFQMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKPAAAD* |
| Ga0099830_114661812 | 3300009088 | Vadose Zone Soil | QSNDGFRMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKAASAD* |
| Ga0099828_107356132 | 3300009089 | Vadose Zone Soil | FRMWKNKHEAFEGHGHNFSYDGTNGFLITIHFSGQAKAAAAD* |
| Ga0099828_113948841 | 3300009089 | Vadose Zone Soil | NTGFRMWKSKHEYYEGHGHKVDYSGTNGFLITITFSGQAKAATAD* |
| Ga0099828_114412541 | 3300009089 | Vadose Zone Soil | MWKSKHEYYEGHGHKVDYSGTNGFLITITFSGQAKAATAD* |
| Ga0099828_116071061 | 3300009089 | Vadose Zone Soil | RMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKPASAD* |
| Ga0099827_112347942 | 3300009090 | Vadose Zone Soil | GAQSNTGFRMWKTKHEYYEGHDEKTDFSGTNGFLITIHFTGKAKAASAD* |
| Ga0099827_114234721 | 3300009090 | Vadose Zone Soil | EAFEGDGHKFSYDGTNGFLITIHFSGNAKPASAD* |
| Ga0099827_116843961 | 3300009090 | Vadose Zone Soil | LHYWGAQSNTGFRMWKTKHEYYEGHDEKTDFSGTNGFLITIHFTGKAKAASAD* |
| Ga0066709_1039096881 | 3300009137 | Grasslands Soil | IHNLKYWQAQTNDGFRMWKSKHEAFDGKGHNFSYDGTNGFLITIHFSGMAKPPAAD* |
| Ga0099792_106117102 | 3300009143 | Vadose Zone Soil | MWKSKHEAFEGHGHNFSYDGTNGFLITIHFSGQAKTAAAD* |
| Ga0114945_101179951 | 3300009444 | Thermal Springs | AQSNTGFRMWKNKRHYYEGYGKKIDYSGTNGFLITITFSGQARKAAAD* |
| Ga0114945_108069431 | 3300009444 | Thermal Springs | QSNTGFRMWKNKRHFYEGHGKKTEYSGTNGFLITINFSGQASKKTTAY* |
| Ga0116133_12302792 | 3300009623 | Peatland | AQSNDGFRMWRSKTERYEGHEQKFEYSGTNGFLITIHFGGTAK* |
| Ga0126382_123059552 | 3300010047 | Tropical Forest Soil | GFRMWKSKHEEFEGKDHKFSYDGTNGFLITIHFSGNAKAAAAGN* |
| Ga0126373_101725824 | 3300010048 | Tropical Forest Soil | MKNLTYWGAQSNDGFRMWKSRRERYEGQGQKFDYSDTNGFLITIHYSGTAK* |
| Ga0126373_117618641 | 3300010048 | Tropical Forest Soil | YWNAQSNDGFRMWKSRHESYEGQGQKFDYSGTNGFLITIHFSGTPKA* |
| Ga0126373_129505522 | 3300010048 | Tropical Forest Soil | AQSNNGFRMWKSKHEAFDGHGHNFSYDGTNGFLITIHFSGKAKAAAAD* |
| Ga0126373_132584571 | 3300010048 | Tropical Forest Soil | SNDGFRMWKSRHESYEGQGQKFDYSGTNGFLITIHFSGTPRA* |
| Ga0099796_102927102 | 3300010159 | Vadose Zone Soil | YWLAQSNNGFRMWKNKHEAFEGHDHNFSYDGTNGFLITIHFTGQAKAAAAD* |
| Ga0134084_104427372 | 3300010322 | Grasslands Soil | QSNDGFRMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKTASAD* |
| Ga0074044_102572562 | 3300010343 | Bog Forest Soil | FRMWKSKHEAFEGDGHKFAYEGTNGFLITIHFSGAAKAAAAD* |
| Ga0126376_105997221 | 3300010359 | Tropical Forest Soil | DGFRMWKSKQESFDGKGHKFSYEGTNGFLITIHFSGQAKAAAAGN* |
| Ga0126376_122231971 | 3300010359 | Tropical Forest Soil | NHEVVAHNLKYWLAQSNNGFRMWKSKHEAFDGHGHNFSYDGTNGFLITIHFSGKAKAASAD* |
| Ga0126372_105303531 | 3300010360 | Tropical Forest Soil | QSNDGFRMWKSKREMYEGQGQKFDYSGTNGFLITIHYSGTAK* |
| Ga0126372_132957461 | 3300010360 | Tropical Forest Soil | SNDGFRMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKAAPAD* |
| Ga0126378_100600541 | 3300010361 | Tropical Forest Soil | GFRMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKAASAD* |
| Ga0126378_102085773 | 3300010361 | Tropical Forest Soil | DGFRMWKNKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKASSAD* |
| Ga0126378_133843652 | 3300010361 | Tropical Forest Soil | VVLRNVRYWNAQSNDGFRMWKSRHESYEGQGQKFDYSGTNGFLITIHFSGTPKA* |
| Ga0126379_118445521 | 3300010366 | Tropical Forest Soil | KNKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKAGSAD* |
| Ga0126379_129526601 | 3300010366 | Tropical Forest Soil | NEEVVLRNVRYWNAQSNDGFRMWKSRHESYEGQGQKFDYSGTNGFLITIHFSGTPKA* |
| Ga0126379_131177791 | 3300010366 | Tropical Forest Soil | MWKNKHEAFEGDGHKFSYDGTNAFLITTHFSGNAKASSAD* |
| Ga0126381_10000639716 | 3300010376 | Tropical Forest Soil | FRMWKSKNEAFEGDGHKFSYDGTNGFLITIHFSGMAKTATAAD* |
| Ga0126381_1010961821 | 3300010376 | Tropical Forest Soil | EEVVLRNVRYWNAQSNDGFRMWKSRHESYEGQGQKFDYSGTNGFLITIHFSGTPKA* |
| Ga0126381_1017931862 | 3300010376 | Tropical Forest Soil | NVRYWNAQSNDGFRMWKSRHESYEGQGQKFDYSGTNGFLITIHFSGTPKA* |
| Ga0126381_1028390362 | 3300010376 | Tropical Forest Soil | VKYWNAQSNDGFRMWKSRHERYEGQGQKFDYSDTNGFLITLHFSGTAK* |
| Ga0136449_1006728023 | 3300010379 | Peatlands Soil | DEEVVMKNLRYWNAQSNDGFRMWKSKTERYEGHDQKFEYSGTNGFLITIHFTGTAK* |
| Ga0136449_1038641671 | 3300010379 | Peatlands Soil | GFRMWKSKHEYYEGNGEKMDYSGTNGFLFTITFSGQAKSTAGN* |
| Ga0136847_132335661 | 3300010391 | Freshwater Sediment | KRHYYEGHGQKYDYSGTNGFRITIHFSGQAKKSATAD* |
| Ga0150983_115077941 | 3300011120 | Forest Soil | SNDGFRMWKSKHEAFEGDGHKFSYDGTNGFLITVHYSGNAKPASAD* |
| Ga0150983_123264472 | 3300011120 | Forest Soil | APGEEVVVKNLHYWNAPSNDGFRMWKSKREYFQGFGQNFDYSGTNGFLITIHFSGDAKPVPPAK* |
| Ga0150983_138351871 | 3300011120 | Forest Soil | KHEAFEGDGHKFSYDGTNGFLITIHFSGSAKPASAD* |
| Ga0150983_158667361 | 3300011120 | Forest Soil | SNDGFRMWKSKHEAFEGDGHKFDYAGTNGFLITIHFSGAAKSAAAD* |
| Ga0150983_163778131 | 3300011120 | Forest Soil | NDGFRMWKSKREAFEGDGHKFSYDGTNGFLITIHFSGAAKAAAAD* |
| Ga0137392_105095641 | 3300011269 | Vadose Zone Soil | NDGFRMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNVKPASAD* |
| Ga0137392_108387351 | 3300011269 | Vadose Zone Soil | SNDGFRMWKSKHEEFEGKDHKFSYDSSNGFLITIHFSGQANAAPAGN* |
| Ga0137392_112058231 | 3300011269 | Vadose Zone Soil | SNDGFRMWKSKHEEFEGKDHKFSYDSSNGFLITIHFSGQAKAAAAGN* |
| Ga0137392_115267211 | 3300011269 | Vadose Zone Soil | EEFEGKDHKFSYEGTNGFLITIHFSGQAKSVAASN* |
| Ga0137393_103188324 | 3300011271 | Vadose Zone Soil | SNTGFRMWKSKHEYYEGHGHKVDYSGTNGFLITITFSGQAKPASAD* |
| Ga0137393_107527551 | 3300011271 | Vadose Zone Soil | AFEGDGHKFAYDGTNGFLITIHYSGMAKATAAAAD* |
| Ga0137393_109935632 | 3300011271 | Vadose Zone Soil | WKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKPASAD* |
| Ga0137393_115357441 | 3300011271 | Vadose Zone Soil | KRHSYEGHGQKFDFSGTNGFLITIHFSGQAKPPSAD* |
| Ga0137389_102993672 | 3300012096 | Vadose Zone Soil | WKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKPAAAD* |
| Ga0137389_106256021 | 3300012096 | Vadose Zone Soil | FRMWKSKHEAFEGDGHKFSYEGTNGFLITIHFSGNAKPASAD* |
| Ga0137389_109358191 | 3300012096 | Vadose Zone Soil | EYYEGHDEKTDFSGTNGFLITIHFTGKAKAASAD* |
| Ga0137388_100274696 | 3300012189 | Vadose Zone Soil | WKSKQEAFEGEGHKFSYAGTNGFLITIHYSGMAKAAAAD* |
| Ga0137388_104535652 | 3300012189 | Vadose Zone Soil | KSKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKPASAD* |
| Ga0137388_111020281 | 3300012189 | Vadose Zone Soil | RMWKSKHEYYEGHGHKVDYSGTNGFLITITFSGQAKAATAD* |
| Ga0137388_115452172 | 3300012189 | Vadose Zone Soil | MWKAKHNYYEGHDRKTDTSGSNGFLIMITFSGQAKAAASD* |
| Ga0137382_100046362 | 3300012200 | Vadose Zone Soil | MWKNKREAFEGDGHKVSYDGKNGFVIAIHFSGTAKARSAN* |
| Ga0137382_105042952 | 3300012200 | Vadose Zone Soil | WKSKHEAFEGDGHTFSYDGTNGFLITIHFSGNAKPASAD* |
| Ga0137363_102886281 | 3300012202 | Vadose Zone Soil | NDGFRMWKSKHEAFEGGGHKFSYDGTNGFLITIHFSGSAKSASAD* |
| Ga0137399_102996523 | 3300012203 | Vadose Zone Soil | FRMWKNKHETFEGDGHKFSYDGTNGFLITIHYSGNAKLASAD* |
| Ga0137399_113611871 | 3300012203 | Vadose Zone Soil | WKNKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKAASAD* |
| Ga0137399_115313482 | 3300012203 | Vadose Zone Soil | EAFEGDGHKFSYDGTNGFLITIHYSGNAKSASAD* |
| Ga0137399_117288192 | 3300012203 | Vadose Zone Soil | VVHNLKYWLAQSNNGFRMWKSKHEAFEGHGHNFSYDGTNGFLITIHFSGQARAAAAD* |
| Ga0137362_103604631 | 3300012205 | Vadose Zone Soil | EEFEGKDHKFSYDGTNGFLITIHFSGRANTAPAGN* |
| Ga0137362_108394262 | 3300012205 | Vadose Zone Soil | QSNDGFRMWKNKHEAFEGDGHKFTYDGTNGFLITIHFSGNAKTASAD* |
| Ga0137380_104474751 | 3300012206 | Vadose Zone Soil | KHEAFDGKGHNFSYDGTNGFLITIHFSGQAKPPAAD* |
| Ga0137380_113026462 | 3300012206 | Vadose Zone Soil | TNDGFRMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKPASAD* |
| Ga0137379_101902603 | 3300012209 | Vadose Zone Soil | MWKTKHEYYEGHDEKTDFSGTNGFLITIHFTGKAKAASAD* |
| Ga0137379_102456082 | 3300012209 | Vadose Zone Soil | LEKVKGDDPNHEVVIHNLKYWQAQTNDGFRMWKSKHEGFDGKGHNFSYDGTNGFLITIHFSGMAKPPAAD* |
| Ga0137377_103324271 | 3300012211 | Vadose Zone Soil | NDGFRMWKSKHEAFDGKGHNFSYDGTNGFLITIHFSGQAKPSATN* |
| Ga0137377_103478011 | 3300012211 | Vadose Zone Soil | NDGFRMWKSKHEAFDGKGHNFSYDGTNGFLITIHFSGQAKPPAAD* |
| Ga0137371_105108561 | 3300012356 | Vadose Zone Soil | NDGFRMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKPASAD* |
| Ga0137384_115835701 | 3300012357 | Vadose Zone Soil | SKHEAFEGDGHKFSYDGTNGFLITIHFSGNIKPASAD* |
| Ga0137360_115217422 | 3300012361 | Vadose Zone Soil | QSNDGFRMWKSKHEAFEGGGHKFSYDGTNGFLITIHFSGSAKSASAD* |
| Ga0137390_104066562 | 3300012363 | Vadose Zone Soil | GFRMWKSKHEAFEGDGHKFSYDGTNGFLITIHYSGNAKPASAD* |
| Ga0137390_104672452 | 3300012363 | Vadose Zone Soil | HEEFEGKDHKFSYDSSNGFLITIHFSGQANAAPAGN* |
| Ga0137390_114043362 | 3300012363 | Vadose Zone Soil | FRMWKSKHEAFEGDGHKFSYDGTNGFLITIRFSGNAKPASAD* |
| Ga0137398_100729011 | 3300012683 | Vadose Zone Soil | AQSNDGFRMWKSKHEEFEGKDHKFSYSGTNGFLVTIHFSGMAKTAAAGN* |
| Ga0137398_103731041 | 3300012683 | Vadose Zone Soil | NDGFRMWKSKHEEFEGKDHKFSYDGTNGFLITIHFSGMAKTTSGN* |
| Ga0137398_109917131 | 3300012683 | Vadose Zone Soil | FRMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKAASAD* |
| Ga0137395_106633442 | 3300012917 | Vadose Zone Soil | KSKHEEFEGKDHKFSYDSSNGFLITIHFSGQANAAPAGN* |
| Ga0137395_108133532 | 3300012917 | Vadose Zone Soil | QSNDGFRMWKSKHEEFEGKDHKFSYDSSNGFLITIHFSGQANAAPAGN* |
| Ga0137396_112099961 | 3300012918 | Vadose Zone Soil | VHEVVVHNLKYWLAQSNNGFRMWKSKHEAFEGHDHNFSYDGTNGFLITIHFSGQAKTCAAD* |
| Ga0137359_102676241 | 3300012923 | Vadose Zone Soil | NDGFRMWNSKHEEFDGKDHKFSYDGTNGFLITIHFSGMAKATPAD* |
| Ga0137413_115140882 | 3300012924 | Vadose Zone Soil | NLKYWLAQSNNGFRMWKSKHEAFEGHGHNFSYDGTNGFLITIHFSGQAKAAAAD* |
| Ga0137416_118530382 | 3300012927 | Vadose Zone Soil | RMWKNKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKPASAD* |
| Ga0137407_113685162 | 3300012930 | Vadose Zone Soil | EAFEGDGHKFSYDGTNGFLITIHYSGNAKPASAD* |
| Ga0137410_105992682 | 3300012944 | Vadose Zone Soil | KHEAFEGDGHKFSYDGTNGFLITIHFSGNAKAASAD* |
| Ga0126375_118041511 | 3300012948 | Tropical Forest Soil | QSNNGFRMWKSKHEAFEGHGHKFSYQGTNGFLITIHFSGQAKAAGAD* |
| Ga0134077_103371321 | 3300012972 | Grasslands Soil | NDGFRMWKNKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKPASAD* |
| Ga0134081_104057672 | 3300014150 | Grasslands Soil | MWKNKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKPASAD* |
| Ga0134079_106773852 | 3300014166 | Grasslands Soil | GAQSNDGFRMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKTASAD* |
| Ga0137418_102606904 | 3300015241 | Vadose Zone Soil | RMWKSKLEAFEGDGHKFSYDGTNGFLITIHFSGNAKLASAD* |
| Ga0137409_110119062 | 3300015245 | Vadose Zone Soil | KSKHEAFEGDGHKFSYDGTNGFLITIHFAGNAKPSSAD* |
| Ga0134073_100493811 | 3300015356 | Grasslands Soil | MWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKPASAD* |
| Ga0182041_111376601 | 3300016294 | Soil | KNKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKASSAD |
| Ga0182033_114353021 | 3300016319 | Soil | NDGFRMWKSRHESYEGQGQKFDYSGTNGFLITIHFSGTPKA |
| Ga0182035_102600111 | 3300016341 | Soil | MWKNKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKASSAD |
| Ga0182034_101452673 | 3300016371 | Soil | WKSRHESYEGQGQKFDYSGTNGFLITIHFSGTPKA |
| Ga0182040_100980033 | 3300016387 | Soil | LRNVRYWNAQSNDGFRMWKSRHESYEGQGQKFDYSGTNGFLITIHFSGAPKA |
| Ga0182038_100828301 | 3300016445 | Soil | GEEVVMKNLRYWNAQSNDGFRMWKTKREMYEGQGQKFEYSGTNGFLITVHFEGMAKTADA |
| Ga0182038_100946253 | 3300016445 | Soil | WKNKHEAFEGDGHKFSYDGTNGFLITTHFSGNAKASSAD |
| Ga0134112_105304251 | 3300017656 | Grasslands Soil | AQTNDGFRMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKPASAD |
| Ga0134074_13584131 | 3300017657 | Grasslands Soil | HEAFDGKGHNFSYDGTNGFLITIHFSGMAKPPAAD |
| Ga0187814_103030641 | 3300017932 | Freshwater Sediment | DGFRMWKSRHEAFEGDGHKFSYDGTNGFLITIHFSGNAKAAAAD |
| Ga0187801_102155841 | 3300017933 | Freshwater Sediment | VKNLRYWNAQSNDGFRMWKTNHEAYEGQCQKFDYSGTNGFLITIHFTGAAK |
| Ga0187819_100508292 | 3300017943 | Freshwater Sediment | VVKNLRYWNAQSNDGFRMWKTNHEAYEGQCQKFDYSGTNGFLITIHFTGTAK |
| Ga0187817_105197342 | 3300017955 | Freshwater Sediment | VKNLRYWNAQSNDGFRMWKTNHEAYEGRCQKFDYSGTNGFLITIHFTGTAK |
| Ga0187779_106991661 | 3300017959 | Tropical Peatland | NGFRMWKTKREYYEGQGQKFDYSGTNGFLITIHFSGKAAAASGD |
| Ga0187767_100110413 | 3300017999 | Tropical Peatland | AHETVVHNLHYWNAQSNNGFRMWKTKREYYEGQGQKFDYSGTNGFLITIHFSGKAAAASG |
| Ga0187804_102551522 | 3300018006 | Freshwater Sediment | MWKTNHEAYEGRCQKFDYSGTNGFLITIHFTGTAK |
| Ga0184634_100782292 | 3300018031 | Groundwater Sediment | FRMWKNKRHAYNNHGKKFEYSGTNGFLITLTVSGQAKAPSAD |
| Ga0187766_113518862 | 3300018058 | Tropical Peatland | GDDPSHEVIVHNLKYWFAQSNNGFRMWKSKHEAFEGHGHNSSYDGTNGFLITIRFSGQAKSAAAD |
| Ga0184640_100809691 | 3300018074 | Groundwater Sediment | SNTGFRMWKNKRHAYNNHGKKFEYSGTNGFLITITVSGQAKPASAD |
| Ga0187771_112995542 | 3300018088 | Tropical Peatland | PDEEVVMKNLRYWNAQSNDGFRMWKSKHEMYEGHEQKFDYSGTNGFLITIHFTGAAK |
| Ga0066655_1000031012 | 3300018431 | Grasslands Soil | LKYWDAHSHDGFRMWKNKHEAFEGDGHKVSYDGKNGFVIAIHFSGTAKARSAN |
| Ga0066667_116730602 | 3300018433 | Grasslands Soil | KNKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKPASAD |
| Ga0066662_117946361 | 3300018468 | Grasslands Soil | NDGFRMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNARPASAD |
| Ga0066669_101727722 | 3300018482 | Grasslands Soil | QSNDGFRMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKPASAD |
| Ga0066669_112730421 | 3300018482 | Grasslands Soil | QSNDGFRMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNVKPASAD |
| Ga0137408_13525871 | 3300019789 | Vadose Zone Soil | GFRMWKSKHEEFEGKDHKFSYDGTNGFLITIHFSGMAKAAAAGN |
| Ga0193722_11164211 | 3300019877 | Soil | HEEFEGKDHKFSYDSSNGFLITIHFSGQAHAAPAGN |
| Ga0193726_11467171 | 3300020021 | Soil | GFRMWKSKREAFEGDGHKFAYDGTNGFLVTIHFSGVAKATSAD |
| Ga0179592_103608262 | 3300020199 | Vadose Zone Soil | WGAQSNEGFRMWKTKHEAFEGDGHKFAYDGTNGFLITIHYSGMAKAAAAD |
| Ga0179592_103737562 | 3300020199 | Vadose Zone Soil | NGFRMWKSKHEAFEGHGHNFSYDGTNGFLITIHFSGQAKAAAAD |
| Ga0210407_104134712 | 3300020579 | Soil | KHEAFEGDGHKFAYDGTNGFLITIHYSGMAKAAAAD |
| Ga0210407_104870862 | 3300020579 | Soil | KSEHEAFEGDGHKFAYDGTNGFLITIHFSGAAKSASAD |
| Ga0210407_109180831 | 3300020579 | Soil | DGFRMWKSKHEAFEGDGHKFAYDGTNGFLITIHYSGMAKAAAAD |
| Ga0210407_109610162 | 3300020579 | Soil | RMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNGKPASAD |
| Ga0210403_102349961 | 3300020580 | Soil | MWKTKHEAFEGDGHKFAYDGTNGFLITIHYSGMAKAAAAD |
| Ga0210399_102077003 | 3300020581 | Soil | WSAQSNDGFRMWKSKHEAFEGDGHKFAYDGTNGFLITIHYSGMAKAAAAD |
| Ga0210399_111304382 | 3300020581 | Soil | GFRMWKSKHEAFEGDGHKFDYEGTNGFLITIHFSGAAKSAAAD |
| Ga0210399_111739852 | 3300020581 | Soil | SNDGFRMWRSKHEAFEGDGHKFSYDGTNGFLVTVHFSGNAKPAQAD |
| Ga0210395_102051541 | 3300020582 | Soil | SNDGFRMWKSKHEAFEGDGHKFDYEGTNGFLITIHFSGAAKSAAAD |
| Ga0210395_111627191 | 3300020582 | Soil | KGDDPDHEVVVHNLKYWLAQSNNGFRMWKSKHEAFEGHGHNFSYDGTNGFLITIHFSGQAKTTAAD |
| Ga0210395_113221922 | 3300020582 | Soil | DGFRMWKNKHEAFEGDGHKFSYDGTNGFLITIHFSGKAKSASAD |
| Ga0210401_100352011 | 3300020583 | Soil | HEAFEGDGHKFSYDGTNGFLITIHFSGKAKSASAD |
| Ga0210404_105112742 | 3300021088 | Soil | RMWKTKREAFEGDGHKFDYEGTNGFLITIHFSGAAKSAAAD |
| Ga0210404_105325691 | 3300021088 | Soil | YWRAQTNDGFRMWKSRHEAFEGDGHKFAYDGTNGFLITIHYSGMAKAAAAD |
| Ga0210404_107046902 | 3300021088 | Soil | KYWSAQSNDGFRMWKSKHEAFEGDGHKFAYDGTNGFLITIHYSGMAKGAAAAD |
| Ga0210406_102823181 | 3300021168 | Soil | SEHEAFEGDGHKFAYDGTNVFLITIHFSGAAKSASAD |
| Ga0210400_100417516 | 3300021170 | Soil | RMWKTKHEAFEGHGHKFSYDGTNGFLITIHFSGQAKTAAAD |
| Ga0210400_105973691 | 3300021170 | Soil | FRMWKSKHEAFEGDGHKFAYDGTNGFLITIHYSGMAKAAAAD |
| Ga0210405_102388522 | 3300021171 | Soil | GFRMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGKAKSASAD |
| Ga0210408_110316932 | 3300021178 | Soil | RHEAFEGDGHKFAYDGTNGFLITIHYSGMAKAAAAD |
| Ga0210396_112636132 | 3300021180 | Soil | YWSAQSNDGFRMWKSKHEAFEGDGHKFAYDGTNGFLITIHYSGMAKAAAAD |
| Ga0210396_113967751 | 3300021180 | Soil | AQSNDGFRMWKSKHEAFEGDGHKFDYAGTNGFLITIHFSGAAKSAAAD |
| Ga0210387_106406182 | 3300021405 | Soil | MWKSKHEAFEGDGHKFAYDGTNGFLITIHYSGMAKAAAAD |
| Ga0210386_118242021 | 3300021406 | Soil | QSNNGFRMWKNKHEAFEGHGHNFSYDGTNGFLITIHFSGQAKTAAAD |
| Ga0210383_106193783 | 3300021407 | Soil | RMWKSKHEAFEGDGHKFSYDGTNGFLITVHFSGAAKSASAD |
| Ga0210383_111849722 | 3300021407 | Soil | TKREAFEGDGHKFDYEGTNGFLITIHFSGAAKSAAAD |
| Ga0210392_101511733 | 3300021475 | Soil | RMWKSKHEAFEGDGHKFAYDGTNGFLITIHYSGMAKAAAAD |
| Ga0210402_107609631 | 3300021478 | Soil | MWKNKHEAFEGDGHKFSYDGTNGFLITIHFSGKAKSASAD |
| Ga0210402_117213122 | 3300021478 | Soil | KYWGAQSNDGFRMWKSEHEAFEGDGHKFAYDGTNGFLITIHFSGAAKSASAD |
| Ga0210409_100505294 | 3300021559 | Soil | GAQSNNGFRMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGSAKAASAD |
| Ga0210409_101490164 | 3300021559 | Soil | SAQSNDGFRMWKSKHEAFEGDGHKFAYDGTNGFLITIHYSGMAKAAAAD |
| Ga0126371_102256073 | 3300021560 | Tropical Forest Soil | GFRMWKSRHESYEGQGQKFDYSGTNGFLITIHFSGTPKA |
| Ga0126371_115261251 | 3300021560 | Tropical Forest Soil | RMWKNKHEAFEGDGHKFSYDGTNGFLITTHFSGNAKASSAD |
| Ga0126371_129957151 | 3300021560 | Tropical Forest Soil | EVVVKNLHYWNAPSNDGFRMWKSKREYFNSQGQKFDYSGTNGFLITIHFSGQAKPVPVAN |
| Ga0242677_10780182 | 3300022713 | Soil | KYWGAQSNDGFRMWKSKHEAFEGDGHKFAYDGTNGFLITIHFSGAAKAAAAD |
| Ga0242665_101933292 | 3300022724 | Soil | HNLTYWKAQSNDGFRMWKNTHEAFEGAGHKFAYEGTNGFLITIHFSGNAKTASAD |
| Ga0137417_14331683 | 3300024330 | Vadose Zone Soil | MWKNKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKAASAD |
| Ga0209399_104033132 | 3300025157 | Thermal Springs | AQSNTGFRMWKNKRHYYEGYGKKIDYSGTNGFLITITFSGQARKAAAD |
| Ga0209350_100002739 | 3300026277 | Grasslands Soil | MWKNKHEAFEGDGHKVSYDGKNGFVIAIHFSGTAKARSAN |
| Ga0209234_10797572 | 3300026295 | Grasslands Soil | GFRMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKPASAD |
| Ga0209238_12100072 | 3300026301 | Grasslands Soil | WKSKHEAFDGHGHKFSYDGSNGFLITIHYSGNAKAASAD |
| Ga0209240_10946271 | 3300026304 | Grasslands Soil | NEGFRMWKSKHEAFEGDGHKFSYDGTNGFLITIHYSGNAKPASAD |
| Ga0209239_11984421 | 3300026310 | Grasslands Soil | AHSHDGFRMWKNKHEAFEGDGHKVSYDGKNGFVIAIHFSGTAKARSAN |
| Ga0209471_13157691 | 3300026318 | Soil | SNDGFRMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKPASAD |
| Ga0209377_11040972 | 3300026334 | Soil | GAQTNDGFRMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKPASAD |
| Ga0209377_12568631 | 3300026334 | Soil | KTKHEYYEGHDEKTDFSGTNGFLITIHFTGKAKAASAD |
| Ga0209804_10334054 | 3300026335 | Soil | KRHSYEGHGQKFDFSGTNGFLITIHFSGQAKPPSAD |
| Ga0257172_10776051 | 3300026482 | Soil | QSNDGFRMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGDAKPASAD |
| Ga0257157_10870692 | 3300026496 | Soil | RMWKSKHETFEGEGHKFSYDGTNGFLITIHFSGNAKPASAD |
| Ga0257164_11003521 | 3300026497 | Soil | HEEFEGKDHKFSYSGTNGFLITIHFSGKAKTAAAGN |
| Ga0257156_11333191 | 3300026498 | Soil | EEFEGKDHKFSYSGTNGFLITIHFSGKAKTAAAGN |
| Ga0209805_11923982 | 3300026542 | Soil | HESFEGDGHKFAYDGTNGFLITIHFSGNAKAGSAD |
| Ga0179587_103649092 | 3300026557 | Vadose Zone Soil | NGFRMWKNKHEAFEGHGHNFSYDGTNGFLITIHFSGQAKAAAAD |
| Ga0179587_111537201 | 3300026557 | Vadose Zone Soil | SNDGFRMWKTKHEAFEGDGHKFAYDGTNGFLITIHYSGMAKTAAAD |
| Ga0207766_10223592 | 3300027042 | Tropical Forest Soil | NDGFRMWKSKHESYEGHDQKFEYSGTNGFLTTIHFSGTAK |
| Ga0209329_10328881 | 3300027605 | Forest Soil | EAFEGDGHKFAYDGTNGFLITIHYSGMAKAAAAAD |
| Ga0209736_10436952 | 3300027660 | Forest Soil | QSNNGFRMWKSKHEAFEGHGHNFSFDGTNGFLITIHFSGQAKTAAAD |
| Ga0209588_10034991 | 3300027671 | Vadose Zone Soil | AQSNDGFRMWKNKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKAASAD |
| Ga0209588_12653272 | 3300027671 | Vadose Zone Soil | KSKHEAFEGDGHKFSYDGTNGFLITIHYSGNAKPASAD |
| Ga0209118_10021011 | 3300027674 | Forest Soil | GFRMWKSKHEAFEGDGHKFSYDGTNGFLITVHFSGNAKPSSAD |
| Ga0209581_10799771 | 3300027706 | Surface Soil | SNDGFRMWKSKTESYDGKGHKFSYQGTNGFLITIHFSGQAQAKPAGN |
| Ga0209180_101012012 | 3300027846 | Vadose Zone Soil | NNGFRMWKNKHEAFEGHGHNFSYDGTNGFLITIHFSGQAKAAAAD |
| Ga0209180_107884871 | 3300027846 | Vadose Zone Soil | VKGDDPAHEVVVHNLKYWLAQSNNGFRMWKSKHEAFEGHGHNFSYEGTNGFLITIHFSGQAKAAVAD |
| Ga0209701_104913942 | 3300027862 | Vadose Zone Soil | AQSNTGFRMWKSKHEYYEGHGHKVDYSGTNGFLITITFSGQAKAATAD |
| Ga0209488_103532533 | 3300027903 | Vadose Zone Soil | KDWLAQSNNGFRMWKNKHEAFEGHGHNFSYDGTNGFLITIHFSGQAKAAAAD |
| Ga0209488_104226332 | 3300027903 | Vadose Zone Soil | FRMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKPASAD |
| Ga0209488_104840792 | 3300027903 | Vadose Zone Soil | FRMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNVKPASAD |
| Ga0209415_103081132 | 3300027905 | Peatlands Soil | WGAQSNDGFRMWKSKHEAFEGDGHKFAYEGTNGFLITIHFSGEAKSAAAD |
| Ga0307504_100064943 | 3300028792 | Soil | RMWKNKHEAFEGHGHNFSYDGTNGFLITIHFSGQAKAAAAD |
| Ga0222749_103325312 | 3300029636 | Soil | WGAQSNDGFRMWKSTHEAFEGDGHKFAYDGTNGFLITIHFSGAAKSASAD |
| Ga0302046_111632742 | 3300030620 | Soil | AAQSNDGFRMWKNRRLYYDHHGKKFEYKDSNGFLITIHFSGQAKQSATD |
| Ga0170823_129522721 | 3300031128 | Forest Soil | TKHEAFEGDGHKFAYDGTNGFLITIHYSGMAKAAD |
| Ga0318541_100853361 | 3300031545 | Soil | SNDGFRMWKSRYESYEGQGQKFDYSGTNGFLITIHFSGAPKA |
| Ga0318560_101901481 | 3300031682 | Soil | NAQANDGFRMWKSRHESYEGQGQKFDYSGTNGFLITIHFSGTPKA |
| Ga0307474_108583542 | 3300031718 | Hardwood Forest Soil | MWKTKHEEFDGKDHKFSYEGTNGFLITIHFSGQAKSAASGN |
| Ga0306917_110048941 | 3300031719 | Soil | RYWNAQANDGFRMWKSRHESYEGQGQKFDYSGTNGFLITIHFSGTPKA |
| Ga0307468_1007293071 | 3300031740 | Hardwood Forest Soil | NDGFRMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKAASAD |
| Ga0306918_106641181 | 3300031744 | Soil | VRYWNAQANDGFRMWKSRHESYEGQGQKFDYSGTNGFLITIHFSGTPKA |
| Ga0307477_100248678 | 3300031753 | Hardwood Forest Soil | LKYWDAHSHDGFRMWKNKHEAFEGDGHKVSYDGKNGFVIAIHFSGNAKARSAD |
| Ga0307475_104347682 | 3300031754 | Hardwood Forest Soil | QSNNGFRMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKPASAD |
| Ga0318509_103946481 | 3300031768 | Soil | VLRNVRYWNAQSNDGFRMWKSRHESYEGQAQKFDYSGTNGFLITIHFSGTPKA |
| Ga0307478_110163962 | 3300031823 | Hardwood Forest Soil | FRMWKTKHEAFEGHGHNFSYDGTNGFLITIHFSGQAKTAAAD |
| Ga0310917_101148193 | 3300031833 | Soil | WNAQSNDGFRMWKSRHESYEGQGQKFDYSGTNGFLITIHFSGTPKA |
| Ga0306919_103255062 | 3300031879 | Soil | KHEAFEGDGHKFSYDGTNGFLITIHFSGNAKASSAD |
| Ga0306923_101721691 | 3300031910 | Soil | VLRNVRYWNAQSNDGFRMWKSRHESYEGQGQKFDYSGTNGFLITIHFSGTPKA |
| Ga0306921_100154078 | 3300031912 | Soil | NKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKASSAD |
| Ga0306921_103151513 | 3300031912 | Soil | QSNDGFRMWKSRHESYEGQGQKFDYSGTNGFLITIHFSGTPKA |
| Ga0310913_112423731 | 3300031945 | Soil | SNDGFRMWKTKREMYEGQGQKFEYSGTNGFLITVHFEGMAKTADAH |
| Ga0310910_113393031 | 3300031946 | Soil | IRYWNAQSNDGFRMWKSRHESYEGQGQKFDYSGTNGFLITIHFSGAPKS |
| Ga0310909_101490001 | 3300031947 | Soil | FRMWKSRHESYEGQGQKFDYSGTNGFLITIHFSGTPKA |
| Ga0214473_118022932 | 3300031949 | Soil | QMWRNKRHYYEGHGQKYDYSGTNGFRITIHFSGQAKKAATAD |
| Ga0307479_100819541 | 3300031962 | Hardwood Forest Soil | NDGFRMWKTKHEEFDGKDHKFSYEGTNGFLITIHFSGQAKSAASGN |
| Ga0307479_101272391 | 3300031962 | Hardwood Forest Soil | NDGFRMWKSKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKPASAD |
| Ga0307479_109959701 | 3300031962 | Hardwood Forest Soil | DGFRMWKSKHEMYDGQGQKFDYSGSNGFLVTIHFTGTAK |
| Ga0307479_120561081 | 3300031962 | Hardwood Forest Soil | RMWKSKHEAFEGDGHKFSYDGTNGFLITVHFSGNAKPASAD |
| Ga0326597_116163562 | 3300031965 | Soil | AQSNTGFRMWKTRQHHYNNHGKKFEYKGTNGFLITIHFSGQAKQAAAD |
| Ga0306922_116933321 | 3300032001 | Soil | VRYWNAQSNDGFRMWKSRHESYEGQGQKFDYSGTNGFLITIHFSGTPKA |
| Ga0306924_107479381 | 3300032076 | Soil | SNDGFRMWKSKHESYEGHDQKFEYSGTNGFLTTIHFSGTAK |
| Ga0306924_114948201 | 3300032076 | Soil | NAQSNDGFRMWKSRHESYEGQGQKFDYSGTNGFLITIHFSGTPKA |
| Ga0311301_100950671 | 3300032160 | Peatlands Soil | DEEVVMKNLRYWNAQSNDGFRMWKSKTERYEGHDQKFEYSGTNGFLITIHFTGTAK |
| Ga0311301_115008571 | 3300032160 | Peatlands Soil | KHEAFEGDGHKFSYDGTNGFLITVHFSGDAKAAAAD |
| Ga0307470_108360251 | 3300032174 | Hardwood Forest Soil | DGFRMWKSKHEAFEGDGHKFAYDGTNGFLITIHYSGAAKAAPAD |
| Ga0307471_1005458611 | 3300032180 | Hardwood Forest Soil | VMHNLKYWSAQSNDGFRMWKSKHEAFEGDGHKFAYDGTNGFLITIHYSGMAKTAAAD |
| Ga0307472_1009292661 | 3300032205 | Hardwood Forest Soil | GFRMWKNKHEEFEGKDHKFAYDGTNGFLITIHFSGQAKTAPAGN |
| Ga0306920_1001278081 | 3300032261 | Soil | QSNDGFRMWKNKHEAFEGDGHKFSYDGTNGFLITIHFSGNAKASSAD |
| Ga0306920_1006755881 | 3300032261 | Soil | RYWNAQSNDGFRMWKSRHESYEGQGQKFDYSGTNGFLITIHFSGTPKA |
| Ga0306920_1009825431 | 3300032261 | Soil | SWNAQANDGFRMWKSRHESYEGQGQKFDYSGTNGFLITIHFSGTPKA |
| Ga0335081_112254781 | 3300032892 | Soil | KNLRYWNAQTNDGFRMWKSRHEAYEGQGQKFDYSGTNGFLITIHFSGTAK |
| Ga0310914_105878751 | 3300033289 | Soil | ANDGFRMWKSRHESYEGQGQKFDYSGTNGFLITIHFSGTPKA |
| ⦗Top⦘ |