Metagenome / Metatranscriptome Family F013619

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F013619
Family Type	Metagenome / Metatranscriptome
Number of Sequences	269
Average Sequence Length	39 residues
Representative Sequence	MKRRFYFMLLVLALILLALPGFAAKAAKRAAGPALRFA
Number of Associated Samples	175
Number of Associated Scaffolds	269

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	38.43 %
% of genes near scaffold ends (potentially truncated)	21.56 %
% of genes from short scaffolds (< 2000 bps)	83.64 %
Associated GOLD sequencing projects	166
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (97.026 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.818 % of family members)
Environment Ontology (ENVO)	Unclassified (30.855 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (55.390 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 51.52% β-sheet: 0.00% Coil/Unstructured: 48.48%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.42
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 269 Family Scaffolds
PF07883	Cupin_2	30.86
PF00581	Rhodanese	6.32
PF00196	GerE	4.46
PF00535	Glycos_transf_2	3.72
PF01741	MscL	2.23
PF07690	MFS_1	2.23
PF06723	MreB_Mbl	1.86
PF02698	DUF218	1.49
PF00005	ABC_tran	1.49
PF08327	AHSA1	1.12
PF07730	HisKA_3	1.12
PF01510	Amidase_2	0.74
PF12833	HTH_18	0.74
PF00291	PALP	0.74
PF05345	He_PIG	0.74
PF01909	NTP_transf_2	0.74
PF00211	Guanylate_cyc	0.74
PF12680	SnoaL_2	0.74
PF03551	PadR	0.74
PF00561	Abhydrolase_1	0.37
PF03734	YkuD	0.37
PF13946	DUF4214	0.37
PF10604	Polyketide_cyc2	0.37
PF03080	Neprosin	0.37
PF04545	Sigma70_r4	0.37
PF08240	ADH_N	0.37
PF13539	Peptidase_M15_4	0.37
PF13240	zinc_ribbon_2	0.37
PF13649	Methyltransf_25	0.37
PF07719	TPR_2	0.37
PF03704	BTAD	0.37
PF12681	Glyoxalase_2	0.37
PF01638	HxlR	0.37
PF14511	RE_EcoO109I	0.37
PF08031	BBE	0.37
PF01565	FAD_binding_4	0.37
PF13419	HAD_2	0.37
PF12637	TSCPD	0.37
PF00486	Trans_reg_C	0.37
PF08281	Sigma70_r4_2	0.37
PF00583	Acetyltransf_1	0.37
PF06841	Phage_T4_gp19	0.37
PF13191	AAA_16	0.37
PF00072	Response_reg	0.37

COG ID	Name	Functional Category	% Frequency in 269 Family Scaffolds
COG1970	Large-conductance mechanosensitive channel	Cell wall/membrane/envelope biogenesis [M]	2.23
COG1077	Cell shape-determining ATPase MreB, actin-like superfamily	Cell cycle control, cell division, chromosome partitioning [D]	1.86
COG1434	Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family	Cell wall/membrane/envelope biogenesis [M]	1.49
COG2949	Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin	Cell wall/membrane/envelope biogenesis [M]	1.49
COG4585	Signal transduction histidine kinase ComP	Signal transduction mechanisms [T]	1.12
COG4564	Signal transduction histidine kinase	Signal transduction mechanisms [T]	1.12
COG3851	Signal transduction histidine kinase UhpB, glucose-6-phosphate specific	Signal transduction mechanisms [T]	1.12
COG3850	Signal transduction histidine kinase NarQ, nitrate/nitrite-specific	Signal transduction mechanisms [T]	1.12
COG1733	DNA-binding transcriptional regulator, HxlR family	Transcription [K]	1.12
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	0.74
COG1846	DNA-binding transcriptional regulator, MarR family	Transcription [K]	0.74
COG1695	DNA-binding transcriptional regulator, PadR family	Transcription [K]	0.74
COG3034	Murein L,D-transpeptidase YafK	Cell wall/membrane/envelope biogenesis [M]	0.37
COG3629	DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain	Transcription [K]	0.37
COG3947	Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains	Transcription [K]	0.37
COG1376	Lipoprotein-anchoring transpeptidase ErfK/SrfK	Cell wall/membrane/envelope biogenesis [M]	0.37
COG0277	FAD/FMN-containing lactate dehydrogenase/glycolate oxidase	Energy production and conversion [C]	0.37

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	97.03 %
Unclassified	root	N/A	2.97 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	97.03 %
Unclassified	root	N/A	2.97 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	97.03 %
Unclassified	root	N/A	2.97 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	85.50 %
Unclassified	root	N/A	2.97 %

Name	Rank	Taxonomy	Distribution
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	63.20 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	14.13 %
Unclassified	root	N/A	2.97 %

Name	Rank	Taxonomy	Distribution
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	17.84 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	14.13 %
Thermoleophilia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	5.58 %
Unclassified	root	N/A	2.97 %
unclassified Actinobacteria	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria	0.37 %

Name	Rank	Taxonomy	Distribution
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	15.61 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	14.13 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples	3.35 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	2.23 %
Unclassified	root	N/A	2.97 %
Actinobacteria bacterium 13_1_20CM_4_69_9	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9	0.37 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.37 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.37 %

Name	Rank	Taxonomy	Distribution
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	15.61 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	14.13 %
uncultured Thermoleophilia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium	3.35 %
Unclassified	root	N/A	2.97 %
Solirubrobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae	1.12 %
Nocardioidaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae	0.37 %
Actinobacteria bacterium 13_1_20CM_4_69_9	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9	0.37 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.37 %

Name	Rank	Taxonomy	Distribution
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	15.61 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	14.13 %
uncultured Thermoleophilia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium	3.35 %
Unclassified	root	N/A	2.97 %
Solirubrobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	1.12 %
Marmoricola	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Marmoricola	0.37 %
Actinobacteria bacterium 13_1_20CM_4_69_9	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9	0.37 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.37 %

Name	Rank	Taxonomy	Distribution
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	15.61 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	14.13 %
uncultured Thermoleophilia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium	3.35 %
Unclassified	root	N/A	2.97 %
unclassified Marmoricola	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Marmoricola → unclassified Marmoricola	0.37 %
Actinobacteria bacterium 13_1_20CM_4_69_9	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9	0.37 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.37 %
Solirubrobacter soli	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli	0.74 %

Name	Rank	Taxonomy	Distribution
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	15.61 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	14.13 %
uncultured Thermoleophilia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium	3.35 %
Unclassified	root	N/A	2.97 %
Marmoricola sp. URHB0036	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Marmoricola → unclassified Marmoricola → Marmoricola sp. URHB0036	0.37 %
Actinobacteria bacterium 13_1_20CM_4_69_9	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9	0.37 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.37 %
Solirubrobacter soli	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli	0.74 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2124908016\|OU_2_1_1_newblercontig106617	All Organisms → cellular organisms → Bacteria → Terrabacteria group	897	Open in IMG/M
2170459004\|F62QY1Z01BBC2A	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	519	Open in IMG/M
2170459019\|G14TP7Y02HR3IS	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	640	Open in IMG/M
3300000033\|ICChiseqgaiiDRAFT_c2036285	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	610	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_101744292	All Organisms → cellular organisms → Bacteria	2122	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_101746537	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1035	Open in IMG/M
3300000956\|JGI10216J12902_101930464	All Organisms → cellular organisms → Bacteria	1368	Open in IMG/M
3300000956\|JGI10216J12902_110174241	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	961	Open in IMG/M
3300000956\|JGI10216J12902_113589816	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1488	Open in IMG/M
3300000956\|JGI10216J12902_122557014	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1609	Open in IMG/M
3300004114\|Ga0062593_101193769	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium	798	Open in IMG/M
3300004114\|Ga0062593_101903761	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	657	Open in IMG/M
3300004479\|Ga0062595_100383621	All Organisms → cellular organisms → Bacteria → Terrabacteria group	997	Open in IMG/M
3300004479\|Ga0062595_101020295	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	713	Open in IMG/M
3300004479\|Ga0062595_102608330	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	507	Open in IMG/M
3300005093\|Ga0062594_100359667	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1149	Open in IMG/M
3300005172\|Ga0066683_10526202	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	722	Open in IMG/M
3300005174\|Ga0066680_10465316	All Organisms → cellular organisms → Bacteria → Terrabacteria group	797	Open in IMG/M
3300005177\|Ga0066690_11008173	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	523	Open in IMG/M
3300005178\|Ga0066688_10340680	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	970	Open in IMG/M
3300005181\|Ga0066678_10559971	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	759	Open in IMG/M
3300005181\|Ga0066678_11048078	All Organisms → cellular organisms → Bacteria	527	Open in IMG/M
3300005186\|Ga0066676_11182070	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	501	Open in IMG/M
3300005187\|Ga0066675_10728968	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	746	Open in IMG/M
3300005445\|Ga0070708_100061257	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3361	Open in IMG/M
3300005450\|Ga0066682_10462730	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	805	Open in IMG/M
3300005468\|Ga0070707_100009180	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	9173	Open in IMG/M
3300005468\|Ga0070707_100037808	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	4609	Open in IMG/M
3300005518\|Ga0070699_100027799	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli	4877	Open in IMG/M
3300005526\|Ga0073909_10033921	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1766	Open in IMG/M
3300005526\|Ga0073909_10236176	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	806	Open in IMG/M
3300005526\|Ga0073909_10662155	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	520	Open in IMG/M
3300005536\|Ga0070697_100380950	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1222	Open in IMG/M
3300005540\|Ga0066697_10227434	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1108	Open in IMG/M
3300005540\|Ga0066697_10705873	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	552	Open in IMG/M
3300005543\|Ga0070672_100054005	All Organisms → cellular organisms → Bacteria	3143	Open in IMG/M
3300005553\|Ga0066695_10559839	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	693	Open in IMG/M
3300005555\|Ga0066692_10744803	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	605	Open in IMG/M
3300005557\|Ga0066704_10022520	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3740	Open in IMG/M
3300005558\|Ga0066698_11083626	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	507	Open in IMG/M
3300005559\|Ga0066700_10702477	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	693	Open in IMG/M
3300005560\|Ga0066670_10197463	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1206	Open in IMG/M
3300005560\|Ga0066670_10581364	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	683	Open in IMG/M
3300005561\|Ga0066699_10089981	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2000	Open in IMG/M
3300005569\|Ga0066705_10337049	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	953	Open in IMG/M
3300005569\|Ga0066705_10863260	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	538	Open in IMG/M
3300005713\|Ga0066905_100093844	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2015	Open in IMG/M
3300005764\|Ga0066903_100083459	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli	4190	Open in IMG/M
3300005764\|Ga0066903_100352553	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2380	Open in IMG/M
3300005764\|Ga0066903_107713240	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	554	Open in IMG/M
3300005985\|Ga0081539_10047584	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2447	Open in IMG/M
3300006028\|Ga0070717_10291439	All Organisms → cellular organisms → Bacteria	1449	Open in IMG/M
3300006031\|Ga0066651_10645764	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	565	Open in IMG/M
3300006034\|Ga0066656_10780806	All Organisms → cellular organisms → Bacteria	612	Open in IMG/M
3300006046\|Ga0066652_100015851	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	5027	Open in IMG/M
3300006046\|Ga0066652_100043486	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3332	Open in IMG/M
3300006046\|Ga0066652_100457892	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1176	Open in IMG/M
3300006794\|Ga0066658_10889690	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	511	Open in IMG/M
3300006796\|Ga0066665_11254203	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	567	Open in IMG/M
3300006800\|Ga0066660_10341631	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1212	Open in IMG/M
3300006854\|Ga0075425_100858025	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1039	Open in IMG/M
3300007258\|Ga0099793_10136072	All Organisms → cellular organisms → Bacteria	1158	Open in IMG/M
3300009012\|Ga0066710_100065083	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	4635	Open in IMG/M
3300009012\|Ga0066710_100197049	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2862	Open in IMG/M
3300009012\|Ga0066710_100359217	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2157	Open in IMG/M
3300009012\|Ga0066710_100444121	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1943	Open in IMG/M
3300009012\|Ga0066710_100670763	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1578	Open in IMG/M
3300009012\|Ga0066710_101535722	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1025	Open in IMG/M
3300009012\|Ga0066710_101563582	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1013	Open in IMG/M
3300009088\|Ga0099830_11103730	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	658	Open in IMG/M
3300009090\|Ga0099827_10001752	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	11547	Open in IMG/M
3300009090\|Ga0099827_10224286	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1571	Open in IMG/M
3300009101\|Ga0105247_10350422	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1038	Open in IMG/M
3300009137\|Ga0066709_101052885	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1194	Open in IMG/M
3300009137\|Ga0066709_102229907	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium	754	Open in IMG/M
3300009137\|Ga0066709_103202995	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	597	Open in IMG/M
3300009551\|Ga0105238_10617932	All Organisms → cellular organisms → Bacteria	1092	Open in IMG/M
3300009789\|Ga0126307_11657444	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	520	Open in IMG/M
3300009792\|Ga0126374_10146223	All Organisms → cellular organisms → Bacteria	1425	Open in IMG/M
3300009817\|Ga0105062_1129370	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	517	Open in IMG/M
3300009817\|Ga0105062_1130123	Not Available	516	Open in IMG/M
3300009818\|Ga0105072_1055176	All Organisms → cellular organisms → Bacteria → Terrabacteria group	760	Open in IMG/M
3300009837\|Ga0105058_1006975	All Organisms → cellular organisms → Bacteria	2134	Open in IMG/M
3300009840\|Ga0126313_10891054	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	726	Open in IMG/M
3300010043\|Ga0126380_11778201	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	556	Open in IMG/M
3300010046\|Ga0126384_10049417	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	2892	Open in IMG/M
3300010166\|Ga0126306_11043922	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	667	Open in IMG/M
3300010301\|Ga0134070_10136904	All Organisms → cellular organisms → Bacteria	872	Open in IMG/M
3300010322\|Ga0134084_10421572	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	525	Open in IMG/M
3300010325\|Ga0134064_10166300	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	772	Open in IMG/M
3300010329\|Ga0134111_10211882	All Organisms → cellular organisms → Bacteria → Terrabacteria group	786	Open in IMG/M
3300010333\|Ga0134080_10095312	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1218	Open in IMG/M
3300010333\|Ga0134080_10186846	All Organisms → cellular organisms → Bacteria → Terrabacteria group	893	Open in IMG/M
3300010333\|Ga0134080_10524021	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	566	Open in IMG/M
3300010335\|Ga0134063_10714528	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	519	Open in IMG/M
3300010336\|Ga0134071_10340680	All Organisms → cellular organisms → Bacteria → Terrabacteria group	757	Open in IMG/M
3300010336\|Ga0134071_10653718	Not Available	553	Open in IMG/M
3300010359\|Ga0126376_11966559	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	626	Open in IMG/M
3300010396\|Ga0134126_11073505	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	899	Open in IMG/M
3300010399\|Ga0134127_11917590	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	670	Open in IMG/M
3300010999\|Ga0138505_100023538	All Organisms → cellular organisms → Bacteria → Terrabacteria group	804	Open in IMG/M
3300011003\|Ga0138514_100049585	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	845	Open in IMG/M
3300011992\|Ga0120146_1053328	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	669	Open in IMG/M
3300012014\|Ga0120159_1044642	All Organisms → cellular organisms → Bacteria	1434	Open in IMG/M
3300012096\|Ga0137389_10345064	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1266	Open in IMG/M
3300012096\|Ga0137389_11630519	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	541	Open in IMG/M
3300012189\|Ga0137388_10198496	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1807	Open in IMG/M
3300012200\|Ga0137382_10112432	All Organisms → cellular organisms → Bacteria	1810	Open in IMG/M
3300012200\|Ga0137382_10859846	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	654	Open in IMG/M
3300012200\|Ga0137382_11023887	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	592	Open in IMG/M
3300012201\|Ga0137365_10001980	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	16181	Open in IMG/M
3300012201\|Ga0137365_10477365	All Organisms → cellular organisms → Bacteria	917	Open in IMG/M
3300012204\|Ga0137374_10021586	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	7283	Open in IMG/M
3300012204\|Ga0137374_10038013	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	5138	Open in IMG/M
3300012204\|Ga0137374_10063174	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3701	Open in IMG/M
3300012204\|Ga0137374_10517570	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	923	Open in IMG/M
3300012204\|Ga0137374_10657006	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	793	Open in IMG/M
3300012204\|Ga0137374_10837847	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	680	Open in IMG/M
3300012204\|Ga0137374_11071334	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	576	Open in IMG/M
3300012204\|Ga0137374_11258905	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9	513	Open in IMG/M
3300012206\|Ga0137380_10243381	All Organisms → cellular organisms → Bacteria	1623	Open in IMG/M
3300012206\|Ga0137380_10493663	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1079	Open in IMG/M
3300012206\|Ga0137380_10941656	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium	740	Open in IMG/M
3300012206\|Ga0137380_10951151	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	736	Open in IMG/M
3300012206\|Ga0137380_11712448	Not Available	512	Open in IMG/M
3300012207\|Ga0137381_10930606	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	751	Open in IMG/M
3300012207\|Ga0137381_11164065	All Organisms → cellular organisms → Bacteria → Terrabacteria group	663	Open in IMG/M
3300012208\|Ga0137376_10193136	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1760	Open in IMG/M
3300012208\|Ga0137376_10520528	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1031	Open in IMG/M
3300012208\|Ga0137376_10566435	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	984	Open in IMG/M
3300012209\|Ga0137379_10307457	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1496	Open in IMG/M
3300012209\|Ga0137379_11221040	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	659	Open in IMG/M
3300012210\|Ga0137378_11042586	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	732	Open in IMG/M
3300012211\|Ga0137377_10116101	All Organisms → cellular organisms → Bacteria	2548	Open in IMG/M
3300012285\|Ga0137370_10733732	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	613	Open in IMG/M
3300012350\|Ga0137372_10028111	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	5180	Open in IMG/M
3300012351\|Ga0137386_11261556	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	514	Open in IMG/M
3300012353\|Ga0137367_10617152	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	758	Open in IMG/M
3300012355\|Ga0137369_10015521	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	7342	Open in IMG/M
3300012355\|Ga0137369_10053773	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	3507	Open in IMG/M
3300012356\|Ga0137371_10251457	All Organisms → cellular organisms → Bacteria	1380	Open in IMG/M
3300012356\|Ga0137371_10436809	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1013	Open in IMG/M
3300012356\|Ga0137371_10799796	All Organisms → cellular organisms → Bacteria	719	Open in IMG/M
3300012356\|Ga0137371_11424853	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	507	Open in IMG/M
3300012358\|Ga0137368_10067628	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2914	Open in IMG/M
3300012358\|Ga0137368_10217920	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1343	Open in IMG/M
3300012358\|Ga0137368_10668873	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	655	Open in IMG/M
3300012359\|Ga0137385_10375865	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1214	Open in IMG/M
3300012359\|Ga0137385_10986142	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	695	Open in IMG/M
3300012362\|Ga0137361_11668844	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	557	Open in IMG/M
3300012469\|Ga0150984_106230611	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	520	Open in IMG/M
3300012685\|Ga0137397_10166477	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1636	Open in IMG/M
3300012685\|Ga0137397_10641005	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	790	Open in IMG/M
3300012929\|Ga0137404_11950923	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	547	Open in IMG/M
3300012955\|Ga0164298_10084739	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1636	Open in IMG/M
3300012955\|Ga0164298_10207082	All Organisms → cellular organisms → Bacteria	1151	Open in IMG/M
3300012957\|Ga0164303_11104415	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	573	Open in IMG/M
3300012958\|Ga0164299_10013451	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	3137	Open in IMG/M
3300012958\|Ga0164299_10128314	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1368	Open in IMG/M
3300012958\|Ga0164299_10380181	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	900	Open in IMG/M
3300012958\|Ga0164299_10788552	All Organisms → cellular organisms → Bacteria → Terrabacteria group	676	Open in IMG/M
3300012960\|Ga0164301_11475256	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	559	Open in IMG/M
3300012971\|Ga0126369_13706092	All Organisms → cellular organisms → Bacteria	501	Open in IMG/M
3300012975\|Ga0134110_10516531	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	545	Open in IMG/M
3300012987\|Ga0164307_10160835	Not Available	1489	Open in IMG/M
3300012988\|Ga0164306_10208340	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1376	Open in IMG/M
3300012988\|Ga0164306_10288044	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1193	Open in IMG/M
3300012989\|Ga0164305_11495061	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	599	Open in IMG/M
3300014150\|Ga0134081_10145733	All Organisms → cellular organisms → Bacteria → Terrabacteria group	775	Open in IMG/M
3300014150\|Ga0134081_10244118	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	625	Open in IMG/M
3300014166\|Ga0134079_10035627	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1691	Open in IMG/M
3300014325\|Ga0163163_11089735	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	862	Open in IMG/M
3300015357\|Ga0134072_10408277	Not Available	537	Open in IMG/M
3300015359\|Ga0134085_10506249	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	553	Open in IMG/M
3300017654\|Ga0134069_1329691	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	546	Open in IMG/M
3300017657\|Ga0134074_1377322	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	526	Open in IMG/M
3300018000\|Ga0184604_10123443	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium	828	Open in IMG/M
3300018027\|Ga0184605_10000143	All Organisms → cellular organisms → Bacteria	20145	Open in IMG/M
3300018027\|Ga0184605_10082940	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1400	Open in IMG/M
3300018027\|Ga0184605_10095178	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1310	Open in IMG/M
3300018027\|Ga0184605_10224904	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	853	Open in IMG/M
3300018027\|Ga0184605_10505762	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	525	Open in IMG/M
3300018028\|Ga0184608_10190078	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	897	Open in IMG/M
3300018051\|Ga0184620_10157171	All Organisms → cellular organisms → Bacteria → Terrabacteria group	738	Open in IMG/M
3300018052\|Ga0184638_1000046	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	26916	Open in IMG/M
3300018056\|Ga0184623_10204075	All Organisms → cellular organisms → Bacteria → Terrabacteria group	909	Open in IMG/M
3300018061\|Ga0184619_10061292	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1650	Open in IMG/M
3300018061\|Ga0184619_10093726	All Organisms → cellular organisms → Bacteria	1344	Open in IMG/M
3300018061\|Ga0184619_10129131	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1147	Open in IMG/M
3300018061\|Ga0184619_10138657	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1106	Open in IMG/M
3300018061\|Ga0184619_10193536	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium	934	Open in IMG/M
3300018071\|Ga0184618_10004817	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	3712	Open in IMG/M
3300018071\|Ga0184618_10012994	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2570	Open in IMG/M
3300018071\|Ga0184618_10138732	Not Available	985	Open in IMG/M
3300018076\|Ga0184609_10231294	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	864	Open in IMG/M
3300018081\|Ga0184625_10067144	All Organisms → cellular organisms → Bacteria	1818	Open in IMG/M
3300018433\|Ga0066667_10069416	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2221	Open in IMG/M
3300018433\|Ga0066667_11066849	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	698	Open in IMG/M
3300018433\|Ga0066667_11722190	All Organisms → cellular organisms → Bacteria	563	Open in IMG/M
3300018468\|Ga0066662_10013839	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	4302	Open in IMG/M
3300018468\|Ga0066662_11185683	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	771	Open in IMG/M
3300018482\|Ga0066669_10085741	All Organisms → cellular organisms → Bacteria	2136	Open in IMG/M
3300018482\|Ga0066669_10231756	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1443	Open in IMG/M
3300018482\|Ga0066669_10575099	All Organisms → cellular organisms → Bacteria	985	Open in IMG/M
3300018482\|Ga0066669_12401634	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	505	Open in IMG/M
3300018482\|Ga0066669_12409676	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	504	Open in IMG/M
3300019867\|Ga0193704_1053196	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium	789	Open in IMG/M
3300019869\|Ga0193705_1066424	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	719	Open in IMG/M
3300019875\|Ga0193701_1041937	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium	934	Open in IMG/M
3300019885\|Ga0193747_1105483	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	680	Open in IMG/M
3300021078\|Ga0210381_10366152	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	529	Open in IMG/M
3300021080\|Ga0210382_10007140	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3683	Open in IMG/M
3300021080\|Ga0210382_10105124	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1179	Open in IMG/M
3300022694\|Ga0222623_10260255	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	669	Open in IMG/M
3300024330\|Ga0137417_1281508	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	524	Open in IMG/M
3300025910\|Ga0207684_10637214	All Organisms → cellular organisms → Bacteria → Terrabacteria group	909	Open in IMG/M
3300025921\|Ga0207652_11226762	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	652	Open in IMG/M
3300025922\|Ga0207646_10002884	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	19952	Open in IMG/M
3300025922\|Ga0207646_10527282	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1063	Open in IMG/M
3300025939\|Ga0207665_10024291	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3996	Open in IMG/M
3300025939\|Ga0207665_10728083	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	781	Open in IMG/M
3300026297\|Ga0209237_1145297	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	935	Open in IMG/M
3300026312\|Ga0209153_1057168	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1394	Open in IMG/M
3300026314\|Ga0209268_1143529	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	587	Open in IMG/M
3300026323\|Ga0209472_1255851	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	559	Open in IMG/M
3300026325\|Ga0209152_10281332	All Organisms → cellular organisms → Bacteria	620	Open in IMG/M
3300026326\|Ga0209801_1065131	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1626	Open in IMG/M
3300026329\|Ga0209375_1169183	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	889	Open in IMG/M
3300026523\|Ga0209808_1054948	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1801	Open in IMG/M
3300026542\|Ga0209805_1226806	All Organisms → cellular organisms → Bacteria → Terrabacteria group	774	Open in IMG/M
3300026550\|Ga0209474_10719237	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	518	Open in IMG/M
3300026552\|Ga0209577_10484464	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	835	Open in IMG/M
3300026552\|Ga0209577_10788403	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	531	Open in IMG/M
3300027056\|Ga0209879_1028100	All Organisms → cellular organisms → Bacteria	934	Open in IMG/M
3300027561\|Ga0209887_1067230	All Organisms → cellular organisms → Bacteria → Terrabacteria group	751	Open in IMG/M
3300027577\|Ga0209874_1003714	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	4622	Open in IMG/M
3300027882\|Ga0209590_10022949	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3181	Open in IMG/M
3300027882\|Ga0209590_10159081	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1406	Open in IMG/M
3300027907\|Ga0207428_11209195	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	525	Open in IMG/M
3300028705\|Ga0307276_10058394	All Organisms → cellular organisms → Bacteria → Terrabacteria group	870	Open in IMG/M
3300028713\|Ga0307303_10042319	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium	946	Open in IMG/M
3300028713\|Ga0307303_10128194	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	598	Open in IMG/M
3300028715\|Ga0307313_10082832	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	965	Open in IMG/M
3300028715\|Ga0307313_10124452	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	790	Open in IMG/M
3300028715\|Ga0307313_10163573	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	688	Open in IMG/M
3300028715\|Ga0307313_10176658	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	661	Open in IMG/M
3300028717\|Ga0307298_10253417	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	523	Open in IMG/M
3300028721\|Ga0307315_10111947	Not Available	810	Open in IMG/M
3300028722\|Ga0307319_10110381	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	883	Open in IMG/M
3300028784\|Ga0307282_10091562	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1403	Open in IMG/M
3300028784\|Ga0307282_10133875	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1167	Open in IMG/M
3300028784\|Ga0307282_10204992	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	943	Open in IMG/M
3300028791\|Ga0307290_10293746	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	595	Open in IMG/M
3300028799\|Ga0307284_10011824	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2632	Open in IMG/M
3300028811\|Ga0307292_10090191	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1195	Open in IMG/M
3300028814\|Ga0307302_10331146	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	750	Open in IMG/M
3300028824\|Ga0307310_10109067	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1239	Open in IMG/M
3300028828\|Ga0307312_10656850	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	694	Open in IMG/M
3300028876\|Ga0307286_10030926	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Marmoricola → unclassified Marmoricola → Marmoricola sp. URHB0036	1765	Open in IMG/M
3300028878\|Ga0307278_10047478	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1946	Open in IMG/M
3300028878\|Ga0307278_10540136	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	508	Open in IMG/M
3300028881\|Ga0307277_10394167	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	619	Open in IMG/M
3300030990\|Ga0308178_1069120	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium	697	Open in IMG/M
3300031226\|Ga0307497_10022555	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1963	Open in IMG/M
3300031716\|Ga0310813_11152968	All Organisms → cellular organisms → Bacteria → Terrabacteria group	712	Open in IMG/M
3300031720\|Ga0307469_11732996	All Organisms → cellular organisms → Bacteria	603	Open in IMG/M
3300031740\|Ga0307468_100223671	All Organisms → cellular organisms → Bacteria	1297	Open in IMG/M
3300031938\|Ga0308175_101315837	All Organisms → cellular organisms → Bacteria	805	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	96.65%
Host-Associated	Host-Associated	2.97%
Engineered	Engineered	0.37%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	87.36%
Aquatic	Environmental → Aquatic	8.92%
Plants	Host-Associated → Plants	2.97%
Unclassified	Environmental → Unclassified	0.37%
Solid Waste	Engineered → Solid Waste	0.37%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	86.62%
Sediment	Environmental → Aquatic → Sediment	7.81%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.23%
Freshwater	Environmental → Aquatic → Freshwater	1.12%
Agricultural Field	Environmental → Terrestrial → Agricultural Field	0.74%
Unclassified	Environmental → Unclassified → Unclassified	0.37%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.37%
Roots	Host-Associated → Plants → Roots	0.37%
Grass	Engineered → Solid Waste → Grass	0.37%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	77.70%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	7.81%
Loam	Environmental → Terrestrial → Soil → Loam	6.32%
Sand	Environmental → Terrestrial → Soil → Sand	2.60%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.12%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.49%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified	0.74%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.74%
Unclassified	Environmental → Unclassified → Unclassified → Unclassified	0.37%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.37%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.37%
Composting	Engineered → Solid Waste → Grass → Composting	0.37%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	47.96%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	25.65%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	7.81%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.46%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	2.60%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.23%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.86%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.12%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.49%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.74%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.74%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified	0.74%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.74%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.37%
Unclassified	Environmental → Unclassified → Unclassified → Unclassified → Unclassified	0.37%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.37%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.37%
Unclassified	Engineered → Solid Waste → Grass → Composting → Unclassified	0.37%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	20.82%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	17.47%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	15.61%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	7.81%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	7.43%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	6.69%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.09%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	2.60%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.23%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.86%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.86%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	1.12%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	1.12%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	1.12%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.74%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.74%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.74%
Soil	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil	0.74%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	0.74%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.37%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.37%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.37%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.37%
	Environmental → Unclassified → Unclassified → Unclassified → Unclassified →	0.37%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.37%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.37%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.37%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.37%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.37%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.37%
Switchgrass, Maize And Mischanthus Litter	Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter	0.37%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2124908016	Sample 642	Environmental	Open in IMG/M
2170459004	Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm (2)	Environmental	Open in IMG/M
2170459019	Litter degradation MG4	Engineered	Open in IMG/M
3300000033	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005172	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132	Environmental	Open in IMG/M
3300005174	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129	Environmental	Open in IMG/M
3300005177	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139	Environmental	Open in IMG/M
3300005178	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137	Environmental	Open in IMG/M
3300005181	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127	Environmental	Open in IMG/M
3300005186	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125	Environmental	Open in IMG/M
3300005187	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005450	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131	Environmental	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005526	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005553	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144	Environmental	Open in IMG/M
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental	Open in IMG/M
3300005557	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153	Environmental	Open in IMG/M
3300005558	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119	Environmental	Open in IMG/M
3300005561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148	Environmental	Open in IMG/M
3300005569	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Host-Associated	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006031	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100	Environmental	Open in IMG/M
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006794	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107	Environmental	Open in IMG/M
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300009789	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28	Environmental	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300009817	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20	Environmental	Open in IMG/M
3300009818	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40	Environmental	Open in IMG/M
3300009837	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30	Environmental	Open in IMG/M
3300009840	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010166	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27	Environmental	Open in IMG/M
3300010301	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015	Environmental	Open in IMG/M
3300010322	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010325	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG	Environmental	Open in IMG/M
3300010329	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015	Environmental	Open in IMG/M
3300010333	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015	Environmental	Open in IMG/M
3300010336	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010999	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015	Environmental	Open in IMG/M
3300011003	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015	Environmental	Open in IMG/M
3300011992	Permafrost microbial communities from Nunavut, Canada - A23_65cm_12M	Environmental	Open in IMG/M
3300012014	Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M	Environmental	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012351	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG	Environmental	Open in IMG/M
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental	Open in IMG/M
3300012355	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG	Environmental	Open in IMG/M
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental	Open in IMG/M
3300012358	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG	Environmental	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012975	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015	Environmental	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300014150	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300014166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300015357	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG	Environmental	Open in IMG/M
3300015359	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015	Environmental	Open in IMG/M
3300017654	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG	Environmental	Open in IMG/M
3300017657	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015	Environmental	Open in IMG/M
3300018000	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex	Environmental	Open in IMG/M
3300018027	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex	Environmental	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018051	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1	Environmental	Open in IMG/M
3300018052	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2	Environmental	Open in IMG/M
3300018056	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1	Environmental	Open in IMG/M
3300018061	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1	Environmental	Open in IMG/M
3300018071	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1	Environmental	Open in IMG/M
3300018076	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex	Environmental	Open in IMG/M
3300018081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019867	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1	Environmental	Open in IMG/M
3300019869	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2	Environmental	Open in IMG/M
3300019875	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2	Environmental	Open in IMG/M
3300019885	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2	Environmental	Open in IMG/M
3300021078	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo	Environmental	Open in IMG/M
3300021080	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo	Environmental	Open in IMG/M
3300022694	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex	Environmental	Open in IMG/M
3300024330	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300026297	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026312	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)	Environmental	Open in IMG/M
3300026314	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes)	Environmental	Open in IMG/M
3300026323	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)	Environmental	Open in IMG/M
3300026325	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)	Environmental	Open in IMG/M
3300026326	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)	Environmental	Open in IMG/M
3300026329	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)	Environmental	Open in IMG/M
3300026523	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)	Environmental	Open in IMG/M
3300026542	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)	Environmental	Open in IMG/M
3300026550	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)	Environmental	Open in IMG/M
3300026552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)	Environmental	Open in IMG/M
3300027056	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes)	Environmental	Open in IMG/M
3300027561	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes)	Environmental	Open in IMG/M
3300027577	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)	Environmental	Open in IMG/M
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300028705	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115	Environmental	Open in IMG/M
3300028713	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184	Environmental	Open in IMG/M
3300028715	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203	Environmental	Open in IMG/M
3300028717	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158	Environmental	Open in IMG/M
3300028721	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355	Environmental	Open in IMG/M
3300028722	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368	Environmental	Open in IMG/M
3300028784	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121	Environmental	Open in IMG/M
3300028791	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144	Environmental	Open in IMG/M
3300028799	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123	Environmental	Open in IMG/M
3300028811	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149	Environmental	Open in IMG/M
3300028814	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183	Environmental	Open in IMG/M
3300028824	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197	Environmental	Open in IMG/M
3300028828	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202	Environmental	Open in IMG/M
3300028876	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140	Environmental	Open in IMG/M
3300028878	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117	Environmental	Open in IMG/M
3300028881	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116	Environmental	Open in IMG/M
3300030990	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
OU_00844190	2124908016		MRRRFYFVLAVLALLLLALPGFATKGVRRAVRPALRFA
E4B_03599680	2170459004	Grass Soil	MRKKHFYFMLLVLALILLALPGFAAKAARRAARPALRFA
4MG_04400260	2170459019	Switchgrass, Maize And Mischanthus Litter	MRRRFYFVLAVLALLLLALPGFAANAARRAARPALRL
ICChiseqgaiiDRAFT_20362852	3300000033	Soil	MKRRFYFVLLVLALILLALPGFAAKGAKRVARPTLRVA*
INPhiseqgaiiFebDRAFT_1017442923	3300000364	Soil	MRRRFYFVLAVLALLLLALPGFAAKGVRRAVRPALRFA*
INPhiseqgaiiFebDRAFT_1017465371	3300000364	Soil	MKRRFYFILVVLALLVLAVPGFAAKAAKRAARPALRFA*
JGI10216J12902_1019304641	3300000956	Soil	RSDMRKKHFYFMLLVLALVLLALPGFAAKAAKRAAGPALRFA*
JGI10216J12902_1101742412	3300000956	Soil	MKRRFYFILLVLALVVLAVPGFAAKAAKWAARPALRVA*
JGI10216J12902_1135898163	3300000956	Soil	MKRRMKRRFYFMLLVFGLILLALPGFAVKAAKRAAEPVLRFA*
JGI10216J12902_1225570143	3300000956	Soil	MRRRRFYFILLVIALILLALPGFAAKAGRRAARPVLRFA*
Ga0062593_1011937691	3300004114	Soil	MRKKHFYFMLLVLALILLALPGFAAKAAKRVTGPALRFA*
Ga0062593_1019037612	3300004114	Soil	MRKRRFYFILLVLALILLALPGFAAKAAKRAAGPALRFA*
Ga0062595_1003836212	3300004479	Soil	MRRRRFYFILLVIALILLALPGFAAKAAKRATGPVLRLA*
Ga0062595_1010202952	3300004479	Soil	MRRRRFYFILLVIGLILLALPGFAAKAAKRTARPVLRCA*
Ga0062595_1026083302	3300004479	Soil	MKRRFYFILLVLALLVLSGPGFAAKAAKRAARPALRFAQPRKVALP*
Ga0062594_1003596672	3300005093	Soil	MKRRFYFILLVLALLVLSGPGFAAKAAKRAARPALRFAQPRKVTLP*
Ga0066683_105262022	3300005172	Soil	MRKKHFYFMLLVLALILLALPGFAAKAAKRAARPALRFA*
Ga0066680_104653161	3300005174	Soil	MRRRRFYFILLVLALILLALPGFAAKAAKRTVRPALRFA*
Ga0066690_110081732	3300005177	Soil	MRRRRFYFILLVVALILLALPGFAAKAAKRAAGPALRFA*
Ga0066688_103406802	3300005178	Soil	MRKKHFYFVLLVLAVILLALPGFAAKAAKRAAGPALRFA*
Ga0066678_105599712	3300005181	Soil	MRRKHFYFVLLVLALILLALPGFAAKAAKRAAGPALRFA*
Ga0066678_110480782	3300005181	Soil	AEGGTMKKRFYFTLLVLALLLLALPGFAAKAARRTVRPALRFA*
Ga0066676_111820701	3300005186	Soil	MRRKHFYFMLLVLALILLALPGFAAKAAKRATGPALRFA*
Ga0066675_107289681	3300005187	Soil	FRRPEMRRRRFYFILLVIALILLALPGFAAKAARRTARPVLRFA*
Ga0070708_1000612575	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MRKKHFYFVLLVLALILLALPGFAAKAAKRAAGPALRFA*
Ga0066682_104627301	3300005450	Soil	RRSRRPEMRRRRFYFILLVLALILLALPGFAAKAAKRAAGPALRFA*
Ga0070707_1000091804	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	MRKKHFYFVLLVLALVLLALPGFAAKAAKRAAGPALRFA*
Ga0070707_1000378085	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	MKKRFYFILLVLALILLALPGFAAKVTKRLTGTRLRVATA*
Ga0070699_1000277996	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	MRKKHFYFMLLVLALILLALPGFAAKAAKKAAGPALRFA*
Ga0073909_100339212	3300005526	Surface Soil	MKRRFYFTLVVLALILLALPGFAAKAAKRAAGPALRFA*
Ga0073909_102361761	3300005526	Surface Soil	MKRRFYFTLVVLALILLALPGFAAKAARRAAGPALRFA*
Ga0073909_106621551	3300005526	Surface Soil	LPRSPQSEMKRRFYFTLVVLALILLALPGFAAKAAKRAAGPALRFA*
Ga0070697_1003809502	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	MRRKHFYFMLLVLALILLALPGFAAKAAKRTARPVFRFA*
Ga0066697_102274342	3300005540	Soil	MRRRRFYFILLVLALILLALPGFAAKAAKRAAGPALRFA*
Ga0066697_107058731	3300005540	Soil	FYFMLLVLTLILLALPGFAAKAAKRAARPALRFA*
Ga0070672_1000540052	3300005543	Miscanthus Rhizosphere	MKRRLYFTLVVLALILLALPGFAAKAAKRAAAPALRFA*
Ga0066695_105598391	3300005553	Soil	AGGLAMKRRFYFILVVLALVLLAIPGFAAKAAKRAAGAPLRFA*
Ga0066692_107448032	3300005555	Soil	MRKKHFYFMLLVLALILLALPGFAAKAAKRAAGPALRFA*
Ga0066704_100225203	3300005557	Soil	MKKRFYFTLLVLALLLLALPGFAAKAAKRTVRPTLRFA*
Ga0066698_110836261	3300005558	Soil	EMRRRRFYFILLVLALMLLALPGFAAKAAKRAAGPALRFA*
Ga0066700_107024772	3300005559	Soil	VKKRFYFTLLVLALLLLALPGFAAKAARRTVRPALRFA*
Ga0066670_101974631	3300005560	Soil	MKRRFYFTLVLLALVLLALPGFAAKAVRRAARPAVRFA*
Ga0066670_105813642	3300005560	Soil	MKRRFYFILVVLALVLLAIPGFAAKAAKRAGPALRFA*
Ga0066699_100899813	3300005561	Soil	MKRRLYFILVVLALILLAIPGFAAKAAKRTARPVLRFA*
Ga0066705_103370492	3300005569	Soil	MKRRFYFILVVLALILLAIPGFAAKAAKRAGPALRFA*
Ga0066705_108632602	3300005569	Soil	MKRRFYFILLVLALLLLAIPGFAAKAARRAAGPALRLA*
Ga0066905_1000938442	3300005713	Tropical Forest Soil	MKRRFYFILFVLALLLLAIPGFAAKGIRRVARPALRFA*
Ga0066903_1000834594	3300005764	Tropical Forest Soil	MKRRFYFILVVLALVLLAIPGFAAKAARRAARPVLRFA*
Ga0066903_1003525534	3300005764	Tropical Forest Soil	MKRRFYFILAVLALLLLALPGFAAKGAKRAARPVLRFA*
Ga0066903_1043863532	3300005764	Tropical Forest Soil	MKRRLYFTLLFLALLLIAIPGFAAKAVRRATRAVALRPAG*
Ga0066903_1077132401	3300005764	Tropical Forest Soil	MKRRFYLTLLVLALVLLAIPGFAAKAARRAAPVLGIA*
Ga0081539_100475843	3300005985	Tabebuia Heterophylla Rhizosphere	MKKRFYFILLVLALVLLALPGFAAKAARRAARRPVIRFA*
Ga0070717_102914392	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MRRRFYFTLLVLALILLAVPGFAAKGLRRAAGPALRFA*
Ga0066651_106457642	3300006031	Soil	MKRRFYFVLVVLALILLAIPGFAAKAARRAGPALRFA*
Ga0066656_107808062	3300006034	Soil	MKRRFYFILVVLALILLAIPGFAAKAAKRAAGPALRFA*
Ga0066652_1000158514	3300006046	Soil	MKRRFYFILVVLALVLLAIPGFAAKAAKRAAGAPLRFA*
Ga0066652_1000434865	3300006046	Soil	MRRRFYFILILLALVMLAIPGFAAKAAKRAARPALRFA*
Ga0066652_1004578922	3300006046	Soil	MKRRFYFILFVLALLLLAIPGFAAKAAKRTRRRPAVRFA*
Ga0066658_108896902	3300006794	Soil	MKRRFYFILVVLALILLAIPGFAAKAARRTARPVLRLA*
Ga0066665_112542032	3300006796	Soil	PRSLMRKKHFYFMLLVLALILLALPGFAAKAAKKAAGPALRFA*
Ga0066660_103416312	3300006800	Soil	MKRRFYFILVVLALILLAIPGFAAKAARRAAGPALRFA*
Ga0075425_1008580252	3300006854	Populus Rhizosphere	MKRRFYLILLVVALILLAIPGFAAKAARRATRPALRFA*
Ga0099793_101360722	3300007258	Vadose Zone Soil	MKRRFYFMLLVLALILLALPGFAAKAAKRAAGPALRFA*
Ga0066710_1000650832	3300009012	Grasslands Soil	MRRRRFYFILLVLALILLALPGFAAKAAKRAAGPALRFA
Ga0066710_1001970495	3300009012	Grasslands Soil	MTRRFYFILVVLALVLLAIPGFAAKAAKRAAGAPLRFA
Ga0066710_1003592174	3300009012	Grasslands Soil	MRRKHFYFVLLVLALILLALPGFAAKAAKRATGPALRFA
Ga0066710_1004441211	3300009012	Grasslands Soil	KHFYFMLLVLALILLALPGFAAKAAKKAAGPALRFA
Ga0066710_1006707631	3300009012	Grasslands Soil	RPSRRPEMRRRRFYFILLVVALILLALPGFAAKAAKRAAGPALRFA
Ga0066710_1015357222	3300009012	Grasslands Soil	MRKRFYFMLLVLALILLALPGFAAKAARRAARPALRFA
Ga0066710_1015635824	3300009012	Grasslands Soil	MKKRFYFTLIVLALILLALPGFAAKAAKRTVRPTLRFA
Ga0099830_111037301	3300009088	Vadose Zone Soil	TGDSGSLMRKKHFYFVLLVLALILLALPGFAAKAAKRAAGPALRFA*
Ga0099827_100017525	3300009090	Vadose Zone Soil	MRRKHFYFMLLVLALILLALPGFAAKAAKRAAGPALRFA*
Ga0099827_102242863	3300009090	Vadose Zone Soil	MKKRFYFMLLVLALILLALPGFAAKAAKRVAGPALGFA*
Ga0105247_103504222	3300009101	Switchgrass Rhizosphere	MKRRSYFILLVLALLVLSGPGFAAKAAKRAARPALRFAQPRKVTLP*
Ga0066709_1010528853	3300009137	Grasslands Soil	MKKRFYFTLIVLALILLALPGFAAKAAKRTVRPTLRFA*
Ga0066709_1022299072	3300009137	Grasslands Soil	MRRKHFYFVLLVLALILLALPGFATKAAKVAAGPALRLA*
Ga0066709_1032029952	3300009137	Grasslands Soil	MKKRFYLTLLVLALVLIALPGFAAKAARRVVPGPLS*
Ga0105238_106179323	3300009551	Corn Rhizosphere	RFYFTLVVLALILLALPGFAAKAAKRAAGPALRFA*
Ga0126307_116574442	3300009789	Serpentine Soil	MRKRHFYFMLVVLALILLALPGFASKAAKRVVRPRLRFA*
Ga0126374_101462233	3300009792	Tropical Forest Soil	MKRRFYFILVVLALVLLAIPGFAAKAARRAARPVLRYA*
Ga0105062_11293701	3300009817	Groundwater Sand	MRKKHFYFMLLVLALILLALPGFAAKAAKRAVRPALRFA*
Ga0105062_11301232	3300009817	Groundwater Sand	VRKKHLYFTLLVLALLLLALPGFAAKAAKRAVGPVLRFA*
Ga0105072_10551762	3300009818	Groundwater Sand	MKKRLYFALLVLALILLALPGFAAKAARRVVGAASPTG
Ga0105058_10069752	3300009837	Groundwater Sand	VRKKHLYFMLLVLALLLLALPGFAAKAAKRAVGPVLRFA*
Ga0126313_108910542	3300009840	Serpentine Soil	MKKRFYLILLVLAVLLLAIPGAAAKAARQIKPTRVALRA*
Ga0126380_117782012	3300010043	Tropical Forest Soil	MKRRLYFILLVLVLVLLAIPGFAAKAARRAGAPLLGLA*
Ga0126384_100494174	3300010046	Tropical Forest Soil	MKRRFYFILVVLALVLLAIPGFAAKAARRAARPVVRFA*
Ga0126306_110439222	3300010166	Serpentine Soil	MKKRHFYFMLLVLALILLALPGFASKAAKRVVRPRLRFA*
Ga0134070_101369042	3300010301	Grasslands Soil	MRKKHFYFMLLVLALILLALPGFAAKAAKRTARPVLRFA*
Ga0134084_104215721	3300010322	Grasslands Soil	MKRRFYFILVVLALVLLAIPGFAAKAAKRAAGAPL
Ga0134064_101663002	3300010325	Grasslands Soil	MKRRFYFILVVVALVLLAIPGFAAKAAKRAAGAPLRFA*
Ga0134111_102118821	3300010329	Grasslands Soil	MRRRRFYFILLVIALILLALPGFAAKAAKRAAGPALRFA*
Ga0134080_100953121	3300010333	Grasslands Soil	MTRRRFYFILLVLALILLALPGFAAKAAKRTVRPALRFA*
Ga0134080_101868462	3300010333	Grasslands Soil	MKRRFYFILVVLALVLLAIPGFAAKAAKRASGAPLRFA*
Ga0134080_105240211	3300010333	Grasslands Soil	MRKRFYFMLLVIALILLALPGFAAKAAKRAAGPALRFA*
Ga0134063_107145282	3300010335	Grasslands Soil	MRRRRFYFILLVLALILFALPGFAAKAAKRAAGPALRFA*
Ga0134071_103406802	3300010336	Grasslands Soil	MRKKHLYFILLVLALILLALPGFAAKAAKRTARPVLRFA*
Ga0134071_106537182	3300010336	Grasslands Soil	MRRKHFYFMLLVLALILLALPGFAAKAARRAAGPALRFA*
Ga0126376_119665591	3300010359	Tropical Forest Soil	GLAMKRRFYFILLVLALLLLAIPGFAARAARRTVRRPAVRLA*
Ga0134126_110735052	3300010396	Terrestrial Soil	MKRRFYFMLVLLALILLALPGFAAKAAKRAAGPALRFA*
Ga0134127_119175902	3300010399	Terrestrial Soil	MRRRFYFILVVLALLLLAIPGFAAKAARRVPRPAIRFA*
Ga0138505_1000235381	3300010999	Soil	MKRRFYFILVVLALVLLAIPGFAAKAAKRAAGPALRFS*
Ga0138514_1000495852	3300011003	Soil	MKRRFYFILVVLALVLLAIPGFAAKAAKRAARPALRFA*
Ga0120146_10533281	3300011992	Permafrost	MRKKHFYFMLLVLALILLTLPGFAAKAAKRVAGPALRFA*
Ga0120159_10446422	3300012014	Permafrost	MRKKHFYFMLLVLALILLALPGFAAKAAKRVAGPALRFA*
Ga0137389_103450642	3300012096	Vadose Zone Soil	MRRRFYFMLLVLALVLLAIPGFAAKAAKRVAGPALRFT*
Ga0137389_116305191	3300012096	Vadose Zone Soil	KRRFYFMLLVLALILLALPGFAAKAAKRAAGPALRFA*
Ga0137388_101984964	3300012189	Vadose Zone Soil	MKKRFYFTLLVLALLLLALPGFAAKAAKRTARLTPRFA*
Ga0137382_101124323	3300012200	Vadose Zone Soil	MKRRFYFMLLVLALILLALPGFAASAAKRAAGPALRFA*
Ga0137382_108598462	3300012200	Vadose Zone Soil	MRKKHFYFMLLVLALILLALPGFAAKAARRAAGPALRFA*
Ga0137382_110238872	3300012200	Vadose Zone Soil	MKRRFYFLLLVLALILLALPGFAAKAAKRAAGPALRFA*
Ga0137365_100019802	3300012201	Vadose Zone Soil	MRRKHFYFLLLVLALILLALPGFAAKAAKKAAGPALRFA*
Ga0137365_104773652	3300012201	Vadose Zone Soil	VDVRKRFYFVLLALVLILLALPGFAAKGARRMVRPVPRFA*
Ga0137374_100215862	3300012204	Vadose Zone Soil	MRRRFYFTLLVLALILLALPGFAAKAVKRAAGPALRFA*
Ga0137374_100380132	3300012204	Vadose Zone Soil	MRRRFYFMLPVLALILLALPGFAAKAAKRAAGPALRFA*
Ga0137374_100631743	3300012204	Vadose Zone Soil	VKRRFYFILAVFALLLLALPGFAAKAAKRVTRPALRFA*
Ga0137374_105175702	3300012204	Vadose Zone Soil	MKRRFYFILVVLALVLLAIPGFAAKAAKRAVGPALRFA*
Ga0137374_106570062	3300012204	Vadose Zone Soil	MKRRFYIILVVLALVLLAIPGFAAKAAKRAARPALRFA*
Ga0137374_108378472	3300012204	Vadose Zone Soil	MKKRFYFVLVVLALILLALPGFAAKAARRAVRPAVRFA*
Ga0137374_110713342	3300012204	Vadose Zone Soil	MKRRFYFMLVVLALILLALPGFAAKAGKRAARLAPRFA*
Ga0137374_112589052	3300012204	Vadose Zone Soil	MKKRFYFVLLVLALILLALPGFAAKAAKRAGRPALRFA*
Ga0137380_102433812	3300012206	Vadose Zone Soil	MKRRFYFILLVLALLALSVPGFAAKAAKRVTRPALRFA*
Ga0137380_104936632	3300012206	Vadose Zone Soil	GGLAMKRRFYFILLVLALLLLSVPGFAAKAAKRAARPALRIA*
Ga0137380_109416561	3300012206	Vadose Zone Soil	MKKRFYFMLLVLALILLALPGFAAKAAKRAAGPALRFA*
Ga0137380_109511512	3300012206	Vadose Zone Soil	MKRRFYFVLVVLALILLALPGFAAKAGKRAVRLAPRFA*
Ga0137380_117124482	3300012206	Vadose Zone Soil	EMRRRRFYFILLVLALILLALPGFAAKAAKRAAGPVLRFA*
Ga0137381_109306061	3300012207	Vadose Zone Soil	KHLYFILLVLALILLALPGFAAKAAKRTARPVLRFA*
Ga0137381_111640652	3300012207	Vadose Zone Soil	MKRRFYFILLVLALLALSVPGFAAKAAKRVARPALRFA*
Ga0137376_101931361	3300012208	Vadose Zone Soil	KKHFYFMLLVLALILLALPGFAAKAAKRAAGPALRFA*
Ga0137376_105205283	3300012208	Vadose Zone Soil	MKRRFYFILVVLALVLFAIPGFAAKAARRATRPSLRFA*
Ga0137376_105664353	3300012208	Vadose Zone Soil	MRKKHFYFMLLVLALILLALPGFAAKAAKRTARPVLRLA*
Ga0137379_103074571	3300012209	Vadose Zone Soil	RAAGGLAMKRRFYFILVVLALILLAIPGFAAKAAKRAAGPALRFA*
Ga0137379_112210401	3300012209	Vadose Zone Soil	SLMRKKHLYFILLVLALILLALPGFAAKAAKRTARPVLRFA*
Ga0137378_110425861	3300012210	Vadose Zone Soil	RAAGGLAMKRRFYFILLVLALLALSVPGFAAKAAKRVTRPALRFA*
Ga0137377_101161015	3300012211	Vadose Zone Soil	LMRKKHFYFMLLVLALILLALPGFAAKAAKKAAGPALRFA*
Ga0137370_107337321	3300012285	Vadose Zone Soil	MKRRFYFILLVLALLVLSVPGFAAKAAKRAARPALRVAWPGKVAVP*
Ga0137372_100281112	3300012350	Vadose Zone Soil	MKRRFYVILVVLALILLAIPGFAAKAAKRAASPALRFA*
Ga0137386_112615561	3300012351	Vadose Zone Soil	MRRRRFYFILLVLALILLALPGFAAKAAKRAAGPVLRF
Ga0137367_106171522	3300012353	Vadose Zone Soil	MKRRFYFMLVVLALILLALPGFAAKAGERAARLAPRFA*
Ga0137369_100155216	3300012355	Vadose Zone Soil	MKRRFYFILVVQALLLLAIPGFAAKAAKRAARPALRFA*
Ga0137369_100537735	3300012355	Vadose Zone Soil	VKRRFYFILAVFALLLLALPGFAAKSAKRVTRPALRFA*
Ga0137371_102514572	3300012356	Vadose Zone Soil	MKRRFYFVLVVLALILLALPGFAAKAGKRAAGLAPRFA*
Ga0137371_104368092	3300012356	Vadose Zone Soil	MRRRFYFALLVLALILLALPGFAAKAAKRATGRLSPRFA*
Ga0137371_107997962	3300012356	Vadose Zone Soil	VKRRFYFVLLALVLILLALPGFAAKGARRMVRPVPRFA*
Ga0137371_114248532	3300012356	Vadose Zone Soil	FYFTLLVLALILLALPGFAAKAARRTVPPKLRFA*
Ga0137368_100676284	3300012358	Vadose Zone Soil	MKRRFYFILVVLALVLLAIPGFAAKAARRAARPALRFA*
Ga0137368_102179203	3300012358	Vadose Zone Soil	MRRRFYFTLLVLALILLALPGFAVKAAKRAAGPALRFA*
Ga0137368_106688732	3300012358	Vadose Zone Soil	MRKKHLYFVLLVLALILLALPGFAAKAAKRSARPVLRFA*
Ga0137385_103758653	3300012359	Vadose Zone Soil	MRRKHFYFVLLVLALILLALPGFAAKAAKRATGPALRFA*
Ga0137385_109861421	3300012359	Vadose Zone Soil	PRSLMRRKHFYFVLLVLALILLALPGFAAKAAKRAARPAVRFA*
Ga0137361_116688442	3300012362	Vadose Zone Soil	KKHFYFMLLVLALILLALPGFAAKAAKKAAGPALRFA*
Ga0150984_1062306112	3300012469	Avena Fatua Rhizosphere	FEMKRRFYFTLVVLALILLALPGFAAKAAKRAAGPALRFA*
Ga0137397_101664773	3300012685	Vadose Zone Soil	MKRRFYFMLLVLALILLALPGFAASAAKRVAGPALRFA*
Ga0137397_106410052	3300012685	Vadose Zone Soil	MRKKHLYFMLLVLALILLALPGFAAKAAKRAAGPALRFA*
Ga0137404_119509232	3300012929	Vadose Zone Soil	MRKKHFYFMLLVLALILLALPGFAAKAAKTAAGPALRFA*
Ga0164298_100847391	3300012955	Soil	MKRRFYFTLVVLELILLALPGFAAKAAKRAAGPALRFA*
Ga0164298_102070822	3300012955	Soil	MRKKHLYFMLLVLALILLAIPGFAAKAAKRVAGPALRFA*
Ga0164303_111044152	3300012957	Soil	MKRRFYFILLVLALLALSGPGFAAKAAKRAARPALRFAQPRKVALP*
Ga0164299_100134514	3300012958	Soil	MKRRFYFILLVLALLALSGPGFAAKAAKRAARPALRFA*
Ga0164299_101283143	3300012958	Soil	MKRRFYFTLVVLALILLALPGLAAKAAKRAAGPALRFA*
Ga0164299_103801813	3300012958	Soil	MKRRFYFTLVVLALILLALPGFAGKAAKRAAGPALRFA*
Ga0164299_107885521	3300012958	Soil	MRRKHFYFTLLVLALILLALPGFAAKAAKRTARPVFRFA*
Ga0164301_114752562	3300012960	Soil	MRRKHLYFMLLVLALILLALPGFAAKAAKRTARPVLRFA*
Ga0126369_137060922	3300012971	Tropical Forest Soil	MKRRFYFILAVLALLLLALPGFAAKGAKRAARPILRFA*
Ga0134110_105165312	3300012975	Grasslands Soil	MRKKHFYFMLLVLALILLALPGFAAKAAKRATGPALRFA*
Ga0164307_101608351	3300012987	Soil	MKRRLYFILLVLAILVLSAPGFAAKAAKRAARPALRFAQPRKVALP*
Ga0164306_102083401	3300012988	Soil	MKRRFYFILLVLALLALSGPGFAAKAAKRAARPALR
Ga0164306_102880442	3300012988	Soil	MKRRFYFTLVVLALILLALPGIAGKAAKRAAGPALRFA*
Ga0164305_114950612	3300012989	Soil	RKHFYFVLLVLALILLALPGFAAKAAKRAARPALRFA*
Ga0134081_101457332	3300014150	Grasslands Soil	MRRRFYFMLLVLALVLLAIPGFAAKAAKKAAGPALRFA*
Ga0134081_102441181	3300014150	Grasslands Soil	MRKKHFYFMLLVLALFLLALPGFAAKAAKKAAGPVLRFA*
Ga0134079_100356271	3300014166	Grasslands Soil	AMRRRFYFMLILLALLLLAIPGFAAKAAKRAARPALRFA*
Ga0163163_110897352	3300014325	Switchgrass Rhizosphere	MKRRSYFILLVLALLVLSGPGFAAKAAKRAARPALRFAQPRKVALP*
Ga0134072_104082772	3300015357	Grasslands Soil	MKRCFYFILVVLALVLLAIPGFAAKAAKRAGPALRFA*
Ga0134085_105062492	3300015359	Grasslands Soil	MRKHFYFMLLVLALILLALPGFAAKAAKRAAQPALRFA*
Ga0134069_13296912	3300017654	Grasslands Soil	MRRRRFYFILLVIVLILLALPGFAAKAAKRATGPVLRLA
Ga0134074_13773222	3300017657	Grasslands Soil	MRRRRFYFILLVIALILLALPGFAAKAAKRAAGSALRFA
Ga0184604_101234432	3300018000	Groundwater Sediment	MRKKHFYFMLLVLALILLALPGFAAKAAKRVTGPALRFA
Ga0184605_1000014325	3300018027	Groundwater Sediment	MKRRFYFMLLVLALILLALPGFAAKGTKRAAGPALRFA
Ga0184605_100829403	3300018027	Groundwater Sediment	MKKRFYFTLLVLALLVLALPGFAAKAARRTVRPALRFA
Ga0184605_100951782	3300018027	Groundwater Sediment	MRKKHFYFMLLVLALILLALPGFAAKAAKKAAGPALRFA
Ga0184605_102249041	3300018027	Groundwater Sediment	MRRKHFYFMLLVLALILLALPGFAAKAAKRVTGPALRFA
Ga0184605_105057622	3300018027	Groundwater Sediment	MRKKHFYFMLLVLALILLALPGFAAKAAKRTARPVLRFA
Ga0184608_101900782	3300018028	Groundwater Sediment	MRKKHFYIMLLVLALILLALPGFAAKAAKRTARPVLRFA
Ga0184620_101571711	3300018051	Groundwater Sediment	MRKKHFYFMLLVLALILLALPGFAAKAAKRVNGPALRFA
Ga0184638_100004613	3300018052	Groundwater Sediment	MRKKHFYFMLLVLALILLALPGFAAKAAKRAVRPALRFA
Ga0184623_102040751	3300018056	Groundwater Sediment	MRKKHFYFMLLVLALILLALPGFATKAAKRAVRPALRFA
Ga0184619_100612922	3300018061	Groundwater Sediment	MKRRFYFILVVLALVLLAIPGFAAKAARRAVRPAVRFA
Ga0184619_100937262	3300018061	Groundwater Sediment	MKKRFYFVLLALILILLALPGFAKGARRVVRPVPRFA
Ga0184619_101291312	3300018061	Groundwater Sediment	MRKKHFYFMLLVLALILLALPGFAAKAAKRTARPVLRLA
Ga0184619_101386571	3300018061	Groundwater Sediment	HFYFMLLVLALILLALPGFAAKAAKRTARPVLRFA
Ga0184619_101935361	3300018061	Groundwater Sediment	MRKKHFYFMLLVLALILLALPGFAAKAAKRVTRPALRFA
Ga0184618_100048173	3300018071	Groundwater Sediment	MRKRHFYFMLLVLALILLALPGFAAKAAKRVTGPALRFA
Ga0184618_100129944	3300018071	Groundwater Sediment	MRKKHVYFMLLVLALILLALPGFAAKAAKKAAGPALRFA
Ga0184618_101387321	3300018071	Groundwater Sediment	GGLAMKRRFYFILVVLALVLLAIPGFAAKAARRAARPAVRFA
Ga0184609_102312942	3300018076	Groundwater Sediment	MKRRFYFMPLVLALILLALPGFAAKGTKRAAGPALRFA
Ga0184625_100671442	3300018081	Groundwater Sediment	MKRRFYFILVVLALVLLALPGFAAKAAKRAGRPVLRFA
Ga0066667_100694164	3300018433	Grasslands Soil	MRKKHFYFVLLVLAVILLALPGFAAKAAKRAAGPALRFA
Ga0066667_110668491	3300018433	Grasslands Soil	RRRRFYFILLVVALILLALPGFAAKAAKRAAGPALRFA
Ga0066667_117221902	3300018433	Grasslands Soil	MRRRRFYFILLVIALILLALPGFAAKAAKRATGPVLRLA
Ga0066662_100138398	3300018468	Grasslands Soil	MKKRFYFTLLVLALLLLALPGFAAKAAKRTVRPTLRFA
Ga0066662_111856831	3300018468	Grasslands Soil	AGGLAMKRRFYFILVVLALILLAIPGFAAKAARRRARPVLRLA
Ga0066669_100857413	3300018482	Grasslands Soil	MRKKHFYFMLLVLALILLALPGFAAKAAKRAARPALRFA
Ga0066669_102317562	3300018482	Grasslands Soil	MKRRFYFTLVVLALVLLALPGFAAKAVRRAARPTVRFA
Ga0066669_105750992	3300018482	Grasslands Soil	MRRRFYFILILLALVMLAIPGFAAKAAKRAARPALRFA
Ga0066669_124016341	3300018482	Grasslands Soil	MKRRFYFILFVLALVLLAVPGFAAKAAKRAGPALRFA
Ga0066669_124096762	3300018482	Grasslands Soil	MKRRFYFVLVVLALILLAIPGFAAKAARRAGPALRFA
Ga0193704_10531962	3300019867	Soil	MKRRFYFTLVVLALILLALPGFAAKAARRATGPALRFA
Ga0193705_10664242	3300019869	Soil	MKRRFYFTLVVLALILLALPGFAAKAARRAAGPALRFA
Ga0193701_10419371	3300019875	Soil	MRKKHFYFMLLVLALILLSLPGFAAKAAKRVTGPALRFA
Ga0193747_11054832	3300019885	Soil	MKRRFYFILLVMGLLLLAVPGFAAKAAKRAAGPALRFA
Ga0210381_103661521	3300021078	Groundwater Sediment	RLLTNPRSLMRKKHFYFMLLVLALILLALPGFAAKAAKRVTGPALRFA
Ga0210382_100071402	3300021080	Groundwater Sediment	MRKKHFYFMLLVLAVILLALPGFAAKAAKKAAGPALRFA
Ga0210382_101051242	3300021080	Groundwater Sediment	MRKKHFYFMLLVLALILLALPGFAAKAARRTARPVLRFA
Ga0222623_102602552	3300022694	Groundwater Sediment	MRKKHLYFILLVLALILLALPGFAAKAAKRTARPVLRFA
Ga0137417_12815082	3300024330	Vadose Zone Soil	MKRRFYFMLLVLALILLALPGFAAKAAKRAAGPALRFA
Ga0207684_106372141	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MKRRFYFILVVLALILLAIPGFAAKAARRVAGPALRFA
Ga0207652_112267622	3300025921	Corn Rhizosphere	MKRRFYFTLVVLALILLALPGFAAKAAKRAAGPALRFA
Ga0207646_1000288418	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MRKKHFYFVLLVLALVLLALPGFAAKAAKRAAGPALRFA
Ga0207646_105272822	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MKKRFYFILLVLALILLALPGFAAKVTKRLTGTRLRVATA
Ga0207665_100242915	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	PQSEMKRRFYFTLVVLALILLAVPGFAAKAAKRAAGPALRFA
Ga0207665_107280832	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	MRKRRFYFILLVLALILLALPGFAAKAAKRAAGPALRFA
Ga0209237_11452972	3300026297	Grasslands Soil	MKKRFYFMLLVLALILLALPGFAAKAAKRAAGPALRFA
Ga0209153_10571683	3300026312	Soil	MKRRFYFILVVLALILLAIPGFAAKAARRTARPVLRLA
Ga0209268_11435292	3300026314	Soil	MKRRFYFILVVLALVLLAIPGFAAKAAKRAAGAPLRFA
Ga0209472_12558511	3300026323	Soil	MKRRFYFILVVLALVLLAIPGFAAKAAKRASGAPLRFA
Ga0209152_102813322	3300026325	Soil	GAEGGTMKKRFYFTLLVLALLLLALPGFAAKAARRTVRPALRFA
Ga0209801_10651314	3300026326	Soil	MRRRRFYFILLVLALILLALPGFAAKAAKRTVRPALRFA
Ga0209375_11691831	3300026329	Soil	GGLAMKRRFYFILVVLALVLLAIPGFAAKAAKRASGAPLRFA
Ga0209808_10549485	3300026523	Soil	MKRRFYFILVVLALVLLAIPGFAAKAAKRAGPALRFA
Ga0209805_12268061	3300026542	Soil	MKRRLYFILVVLALILLAIPGFAAKAAKRTARPVLRFA
Ga0209474_107192372	3300026550	Soil	MKRRFYFILVVLALILLAIPGFAAKAARRTARPVL
Ga0209577_104844641	3300026552	Soil	RRLYFILVVLALILLAIPGFAAKAAKRTARPVLRFA
Ga0209577_107884032	3300026552	Soil	MKRRFYFILVVLALILLAIPGFAAKAARRAAGPALRFA
Ga0209879_10281002	3300027056	Groundwater Sand	VRKKHLYFTLLVLALLLLALPGFAAKAAKRAVGPVLRFA
Ga0209887_10672302	3300027561	Groundwater Sand	MKKRLYFALLVLALILLALPGFAAKAARRVVGAASPTGG
Ga0209874_10037143	3300027577	Groundwater Sand	VRKKHLYFMLLVLALLLLALPGFAAKAAKRAVGPVLRFA
Ga0209590_100229495	3300027882	Vadose Zone Soil	MRRKHFYFMLLVLALILLALPGFAAKAAKRAAGPALRFA
Ga0209590_101590812	3300027882	Vadose Zone Soil	MKKRFYFMLLVLALILLALPGFAAKAAKRVAGPALGFA
Ga0207428_112091952	3300027907	Populus Rhizosphere	MRRRFYFILVVLALLLLAIPGFAAKAAKRAARPALRFA
Ga0307276_100583942	3300028705	Soil	MKRRFYFILVVLALVLLALPGFAAKAAKRAARPALRFA
Ga0307303_100423192	3300028713	Soil	MRKKHFYFVLLVLALILLALPGFAAKAAKRVTGPALRFA
Ga0307303_101281942	3300028713	Soil	MRRRFYFILVVLALLLLAIPGFAARAARSAARPALRFA
Ga0307313_100828321	3300028715	Soil	MRKKHFYFMLLVLALILLALPGFAAKAAKKAAGPALR
Ga0307313_101244522	3300028715	Soil	RPSPRSDMRKKHFYFMLLVLALILLALPGFAAKAARRTARPVLRFA
Ga0307313_101635732	3300028715	Soil	MKRRFYFVLVVLALILLSLPGFAAKAVKRVARPAVRYA
Ga0307313_101766581	3300028715	Soil	MRKKHFYFMLLVLALILLALPGFAANAAKKAAGPALRFA
Ga0307298_102534172	3300028717	Soil	MRKKHFYFMLLVLALILLALPGFAAKAAKRMTGPAL
Ga0307315_101119471	3300028721	Soil	GGLAMKRRFYFILVVLALVLLAIPGFAAKAARRAVRPAVRFA
Ga0307319_101103811	3300028722	Soil	MKRRFYFILVVLALVLLAIPGFAAKAARRAARPAVRFA
Ga0307282_100915622	3300028784	Soil	MRKKHLYFMLLVLALILLALPGFAAKAAKRTARPVLRFA
Ga0307282_101338751	3300028784	Soil	RKKHFYFMLLVLVLALILLALPGFAAKAAKKAAGPALRFA
Ga0307282_102049922	3300028784	Soil	MRKRHIYFMLLVLALILLALPGFAAKAAKRVTGPALRFA
Ga0307290_102937462	3300028791	Soil	MKRRFYFILVVLALVLLALPGFAAKAAKRAGRPALRFA
Ga0307284_100118241	3300028799	Soil	MKRRFYFILVVLALVLLAIPGFAAKAARRATRPALRFA
Ga0307292_100901911	3300028811	Soil	HFYFMLLVLALILLALPGFAANAAKKAAGPALRFA
Ga0307302_103311462	3300028814	Soil	MRRKHFYFVLVVLALILLALPGFAAKAAKRVTRPALRFA
Ga0307310_101090673	3300028824	Soil	PRSLMRKKHFYFMLLVLALILLALPGFAANAAKKAAGPALRFA
Ga0307312_106568503	3300028828	Soil	MRKKHFYFMLLVLALILLALPGFAAKAAKRAAGPALRFA
Ga0307286_100309263	3300028876	Soil	LMKRRFYFMLLVLALILLALPGFAAKGTKRAAGPALRFA
Ga0307278_100474783	3300028878	Soil	MKRRFYFMLLVLALILLALPGFAAKGAKRAAGPALRFA
Ga0307278_105401361	3300028878	Soil	RRFYFTLVVLALILLALPGFAAKAAKRAAGPALRFA
Ga0307277_103941672	3300028881	Soil	MRKKHFYFMLLVLALILLALPGFAARAAKRVAGPALRFA
Ga0308178_10691201	3300030990	Soil	MKRRFYFMLLVLALILLALPGFAAMGTKRAAGPALRFA
Ga0307497_100225552	3300031226	Soil	MKRRFYFTLVILALILLALPGFAAKAAKRAAGPALRFA
Ga0310813_111529681	3300031716	Soil	MRKRRFYFILLVLALILLALPGFAAKAAKRAAGPALRF
Ga0307469_117329961	3300031720	Hardwood Forest Soil	AAGGLTMRRPFYFVLAVLALLLLALPGFAAKGVRRAVRPALRFA
Ga0307468_1002236712	3300031740	Hardwood Forest Soil	MKRRFYFTLVVLALILLAMPGFAAKAAKRAAGPALRFA
Ga0308175_1013158372	3300031938	Soil	MKRRFYFILLVLALIVLAVPGFAAKAAKRAARPAPRLA

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F013619

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences