Basic Information | |
---|---|
Family ID | F013619 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 269 |
Average Sequence Length | 39 residues |
Representative Sequence | MKRRFYFMLLVLALILLALPGFAAKAAKRAAGPALRFA |
Number of Associated Samples | 175 |
Number of Associated Scaffolds | 269 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 38.43 % |
% of genes near scaffold ends (potentially truncated) | 21.56 % |
% of genes from short scaffolds (< 2000 bps) | 83.64 % |
Associated GOLD sequencing projects | 166 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.42 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.026 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.818 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.855 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.390 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 51.52% β-sheet: 0.00% Coil/Unstructured: 48.48% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 269 Family Scaffolds |
---|---|---|
PF07883 | Cupin_2 | 30.86 |
PF00581 | Rhodanese | 6.32 |
PF00196 | GerE | 4.46 |
PF00535 | Glycos_transf_2 | 3.72 |
PF01741 | MscL | 2.23 |
PF07690 | MFS_1 | 2.23 |
PF06723 | MreB_Mbl | 1.86 |
PF02698 | DUF218 | 1.49 |
PF00005 | ABC_tran | 1.49 |
PF08327 | AHSA1 | 1.12 |
PF07730 | HisKA_3 | 1.12 |
PF01510 | Amidase_2 | 0.74 |
PF12833 | HTH_18 | 0.74 |
PF00291 | PALP | 0.74 |
PF05345 | He_PIG | 0.74 |
PF01909 | NTP_transf_2 | 0.74 |
PF00211 | Guanylate_cyc | 0.74 |
PF12680 | SnoaL_2 | 0.74 |
PF03551 | PadR | 0.74 |
PF00561 | Abhydrolase_1 | 0.37 |
PF03734 | YkuD | 0.37 |
PF13946 | DUF4214 | 0.37 |
PF10604 | Polyketide_cyc2 | 0.37 |
PF03080 | Neprosin | 0.37 |
PF04545 | Sigma70_r4 | 0.37 |
PF08240 | ADH_N | 0.37 |
PF13539 | Peptidase_M15_4 | 0.37 |
PF13240 | zinc_ribbon_2 | 0.37 |
PF13649 | Methyltransf_25 | 0.37 |
PF07719 | TPR_2 | 0.37 |
PF03704 | BTAD | 0.37 |
PF12681 | Glyoxalase_2 | 0.37 |
PF01638 | HxlR | 0.37 |
PF14511 | RE_EcoO109I | 0.37 |
PF08031 | BBE | 0.37 |
PF01565 | FAD_binding_4 | 0.37 |
PF13419 | HAD_2 | 0.37 |
PF12637 | TSCPD | 0.37 |
PF00486 | Trans_reg_C | 0.37 |
PF08281 | Sigma70_r4_2 | 0.37 |
PF00583 | Acetyltransf_1 | 0.37 |
PF06841 | Phage_T4_gp19 | 0.37 |
PF13191 | AAA_16 | 0.37 |
PF00072 | Response_reg | 0.37 |
COG ID | Name | Functional Category | % Frequency in 269 Family Scaffolds |
---|---|---|---|
COG1970 | Large-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 2.23 |
COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 1.86 |
COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 1.49 |
COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 1.49 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 1.12 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 1.12 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 1.12 |
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 1.12 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.12 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.74 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.74 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.74 |
COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.37 |
COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.37 |
COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.37 |
COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.37 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.37 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.03 % |
Unclassified | root | N/A | 2.97 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908016|OU_2_1_1_newblercontig106617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 897 | Open in IMG/M |
2170459004|F62QY1Z01BBC2A | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
2170459019|G14TP7Y02HR3IS | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 640 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c2036285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 610 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101744292 | All Organisms → cellular organisms → Bacteria | 2122 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101746537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1035 | Open in IMG/M |
3300000956|JGI10216J12902_101930464 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
3300000956|JGI10216J12902_110174241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 961 | Open in IMG/M |
3300000956|JGI10216J12902_113589816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1488 | Open in IMG/M |
3300000956|JGI10216J12902_122557014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1609 | Open in IMG/M |
3300004114|Ga0062593_101193769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 798 | Open in IMG/M |
3300004114|Ga0062593_101903761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 657 | Open in IMG/M |
3300004479|Ga0062595_100383621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 997 | Open in IMG/M |
3300004479|Ga0062595_101020295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 713 | Open in IMG/M |
3300004479|Ga0062595_102608330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
3300005093|Ga0062594_100359667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1149 | Open in IMG/M |
3300005172|Ga0066683_10526202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 722 | Open in IMG/M |
3300005174|Ga0066680_10465316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 797 | Open in IMG/M |
3300005177|Ga0066690_11008173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 523 | Open in IMG/M |
3300005178|Ga0066688_10340680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 970 | Open in IMG/M |
3300005181|Ga0066678_10559971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 759 | Open in IMG/M |
3300005181|Ga0066678_11048078 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300005186|Ga0066676_11182070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 501 | Open in IMG/M |
3300005187|Ga0066675_10728968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 746 | Open in IMG/M |
3300005445|Ga0070708_100061257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3361 | Open in IMG/M |
3300005450|Ga0066682_10462730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 805 | Open in IMG/M |
3300005468|Ga0070707_100009180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9173 | Open in IMG/M |
3300005468|Ga0070707_100037808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4609 | Open in IMG/M |
3300005518|Ga0070699_100027799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 4877 | Open in IMG/M |
3300005526|Ga0073909_10033921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1766 | Open in IMG/M |
3300005526|Ga0073909_10236176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 806 | Open in IMG/M |
3300005526|Ga0073909_10662155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
3300005536|Ga0070697_100380950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1222 | Open in IMG/M |
3300005540|Ga0066697_10227434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1108 | Open in IMG/M |
3300005540|Ga0066697_10705873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
3300005543|Ga0070672_100054005 | All Organisms → cellular organisms → Bacteria | 3143 | Open in IMG/M |
3300005553|Ga0066695_10559839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 693 | Open in IMG/M |
3300005555|Ga0066692_10744803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 605 | Open in IMG/M |
3300005557|Ga0066704_10022520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3740 | Open in IMG/M |
3300005558|Ga0066698_11083626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 507 | Open in IMG/M |
3300005559|Ga0066700_10702477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
3300005560|Ga0066670_10197463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1206 | Open in IMG/M |
3300005560|Ga0066670_10581364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 683 | Open in IMG/M |
3300005561|Ga0066699_10089981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2000 | Open in IMG/M |
3300005569|Ga0066705_10337049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 953 | Open in IMG/M |
3300005569|Ga0066705_10863260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 538 | Open in IMG/M |
3300005713|Ga0066905_100093844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2015 | Open in IMG/M |
3300005764|Ga0066903_100083459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 4190 | Open in IMG/M |
3300005764|Ga0066903_100352553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2380 | Open in IMG/M |
3300005764|Ga0066903_107713240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 554 | Open in IMG/M |
3300005985|Ga0081539_10047584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2447 | Open in IMG/M |
3300006028|Ga0070717_10291439 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
3300006031|Ga0066651_10645764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 565 | Open in IMG/M |
3300006034|Ga0066656_10780806 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300006046|Ga0066652_100015851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 5027 | Open in IMG/M |
3300006046|Ga0066652_100043486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3332 | Open in IMG/M |
3300006046|Ga0066652_100457892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1176 | Open in IMG/M |
3300006794|Ga0066658_10889690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 511 | Open in IMG/M |
3300006796|Ga0066665_11254203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
3300006800|Ga0066660_10341631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1212 | Open in IMG/M |
3300006854|Ga0075425_100858025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1039 | Open in IMG/M |
3300007258|Ga0099793_10136072 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
3300009012|Ga0066710_100065083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4635 | Open in IMG/M |
3300009012|Ga0066710_100197049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2862 | Open in IMG/M |
3300009012|Ga0066710_100359217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2157 | Open in IMG/M |
3300009012|Ga0066710_100444121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1943 | Open in IMG/M |
3300009012|Ga0066710_100670763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1578 | Open in IMG/M |
3300009012|Ga0066710_101535722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1025 | Open in IMG/M |
3300009012|Ga0066710_101563582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1013 | Open in IMG/M |
3300009088|Ga0099830_11103730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 658 | Open in IMG/M |
3300009090|Ga0099827_10001752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11547 | Open in IMG/M |
3300009090|Ga0099827_10224286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1571 | Open in IMG/M |
3300009101|Ga0105247_10350422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1038 | Open in IMG/M |
3300009137|Ga0066709_101052885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1194 | Open in IMG/M |
3300009137|Ga0066709_102229907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 754 | Open in IMG/M |
3300009137|Ga0066709_103202995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 597 | Open in IMG/M |
3300009551|Ga0105238_10617932 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
3300009789|Ga0126307_11657444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
3300009792|Ga0126374_10146223 | All Organisms → cellular organisms → Bacteria | 1425 | Open in IMG/M |
3300009817|Ga0105062_1129370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 517 | Open in IMG/M |
3300009817|Ga0105062_1130123 | Not Available | 516 | Open in IMG/M |
3300009818|Ga0105072_1055176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 760 | Open in IMG/M |
3300009837|Ga0105058_1006975 | All Organisms → cellular organisms → Bacteria | 2134 | Open in IMG/M |
3300009840|Ga0126313_10891054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 726 | Open in IMG/M |
3300010043|Ga0126380_11778201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 556 | Open in IMG/M |
3300010046|Ga0126384_10049417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2892 | Open in IMG/M |
3300010166|Ga0126306_11043922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 667 | Open in IMG/M |
3300010301|Ga0134070_10136904 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300010322|Ga0134084_10421572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
3300010325|Ga0134064_10166300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 772 | Open in IMG/M |
3300010329|Ga0134111_10211882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 786 | Open in IMG/M |
3300010333|Ga0134080_10095312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1218 | Open in IMG/M |
3300010333|Ga0134080_10186846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 893 | Open in IMG/M |
3300010333|Ga0134080_10524021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 566 | Open in IMG/M |
3300010335|Ga0134063_10714528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 519 | Open in IMG/M |
3300010336|Ga0134071_10340680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 757 | Open in IMG/M |
3300010336|Ga0134071_10653718 | Not Available | 553 | Open in IMG/M |
3300010359|Ga0126376_11966559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 626 | Open in IMG/M |
3300010396|Ga0134126_11073505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 899 | Open in IMG/M |
3300010399|Ga0134127_11917590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 670 | Open in IMG/M |
3300010999|Ga0138505_100023538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 804 | Open in IMG/M |
3300011003|Ga0138514_100049585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 845 | Open in IMG/M |
3300011992|Ga0120146_1053328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 669 | Open in IMG/M |
3300012014|Ga0120159_1044642 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
3300012096|Ga0137389_10345064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1266 | Open in IMG/M |
3300012096|Ga0137389_11630519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 541 | Open in IMG/M |
3300012189|Ga0137388_10198496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1807 | Open in IMG/M |
3300012200|Ga0137382_10112432 | All Organisms → cellular organisms → Bacteria | 1810 | Open in IMG/M |
3300012200|Ga0137382_10859846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 654 | Open in IMG/M |
3300012200|Ga0137382_11023887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
3300012201|Ga0137365_10001980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 16181 | Open in IMG/M |
3300012201|Ga0137365_10477365 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
3300012204|Ga0137374_10021586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7283 | Open in IMG/M |
3300012204|Ga0137374_10038013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5138 | Open in IMG/M |
3300012204|Ga0137374_10063174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3701 | Open in IMG/M |
3300012204|Ga0137374_10517570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 923 | Open in IMG/M |
3300012204|Ga0137374_10657006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 793 | Open in IMG/M |
3300012204|Ga0137374_10837847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 680 | Open in IMG/M |
3300012204|Ga0137374_11071334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
3300012204|Ga0137374_11258905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 513 | Open in IMG/M |
3300012206|Ga0137380_10243381 | All Organisms → cellular organisms → Bacteria | 1623 | Open in IMG/M |
3300012206|Ga0137380_10493663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1079 | Open in IMG/M |
3300012206|Ga0137380_10941656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 740 | Open in IMG/M |
3300012206|Ga0137380_10951151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 736 | Open in IMG/M |
3300012206|Ga0137380_11712448 | Not Available | 512 | Open in IMG/M |
3300012207|Ga0137381_10930606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 751 | Open in IMG/M |
3300012207|Ga0137381_11164065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 663 | Open in IMG/M |
3300012208|Ga0137376_10193136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1760 | Open in IMG/M |
3300012208|Ga0137376_10520528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1031 | Open in IMG/M |
3300012208|Ga0137376_10566435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 984 | Open in IMG/M |
3300012209|Ga0137379_10307457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1496 | Open in IMG/M |
3300012209|Ga0137379_11221040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 659 | Open in IMG/M |
3300012210|Ga0137378_11042586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 732 | Open in IMG/M |
3300012211|Ga0137377_10116101 | All Organisms → cellular organisms → Bacteria | 2548 | Open in IMG/M |
3300012285|Ga0137370_10733732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 613 | Open in IMG/M |
3300012350|Ga0137372_10028111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5180 | Open in IMG/M |
3300012351|Ga0137386_11261556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 514 | Open in IMG/M |
3300012353|Ga0137367_10617152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 758 | Open in IMG/M |
3300012355|Ga0137369_10015521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7342 | Open in IMG/M |
3300012355|Ga0137369_10053773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3507 | Open in IMG/M |
3300012356|Ga0137371_10251457 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
3300012356|Ga0137371_10436809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1013 | Open in IMG/M |
3300012356|Ga0137371_10799796 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300012356|Ga0137371_11424853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 507 | Open in IMG/M |
3300012358|Ga0137368_10067628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2914 | Open in IMG/M |
3300012358|Ga0137368_10217920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1343 | Open in IMG/M |
3300012358|Ga0137368_10668873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 655 | Open in IMG/M |
3300012359|Ga0137385_10375865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1214 | Open in IMG/M |
3300012359|Ga0137385_10986142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 695 | Open in IMG/M |
3300012362|Ga0137361_11668844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
3300012469|Ga0150984_106230611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
3300012685|Ga0137397_10166477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1636 | Open in IMG/M |
3300012685|Ga0137397_10641005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 790 | Open in IMG/M |
3300012929|Ga0137404_11950923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
3300012955|Ga0164298_10084739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1636 | Open in IMG/M |
3300012955|Ga0164298_10207082 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
3300012957|Ga0164303_11104415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 573 | Open in IMG/M |
3300012958|Ga0164299_10013451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3137 | Open in IMG/M |
3300012958|Ga0164299_10128314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1368 | Open in IMG/M |
3300012958|Ga0164299_10380181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 900 | Open in IMG/M |
3300012958|Ga0164299_10788552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 676 | Open in IMG/M |
3300012960|Ga0164301_11475256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 559 | Open in IMG/M |
3300012971|Ga0126369_13706092 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300012975|Ga0134110_10516531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 545 | Open in IMG/M |
3300012987|Ga0164307_10160835 | Not Available | 1489 | Open in IMG/M |
3300012988|Ga0164306_10208340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1376 | Open in IMG/M |
3300012988|Ga0164306_10288044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1193 | Open in IMG/M |
3300012989|Ga0164305_11495061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
3300014150|Ga0134081_10145733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 775 | Open in IMG/M |
3300014150|Ga0134081_10244118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 625 | Open in IMG/M |
3300014166|Ga0134079_10035627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1691 | Open in IMG/M |
3300014325|Ga0163163_11089735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 862 | Open in IMG/M |
3300015357|Ga0134072_10408277 | Not Available | 537 | Open in IMG/M |
3300015359|Ga0134085_10506249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 553 | Open in IMG/M |
3300017654|Ga0134069_1329691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 546 | Open in IMG/M |
3300017657|Ga0134074_1377322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 526 | Open in IMG/M |
3300018000|Ga0184604_10123443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 828 | Open in IMG/M |
3300018027|Ga0184605_10000143 | All Organisms → cellular organisms → Bacteria | 20145 | Open in IMG/M |
3300018027|Ga0184605_10082940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1400 | Open in IMG/M |
3300018027|Ga0184605_10095178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1310 | Open in IMG/M |
3300018027|Ga0184605_10224904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 853 | Open in IMG/M |
3300018027|Ga0184605_10505762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 525 | Open in IMG/M |
3300018028|Ga0184608_10190078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 897 | Open in IMG/M |
3300018051|Ga0184620_10157171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 738 | Open in IMG/M |
3300018052|Ga0184638_1000046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 26916 | Open in IMG/M |
3300018056|Ga0184623_10204075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 909 | Open in IMG/M |
3300018061|Ga0184619_10061292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1650 | Open in IMG/M |
3300018061|Ga0184619_10093726 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
3300018061|Ga0184619_10129131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1147 | Open in IMG/M |
3300018061|Ga0184619_10138657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1106 | Open in IMG/M |
3300018061|Ga0184619_10193536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 934 | Open in IMG/M |
3300018071|Ga0184618_10004817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3712 | Open in IMG/M |
3300018071|Ga0184618_10012994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2570 | Open in IMG/M |
3300018071|Ga0184618_10138732 | Not Available | 985 | Open in IMG/M |
3300018076|Ga0184609_10231294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 864 | Open in IMG/M |
3300018081|Ga0184625_10067144 | All Organisms → cellular organisms → Bacteria | 1818 | Open in IMG/M |
3300018433|Ga0066667_10069416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2221 | Open in IMG/M |
3300018433|Ga0066667_11066849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 698 | Open in IMG/M |
3300018433|Ga0066667_11722190 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300018468|Ga0066662_10013839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4302 | Open in IMG/M |
3300018468|Ga0066662_11185683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 771 | Open in IMG/M |
3300018482|Ga0066669_10085741 | All Organisms → cellular organisms → Bacteria | 2136 | Open in IMG/M |
3300018482|Ga0066669_10231756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1443 | Open in IMG/M |
3300018482|Ga0066669_10575099 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
3300018482|Ga0066669_12401634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 505 | Open in IMG/M |
3300018482|Ga0066669_12409676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 504 | Open in IMG/M |
3300019867|Ga0193704_1053196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 789 | Open in IMG/M |
3300019869|Ga0193705_1066424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 719 | Open in IMG/M |
3300019875|Ga0193701_1041937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 934 | Open in IMG/M |
3300019885|Ga0193747_1105483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 680 | Open in IMG/M |
3300021078|Ga0210381_10366152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 529 | Open in IMG/M |
3300021080|Ga0210382_10007140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3683 | Open in IMG/M |
3300021080|Ga0210382_10105124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1179 | Open in IMG/M |
3300022694|Ga0222623_10260255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 669 | Open in IMG/M |
3300024330|Ga0137417_1281508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
3300025910|Ga0207684_10637214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 909 | Open in IMG/M |
3300025921|Ga0207652_11226762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 652 | Open in IMG/M |
3300025922|Ga0207646_10002884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 19952 | Open in IMG/M |
3300025922|Ga0207646_10527282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1063 | Open in IMG/M |
3300025939|Ga0207665_10024291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3996 | Open in IMG/M |
3300025939|Ga0207665_10728083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 781 | Open in IMG/M |
3300026297|Ga0209237_1145297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 935 | Open in IMG/M |
3300026312|Ga0209153_1057168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1394 | Open in IMG/M |
3300026314|Ga0209268_1143529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 587 | Open in IMG/M |
3300026323|Ga0209472_1255851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 559 | Open in IMG/M |
3300026325|Ga0209152_10281332 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300026326|Ga0209801_1065131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1626 | Open in IMG/M |
3300026329|Ga0209375_1169183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 889 | Open in IMG/M |
3300026523|Ga0209808_1054948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1801 | Open in IMG/M |
3300026542|Ga0209805_1226806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 774 | Open in IMG/M |
3300026550|Ga0209474_10719237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 518 | Open in IMG/M |
3300026552|Ga0209577_10484464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 835 | Open in IMG/M |
3300026552|Ga0209577_10788403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 531 | Open in IMG/M |
3300027056|Ga0209879_1028100 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
3300027561|Ga0209887_1067230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 751 | Open in IMG/M |
3300027577|Ga0209874_1003714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4622 | Open in IMG/M |
3300027882|Ga0209590_10022949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3181 | Open in IMG/M |
3300027882|Ga0209590_10159081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1406 | Open in IMG/M |
3300027907|Ga0207428_11209195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 525 | Open in IMG/M |
3300028705|Ga0307276_10058394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 870 | Open in IMG/M |
3300028713|Ga0307303_10042319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 946 | Open in IMG/M |
3300028713|Ga0307303_10128194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 598 | Open in IMG/M |
3300028715|Ga0307313_10082832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 965 | Open in IMG/M |
3300028715|Ga0307313_10124452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 790 | Open in IMG/M |
3300028715|Ga0307313_10163573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 688 | Open in IMG/M |
3300028715|Ga0307313_10176658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 661 | Open in IMG/M |
3300028717|Ga0307298_10253417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 523 | Open in IMG/M |
3300028721|Ga0307315_10111947 | Not Available | 810 | Open in IMG/M |
3300028722|Ga0307319_10110381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 883 | Open in IMG/M |
3300028784|Ga0307282_10091562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1403 | Open in IMG/M |
3300028784|Ga0307282_10133875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1167 | Open in IMG/M |
3300028784|Ga0307282_10204992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 943 | Open in IMG/M |
3300028791|Ga0307290_10293746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 595 | Open in IMG/M |
3300028799|Ga0307284_10011824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2632 | Open in IMG/M |
3300028811|Ga0307292_10090191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1195 | Open in IMG/M |
3300028814|Ga0307302_10331146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 750 | Open in IMG/M |
3300028824|Ga0307310_10109067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1239 | Open in IMG/M |
3300028828|Ga0307312_10656850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 694 | Open in IMG/M |
3300028876|Ga0307286_10030926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Marmoricola → unclassified Marmoricola → Marmoricola sp. URHB0036 | 1765 | Open in IMG/M |
3300028878|Ga0307278_10047478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1946 | Open in IMG/M |
3300028878|Ga0307278_10540136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
3300028881|Ga0307277_10394167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 619 | Open in IMG/M |
3300030990|Ga0308178_1069120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 697 | Open in IMG/M |
3300031226|Ga0307497_10022555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1963 | Open in IMG/M |
3300031716|Ga0310813_11152968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 712 | Open in IMG/M |
3300031720|Ga0307469_11732996 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300031740|Ga0307468_100223671 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
3300031938|Ga0308175_101315837 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 17.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.61% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.81% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 7.43% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.69% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.09% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.23% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.86% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.86% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.12% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.12% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.12% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.74% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.74% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.74% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.74% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.74% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.37% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.37% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.37% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.37% |
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 0.37% | |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.37% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.37% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.37% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.37% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.37% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.37% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.37% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908016 | Sample 642 | Environmental | Open in IMG/M |
2170459004 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm (2) | Environmental | Open in IMG/M |
2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
3300011992 | Permafrost microbial communities from Nunavut, Canada - A23_65cm_12M | Environmental | Open in IMG/M |
3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
OU_00844190 | 2124908016 | MRRRFYFVLAVLALLLLALPGFATKGVRRAVRPALRFA | |
E4B_03599680 | 2170459004 | Grass Soil | MRKKHFYFMLLVLALILLALPGFAAKAARRAARPALRFA |
4MG_04400260 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | MRRRFYFVLAVLALLLLALPGFAANAARRAARPALRL |
ICChiseqgaiiDRAFT_20362852 | 3300000033 | Soil | MKRRFYFVLLVLALILLALPGFAAKGAKRVARPTLRVA* |
INPhiseqgaiiFebDRAFT_1017442923 | 3300000364 | Soil | MRRRFYFVLAVLALLLLALPGFAAKGVRRAVRPALRFA* |
INPhiseqgaiiFebDRAFT_1017465371 | 3300000364 | Soil | MKRRFYFILVVLALLVLAVPGFAAKAAKRAARPALRFA* |
JGI10216J12902_1019304641 | 3300000956 | Soil | RSDMRKKHFYFMLLVLALVLLALPGFAAKAAKRAAGPALRFA* |
JGI10216J12902_1101742412 | 3300000956 | Soil | MKRRFYFILLVLALVVLAVPGFAAKAAKWAARPALRVA* |
JGI10216J12902_1135898163 | 3300000956 | Soil | MKRRMKRRFYFMLLVFGLILLALPGFAVKAAKRAAEPVLRFA* |
JGI10216J12902_1225570143 | 3300000956 | Soil | MRRRRFYFILLVIALILLALPGFAAKAGRRAARPVLRFA* |
Ga0062593_1011937691 | 3300004114 | Soil | MRKKHFYFMLLVLALILLALPGFAAKAAKRVTGPALRFA* |
Ga0062593_1019037612 | 3300004114 | Soil | MRKRRFYFILLVLALILLALPGFAAKAAKRAAGPALRFA* |
Ga0062595_1003836212 | 3300004479 | Soil | MRRRRFYFILLVIALILLALPGFAAKAAKRATGPVLRLA* |
Ga0062595_1010202952 | 3300004479 | Soil | MRRRRFYFILLVIGLILLALPGFAAKAAKRTARPVLRCA* |
Ga0062595_1026083302 | 3300004479 | Soil | MKRRFYFILLVLALLVLSGPGFAAKAAKRAARPALRFAQPRKVALP* |
Ga0062594_1003596672 | 3300005093 | Soil | MKRRFYFILLVLALLVLSGPGFAAKAAKRAARPALRFAQPRKVTLP* |
Ga0066683_105262022 | 3300005172 | Soil | MRKKHFYFMLLVLALILLALPGFAAKAAKRAARPALRFA* |
Ga0066680_104653161 | 3300005174 | Soil | MRRRRFYFILLVLALILLALPGFAAKAAKRTVRPALRFA* |
Ga0066690_110081732 | 3300005177 | Soil | MRRRRFYFILLVVALILLALPGFAAKAAKRAAGPALRFA* |
Ga0066688_103406802 | 3300005178 | Soil | MRKKHFYFVLLVLAVILLALPGFAAKAAKRAAGPALRFA* |
Ga0066678_105599712 | 3300005181 | Soil | MRRKHFYFVLLVLALILLALPGFAAKAAKRAAGPALRFA* |
Ga0066678_110480782 | 3300005181 | Soil | AEGGTMKKRFYFTLLVLALLLLALPGFAAKAARRTVRPALRFA* |
Ga0066676_111820701 | 3300005186 | Soil | MRRKHFYFMLLVLALILLALPGFAAKAAKRATGPALRFA* |
Ga0066675_107289681 | 3300005187 | Soil | FRRPEMRRRRFYFILLVIALILLALPGFAAKAARRTARPVLRFA* |
Ga0070708_1000612575 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKKHFYFVLLVLALILLALPGFAAKAAKRAAGPALRFA* |
Ga0066682_104627301 | 3300005450 | Soil | RRSRRPEMRRRRFYFILLVLALILLALPGFAAKAAKRAAGPALRFA* |
Ga0070707_1000091804 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKKHFYFVLLVLALVLLALPGFAAKAAKRAAGPALRFA* |
Ga0070707_1000378085 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKRFYFILLVLALILLALPGFAAKVTKRLTGTRLRVATA* |
Ga0070699_1000277996 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKKHFYFMLLVLALILLALPGFAAKAAKKAAGPALRFA* |
Ga0073909_100339212 | 3300005526 | Surface Soil | MKRRFYFTLVVLALILLALPGFAAKAAKRAAGPALRFA* |
Ga0073909_102361761 | 3300005526 | Surface Soil | MKRRFYFTLVVLALILLALPGFAAKAARRAAGPALRFA* |
Ga0073909_106621551 | 3300005526 | Surface Soil | LPRSPQSEMKRRFYFTLVVLALILLALPGFAAKAAKRAAGPALRFA* |
Ga0070697_1003809502 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRKHFYFMLLVLALILLALPGFAAKAAKRTARPVFRFA* |
Ga0066697_102274342 | 3300005540 | Soil | MRRRRFYFILLVLALILLALPGFAAKAAKRAAGPALRFA* |
Ga0066697_107058731 | 3300005540 | Soil | FYFMLLVLTLILLALPGFAAKAAKRAARPALRFA* |
Ga0070672_1000540052 | 3300005543 | Miscanthus Rhizosphere | MKRRLYFTLVVLALILLALPGFAAKAAKRAAAPALRFA* |
Ga0066695_105598391 | 3300005553 | Soil | AGGLAMKRRFYFILVVLALVLLAIPGFAAKAAKRAAGAPLRFA* |
Ga0066692_107448032 | 3300005555 | Soil | MRKKHFYFMLLVLALILLALPGFAAKAAKRAAGPALRFA* |
Ga0066704_100225203 | 3300005557 | Soil | MKKRFYFTLLVLALLLLALPGFAAKAAKRTVRPTLRFA* |
Ga0066698_110836261 | 3300005558 | Soil | EMRRRRFYFILLVLALMLLALPGFAAKAAKRAAGPALRFA* |
Ga0066700_107024772 | 3300005559 | Soil | VKKRFYFTLLVLALLLLALPGFAAKAARRTVRPALRFA* |
Ga0066670_101974631 | 3300005560 | Soil | MKRRFYFTLVLLALVLLALPGFAAKAVRRAARPAVRFA* |
Ga0066670_105813642 | 3300005560 | Soil | MKRRFYFILVVLALVLLAIPGFAAKAAKRAGPALRFA* |
Ga0066699_100899813 | 3300005561 | Soil | MKRRLYFILVVLALILLAIPGFAAKAAKRTARPVLRFA* |
Ga0066705_103370492 | 3300005569 | Soil | MKRRFYFILVVLALILLAIPGFAAKAAKRAGPALRFA* |
Ga0066705_108632602 | 3300005569 | Soil | MKRRFYFILLVLALLLLAIPGFAAKAARRAAGPALRLA* |
Ga0066905_1000938442 | 3300005713 | Tropical Forest Soil | MKRRFYFILFVLALLLLAIPGFAAKGIRRVARPALRFA* |
Ga0066903_1000834594 | 3300005764 | Tropical Forest Soil | MKRRFYFILVVLALVLLAIPGFAAKAARRAARPVLRFA* |
Ga0066903_1003525534 | 3300005764 | Tropical Forest Soil | MKRRFYFILAVLALLLLALPGFAAKGAKRAARPVLRFA* |
Ga0066903_1043863532 | 3300005764 | Tropical Forest Soil | MKRRLYFTLLFLALLLIAIPGFAAKAVRRATRAVALRPAG* |
Ga0066903_1077132401 | 3300005764 | Tropical Forest Soil | MKRRFYLTLLVLALVLLAIPGFAAKAARRAAPVLGIA* |
Ga0081539_100475843 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MKKRFYFILLVLALVLLALPGFAAKAARRAARRPVIRFA* |
Ga0070717_102914392 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRRFYFTLLVLALILLAVPGFAAKGLRRAAGPALRFA* |
Ga0066651_106457642 | 3300006031 | Soil | MKRRFYFVLVVLALILLAIPGFAAKAARRAGPALRFA* |
Ga0066656_107808062 | 3300006034 | Soil | MKRRFYFILVVLALILLAIPGFAAKAAKRAAGPALRFA* |
Ga0066652_1000158514 | 3300006046 | Soil | MKRRFYFILVVLALVLLAIPGFAAKAAKRAAGAPLRFA* |
Ga0066652_1000434865 | 3300006046 | Soil | MRRRFYFILILLALVMLAIPGFAAKAAKRAARPALRFA* |
Ga0066652_1004578922 | 3300006046 | Soil | MKRRFYFILFVLALLLLAIPGFAAKAAKRTRRRPAVRFA* |
Ga0066658_108896902 | 3300006794 | Soil | MKRRFYFILVVLALILLAIPGFAAKAARRTARPVLRLA* |
Ga0066665_112542032 | 3300006796 | Soil | PRSLMRKKHFYFMLLVLALILLALPGFAAKAAKKAAGPALRFA* |
Ga0066660_103416312 | 3300006800 | Soil | MKRRFYFILVVLALILLAIPGFAAKAARRAAGPALRFA* |
Ga0075425_1008580252 | 3300006854 | Populus Rhizosphere | MKRRFYLILLVVALILLAIPGFAAKAARRATRPALRFA* |
Ga0099793_101360722 | 3300007258 | Vadose Zone Soil | MKRRFYFMLLVLALILLALPGFAAKAAKRAAGPALRFA* |
Ga0066710_1000650832 | 3300009012 | Grasslands Soil | MRRRRFYFILLVLALILLALPGFAAKAAKRAAGPALRFA |
Ga0066710_1001970495 | 3300009012 | Grasslands Soil | MTRRFYFILVVLALVLLAIPGFAAKAAKRAAGAPLRFA |
Ga0066710_1003592174 | 3300009012 | Grasslands Soil | MRRKHFYFVLLVLALILLALPGFAAKAAKRATGPALRFA |
Ga0066710_1004441211 | 3300009012 | Grasslands Soil | KHFYFMLLVLALILLALPGFAAKAAKKAAGPALRFA |
Ga0066710_1006707631 | 3300009012 | Grasslands Soil | RPSRRPEMRRRRFYFILLVVALILLALPGFAAKAAKRAAGPALRFA |
Ga0066710_1015357222 | 3300009012 | Grasslands Soil | MRKRFYFMLLVLALILLALPGFAAKAARRAARPALRFA |
Ga0066710_1015635824 | 3300009012 | Grasslands Soil | MKKRFYFTLIVLALILLALPGFAAKAAKRTVRPTLRFA |
Ga0099830_111037301 | 3300009088 | Vadose Zone Soil | TGDSGSLMRKKHFYFVLLVLALILLALPGFAAKAAKRAAGPALRFA* |
Ga0099827_100017525 | 3300009090 | Vadose Zone Soil | MRRKHFYFMLLVLALILLALPGFAAKAAKRAAGPALRFA* |
Ga0099827_102242863 | 3300009090 | Vadose Zone Soil | MKKRFYFMLLVLALILLALPGFAAKAAKRVAGPALGFA* |
Ga0105247_103504222 | 3300009101 | Switchgrass Rhizosphere | MKRRSYFILLVLALLVLSGPGFAAKAAKRAARPALRFAQPRKVTLP* |
Ga0066709_1010528853 | 3300009137 | Grasslands Soil | MKKRFYFTLIVLALILLALPGFAAKAAKRTVRPTLRFA* |
Ga0066709_1022299072 | 3300009137 | Grasslands Soil | MRRKHFYFVLLVLALILLALPGFATKAAKVAAGPALRLA* |
Ga0066709_1032029952 | 3300009137 | Grasslands Soil | MKKRFYLTLLVLALVLIALPGFAAKAARRVVPGPLS* |
Ga0105238_106179323 | 3300009551 | Corn Rhizosphere | RFYFTLVVLALILLALPGFAAKAAKRAAGPALRFA* |
Ga0126307_116574442 | 3300009789 | Serpentine Soil | MRKRHFYFMLVVLALILLALPGFASKAAKRVVRPRLRFA* |
Ga0126374_101462233 | 3300009792 | Tropical Forest Soil | MKRRFYFILVVLALVLLAIPGFAAKAARRAARPVLRYA* |
Ga0105062_11293701 | 3300009817 | Groundwater Sand | MRKKHFYFMLLVLALILLALPGFAAKAAKRAVRPALRFA* |
Ga0105062_11301232 | 3300009817 | Groundwater Sand | VRKKHLYFTLLVLALLLLALPGFAAKAAKRAVGPVLRFA* |
Ga0105072_10551762 | 3300009818 | Groundwater Sand | MKKRLYFALLVLALILLALPGFAAKAARRVVGAASPTG |
Ga0105058_10069752 | 3300009837 | Groundwater Sand | VRKKHLYFMLLVLALLLLALPGFAAKAAKRAVGPVLRFA* |
Ga0126313_108910542 | 3300009840 | Serpentine Soil | MKKRFYLILLVLAVLLLAIPGAAAKAARQIKPTRVALRA* |
Ga0126380_117782012 | 3300010043 | Tropical Forest Soil | MKRRLYFILLVLVLVLLAIPGFAAKAARRAGAPLLGLA* |
Ga0126384_100494174 | 3300010046 | Tropical Forest Soil | MKRRFYFILVVLALVLLAIPGFAAKAARRAARPVVRFA* |
Ga0126306_110439222 | 3300010166 | Serpentine Soil | MKKRHFYFMLLVLALILLALPGFASKAAKRVVRPRLRFA* |
Ga0134070_101369042 | 3300010301 | Grasslands Soil | MRKKHFYFMLLVLALILLALPGFAAKAAKRTARPVLRFA* |
Ga0134084_104215721 | 3300010322 | Grasslands Soil | MKRRFYFILVVLALVLLAIPGFAAKAAKRAAGAPL |
Ga0134064_101663002 | 3300010325 | Grasslands Soil | MKRRFYFILVVVALVLLAIPGFAAKAAKRAAGAPLRFA* |
Ga0134111_102118821 | 3300010329 | Grasslands Soil | MRRRRFYFILLVIALILLALPGFAAKAAKRAAGPALRFA* |
Ga0134080_100953121 | 3300010333 | Grasslands Soil | MTRRRFYFILLVLALILLALPGFAAKAAKRTVRPALRFA* |
Ga0134080_101868462 | 3300010333 | Grasslands Soil | MKRRFYFILVVLALVLLAIPGFAAKAAKRASGAPLRFA* |
Ga0134080_105240211 | 3300010333 | Grasslands Soil | MRKRFYFMLLVIALILLALPGFAAKAAKRAAGPALRFA* |
Ga0134063_107145282 | 3300010335 | Grasslands Soil | MRRRRFYFILLVLALILFALPGFAAKAAKRAAGPALRFA* |
Ga0134071_103406802 | 3300010336 | Grasslands Soil | MRKKHLYFILLVLALILLALPGFAAKAAKRTARPVLRFA* |
Ga0134071_106537182 | 3300010336 | Grasslands Soil | MRRKHFYFMLLVLALILLALPGFAAKAARRAAGPALRFA* |
Ga0126376_119665591 | 3300010359 | Tropical Forest Soil | GLAMKRRFYFILLVLALLLLAIPGFAARAARRTVRRPAVRLA* |
Ga0134126_110735052 | 3300010396 | Terrestrial Soil | MKRRFYFMLVLLALILLALPGFAAKAAKRAAGPALRFA* |
Ga0134127_119175902 | 3300010399 | Terrestrial Soil | MRRRFYFILVVLALLLLAIPGFAAKAARRVPRPAIRFA* |
Ga0138505_1000235381 | 3300010999 | Soil | MKRRFYFILVVLALVLLAIPGFAAKAAKRAAGPALRFS* |
Ga0138514_1000495852 | 3300011003 | Soil | MKRRFYFILVVLALVLLAIPGFAAKAAKRAARPALRFA* |
Ga0120146_10533281 | 3300011992 | Permafrost | MRKKHFYFMLLVLALILLTLPGFAAKAAKRVAGPALRFA* |
Ga0120159_10446422 | 3300012014 | Permafrost | MRKKHFYFMLLVLALILLALPGFAAKAAKRVAGPALRFA* |
Ga0137389_103450642 | 3300012096 | Vadose Zone Soil | MRRRFYFMLLVLALVLLAIPGFAAKAAKRVAGPALRFT* |
Ga0137389_116305191 | 3300012096 | Vadose Zone Soil | KRRFYFMLLVLALILLALPGFAAKAAKRAAGPALRFA* |
Ga0137388_101984964 | 3300012189 | Vadose Zone Soil | MKKRFYFTLLVLALLLLALPGFAAKAAKRTARLTPRFA* |
Ga0137382_101124323 | 3300012200 | Vadose Zone Soil | MKRRFYFMLLVLALILLALPGFAASAAKRAAGPALRFA* |
Ga0137382_108598462 | 3300012200 | Vadose Zone Soil | MRKKHFYFMLLVLALILLALPGFAAKAARRAAGPALRFA* |
Ga0137382_110238872 | 3300012200 | Vadose Zone Soil | MKRRFYFLLLVLALILLALPGFAAKAAKRAAGPALRFA* |
Ga0137365_100019802 | 3300012201 | Vadose Zone Soil | MRRKHFYFLLLVLALILLALPGFAAKAAKKAAGPALRFA* |
Ga0137365_104773652 | 3300012201 | Vadose Zone Soil | VDVRKRFYFVLLALVLILLALPGFAAKGARRMVRPVPRFA* |
Ga0137374_100215862 | 3300012204 | Vadose Zone Soil | MRRRFYFTLLVLALILLALPGFAAKAVKRAAGPALRFA* |
Ga0137374_100380132 | 3300012204 | Vadose Zone Soil | MRRRFYFMLPVLALILLALPGFAAKAAKRAAGPALRFA* |
Ga0137374_100631743 | 3300012204 | Vadose Zone Soil | VKRRFYFILAVFALLLLALPGFAAKAAKRVTRPALRFA* |
Ga0137374_105175702 | 3300012204 | Vadose Zone Soil | MKRRFYFILVVLALVLLAIPGFAAKAAKRAVGPALRFA* |
Ga0137374_106570062 | 3300012204 | Vadose Zone Soil | MKRRFYIILVVLALVLLAIPGFAAKAAKRAARPALRFA* |
Ga0137374_108378472 | 3300012204 | Vadose Zone Soil | MKKRFYFVLVVLALILLALPGFAAKAARRAVRPAVRFA* |
Ga0137374_110713342 | 3300012204 | Vadose Zone Soil | MKRRFYFMLVVLALILLALPGFAAKAGKRAARLAPRFA* |
Ga0137374_112589052 | 3300012204 | Vadose Zone Soil | MKKRFYFVLLVLALILLALPGFAAKAAKRAGRPALRFA* |
Ga0137380_102433812 | 3300012206 | Vadose Zone Soil | MKRRFYFILLVLALLALSVPGFAAKAAKRVTRPALRFA* |
Ga0137380_104936632 | 3300012206 | Vadose Zone Soil | GGLAMKRRFYFILLVLALLLLSVPGFAAKAAKRAARPALRIA* |
Ga0137380_109416561 | 3300012206 | Vadose Zone Soil | MKKRFYFMLLVLALILLALPGFAAKAAKRAAGPALRFA* |
Ga0137380_109511512 | 3300012206 | Vadose Zone Soil | MKRRFYFVLVVLALILLALPGFAAKAGKRAVRLAPRFA* |
Ga0137380_117124482 | 3300012206 | Vadose Zone Soil | EMRRRRFYFILLVLALILLALPGFAAKAAKRAAGPVLRFA* |
Ga0137381_109306061 | 3300012207 | Vadose Zone Soil | KHLYFILLVLALILLALPGFAAKAAKRTARPVLRFA* |
Ga0137381_111640652 | 3300012207 | Vadose Zone Soil | MKRRFYFILLVLALLALSVPGFAAKAAKRVARPALRFA* |
Ga0137376_101931361 | 3300012208 | Vadose Zone Soil | KKHFYFMLLVLALILLALPGFAAKAAKRAAGPALRFA* |
Ga0137376_105205283 | 3300012208 | Vadose Zone Soil | MKRRFYFILVVLALVLFAIPGFAAKAARRATRPSLRFA* |
Ga0137376_105664353 | 3300012208 | Vadose Zone Soil | MRKKHFYFMLLVLALILLALPGFAAKAAKRTARPVLRLA* |
Ga0137379_103074571 | 3300012209 | Vadose Zone Soil | RAAGGLAMKRRFYFILVVLALILLAIPGFAAKAAKRAAGPALRFA* |
Ga0137379_112210401 | 3300012209 | Vadose Zone Soil | SLMRKKHLYFILLVLALILLALPGFAAKAAKRTARPVLRFA* |
Ga0137378_110425861 | 3300012210 | Vadose Zone Soil | RAAGGLAMKRRFYFILLVLALLALSVPGFAAKAAKRVTRPALRFA* |
Ga0137377_101161015 | 3300012211 | Vadose Zone Soil | LMRKKHFYFMLLVLALILLALPGFAAKAAKKAAGPALRFA* |
Ga0137370_107337321 | 3300012285 | Vadose Zone Soil | MKRRFYFILLVLALLVLSVPGFAAKAAKRAARPALRVAWPGKVAVP* |
Ga0137372_100281112 | 3300012350 | Vadose Zone Soil | MKRRFYVILVVLALILLAIPGFAAKAAKRAASPALRFA* |
Ga0137386_112615561 | 3300012351 | Vadose Zone Soil | MRRRRFYFILLVLALILLALPGFAAKAAKRAAGPVLRF |
Ga0137367_106171522 | 3300012353 | Vadose Zone Soil | MKRRFYFMLVVLALILLALPGFAAKAGERAARLAPRFA* |
Ga0137369_100155216 | 3300012355 | Vadose Zone Soil | MKRRFYFILVVQALLLLAIPGFAAKAAKRAARPALRFA* |
Ga0137369_100537735 | 3300012355 | Vadose Zone Soil | VKRRFYFILAVFALLLLALPGFAAKSAKRVTRPALRFA* |
Ga0137371_102514572 | 3300012356 | Vadose Zone Soil | MKRRFYFVLVVLALILLALPGFAAKAGKRAAGLAPRFA* |
Ga0137371_104368092 | 3300012356 | Vadose Zone Soil | MRRRFYFALLVLALILLALPGFAAKAAKRATGRLSPRFA* |
Ga0137371_107997962 | 3300012356 | Vadose Zone Soil | VKRRFYFVLLALVLILLALPGFAAKGARRMVRPVPRFA* |
Ga0137371_114248532 | 3300012356 | Vadose Zone Soil | FYFTLLVLALILLALPGFAAKAARRTVPPKLRFA* |
Ga0137368_100676284 | 3300012358 | Vadose Zone Soil | MKRRFYFILVVLALVLLAIPGFAAKAARRAARPALRFA* |
Ga0137368_102179203 | 3300012358 | Vadose Zone Soil | MRRRFYFTLLVLALILLALPGFAVKAAKRAAGPALRFA* |
Ga0137368_106688732 | 3300012358 | Vadose Zone Soil | MRKKHLYFVLLVLALILLALPGFAAKAAKRSARPVLRFA* |
Ga0137385_103758653 | 3300012359 | Vadose Zone Soil | MRRKHFYFVLLVLALILLALPGFAAKAAKRATGPALRFA* |
Ga0137385_109861421 | 3300012359 | Vadose Zone Soil | PRSLMRRKHFYFVLLVLALILLALPGFAAKAAKRAARPAVRFA* |
Ga0137361_116688442 | 3300012362 | Vadose Zone Soil | KKHFYFMLLVLALILLALPGFAAKAAKKAAGPALRFA* |
Ga0150984_1062306112 | 3300012469 | Avena Fatua Rhizosphere | FEMKRRFYFTLVVLALILLALPGFAAKAAKRAAGPALRFA* |
Ga0137397_101664773 | 3300012685 | Vadose Zone Soil | MKRRFYFMLLVLALILLALPGFAASAAKRVAGPALRFA* |
Ga0137397_106410052 | 3300012685 | Vadose Zone Soil | MRKKHLYFMLLVLALILLALPGFAAKAAKRAAGPALRFA* |
Ga0137404_119509232 | 3300012929 | Vadose Zone Soil | MRKKHFYFMLLVLALILLALPGFAAKAAKTAAGPALRFA* |
Ga0164298_100847391 | 3300012955 | Soil | MKRRFYFTLVVLELILLALPGFAAKAAKRAAGPALRFA* |
Ga0164298_102070822 | 3300012955 | Soil | MRKKHLYFMLLVLALILLAIPGFAAKAAKRVAGPALRFA* |
Ga0164303_111044152 | 3300012957 | Soil | MKRRFYFILLVLALLALSGPGFAAKAAKRAARPALRFAQPRKVALP* |
Ga0164299_100134514 | 3300012958 | Soil | MKRRFYFILLVLALLALSGPGFAAKAAKRAARPALRFA* |
Ga0164299_101283143 | 3300012958 | Soil | MKRRFYFTLVVLALILLALPGLAAKAAKRAAGPALRFA* |
Ga0164299_103801813 | 3300012958 | Soil | MKRRFYFTLVVLALILLALPGFAGKAAKRAAGPALRFA* |
Ga0164299_107885521 | 3300012958 | Soil | MRRKHFYFTLLVLALILLALPGFAAKAAKRTARPVFRFA* |
Ga0164301_114752562 | 3300012960 | Soil | MRRKHLYFMLLVLALILLALPGFAAKAAKRTARPVLRFA* |
Ga0126369_137060922 | 3300012971 | Tropical Forest Soil | MKRRFYFILAVLALLLLALPGFAAKGAKRAARPILRFA* |
Ga0134110_105165312 | 3300012975 | Grasslands Soil | MRKKHFYFMLLVLALILLALPGFAAKAAKRATGPALRFA* |
Ga0164307_101608351 | 3300012987 | Soil | MKRRLYFILLVLAILVLSAPGFAAKAAKRAARPALRFAQPRKVALP* |
Ga0164306_102083401 | 3300012988 | Soil | MKRRFYFILLVLALLALSGPGFAAKAAKRAARPALR |
Ga0164306_102880442 | 3300012988 | Soil | MKRRFYFTLVVLALILLALPGIAGKAAKRAAGPALRFA* |
Ga0164305_114950612 | 3300012989 | Soil | RKHFYFVLLVLALILLALPGFAAKAAKRAARPALRFA* |
Ga0134081_101457332 | 3300014150 | Grasslands Soil | MRRRFYFMLLVLALVLLAIPGFAAKAAKKAAGPALRFA* |
Ga0134081_102441181 | 3300014150 | Grasslands Soil | MRKKHFYFMLLVLALFLLALPGFAAKAAKKAAGPVLRFA* |
Ga0134079_100356271 | 3300014166 | Grasslands Soil | AMRRRFYFMLILLALLLLAIPGFAAKAAKRAARPALRFA* |
Ga0163163_110897352 | 3300014325 | Switchgrass Rhizosphere | MKRRSYFILLVLALLVLSGPGFAAKAAKRAARPALRFAQPRKVALP* |
Ga0134072_104082772 | 3300015357 | Grasslands Soil | MKRCFYFILVVLALVLLAIPGFAAKAAKRAGPALRFA* |
Ga0134085_105062492 | 3300015359 | Grasslands Soil | MRKHFYFMLLVLALILLALPGFAAKAAKRAAQPALRFA* |
Ga0134069_13296912 | 3300017654 | Grasslands Soil | MRRRRFYFILLVIVLILLALPGFAAKAAKRATGPVLRLA |
Ga0134074_13773222 | 3300017657 | Grasslands Soil | MRRRRFYFILLVIALILLALPGFAAKAAKRAAGSALRFA |
Ga0184604_101234432 | 3300018000 | Groundwater Sediment | MRKKHFYFMLLVLALILLALPGFAAKAAKRVTGPALRFA |
Ga0184605_1000014325 | 3300018027 | Groundwater Sediment | MKRRFYFMLLVLALILLALPGFAAKGTKRAAGPALRFA |
Ga0184605_100829403 | 3300018027 | Groundwater Sediment | MKKRFYFTLLVLALLVLALPGFAAKAARRTVRPALRFA |
Ga0184605_100951782 | 3300018027 | Groundwater Sediment | MRKKHFYFMLLVLALILLALPGFAAKAAKKAAGPALRFA |
Ga0184605_102249041 | 3300018027 | Groundwater Sediment | MRRKHFYFMLLVLALILLALPGFAAKAAKRVTGPALRFA |
Ga0184605_105057622 | 3300018027 | Groundwater Sediment | MRKKHFYFMLLVLALILLALPGFAAKAAKRTARPVLRFA |
Ga0184608_101900782 | 3300018028 | Groundwater Sediment | MRKKHFYIMLLVLALILLALPGFAAKAAKRTARPVLRFA |
Ga0184620_101571711 | 3300018051 | Groundwater Sediment | MRKKHFYFMLLVLALILLALPGFAAKAAKRVNGPALRFA |
Ga0184638_100004613 | 3300018052 | Groundwater Sediment | MRKKHFYFMLLVLALILLALPGFAAKAAKRAVRPALRFA |
Ga0184623_102040751 | 3300018056 | Groundwater Sediment | MRKKHFYFMLLVLALILLALPGFATKAAKRAVRPALRFA |
Ga0184619_100612922 | 3300018061 | Groundwater Sediment | MKRRFYFILVVLALVLLAIPGFAAKAARRAVRPAVRFA |
Ga0184619_100937262 | 3300018061 | Groundwater Sediment | MKKRFYFVLLALILILLALPGFAKGARRVVRPVPRFA |
Ga0184619_101291312 | 3300018061 | Groundwater Sediment | MRKKHFYFMLLVLALILLALPGFAAKAAKRTARPVLRLA |
Ga0184619_101386571 | 3300018061 | Groundwater Sediment | HFYFMLLVLALILLALPGFAAKAAKRTARPVLRFA |
Ga0184619_101935361 | 3300018061 | Groundwater Sediment | MRKKHFYFMLLVLALILLALPGFAAKAAKRVTRPALRFA |
Ga0184618_100048173 | 3300018071 | Groundwater Sediment | MRKRHFYFMLLVLALILLALPGFAAKAAKRVTGPALRFA |
Ga0184618_100129944 | 3300018071 | Groundwater Sediment | MRKKHVYFMLLVLALILLALPGFAAKAAKKAAGPALRFA |
Ga0184618_101387321 | 3300018071 | Groundwater Sediment | GGLAMKRRFYFILVVLALVLLAIPGFAAKAARRAARPAVRFA |
Ga0184609_102312942 | 3300018076 | Groundwater Sediment | MKRRFYFMPLVLALILLALPGFAAKGTKRAAGPALRFA |
Ga0184625_100671442 | 3300018081 | Groundwater Sediment | MKRRFYFILVVLALVLLALPGFAAKAAKRAGRPVLRFA |
Ga0066667_100694164 | 3300018433 | Grasslands Soil | MRKKHFYFVLLVLAVILLALPGFAAKAAKRAAGPALRFA |
Ga0066667_110668491 | 3300018433 | Grasslands Soil | RRRRFYFILLVVALILLALPGFAAKAAKRAAGPALRFA |
Ga0066667_117221902 | 3300018433 | Grasslands Soil | MRRRRFYFILLVIALILLALPGFAAKAAKRATGPVLRLA |
Ga0066662_100138398 | 3300018468 | Grasslands Soil | MKKRFYFTLLVLALLLLALPGFAAKAAKRTVRPTLRFA |
Ga0066662_111856831 | 3300018468 | Grasslands Soil | AGGLAMKRRFYFILVVLALILLAIPGFAAKAARRRARPVLRLA |
Ga0066669_100857413 | 3300018482 | Grasslands Soil | MRKKHFYFMLLVLALILLALPGFAAKAAKRAARPALRFA |
Ga0066669_102317562 | 3300018482 | Grasslands Soil | MKRRFYFTLVVLALVLLALPGFAAKAVRRAARPTVRFA |
Ga0066669_105750992 | 3300018482 | Grasslands Soil | MRRRFYFILILLALVMLAIPGFAAKAAKRAARPALRFA |
Ga0066669_124016341 | 3300018482 | Grasslands Soil | MKRRFYFILFVLALVLLAVPGFAAKAAKRAGPALRFA |
Ga0066669_124096762 | 3300018482 | Grasslands Soil | MKRRFYFVLVVLALILLAIPGFAAKAARRAGPALRFA |
Ga0193704_10531962 | 3300019867 | Soil | MKRRFYFTLVVLALILLALPGFAAKAARRATGPALRFA |
Ga0193705_10664242 | 3300019869 | Soil | MKRRFYFTLVVLALILLALPGFAAKAARRAAGPALRFA |
Ga0193701_10419371 | 3300019875 | Soil | MRKKHFYFMLLVLALILLSLPGFAAKAAKRVTGPALRFA |
Ga0193747_11054832 | 3300019885 | Soil | MKRRFYFILLVMGLLLLAVPGFAAKAAKRAAGPALRFA |
Ga0210381_103661521 | 3300021078 | Groundwater Sediment | RLLTNPRSLMRKKHFYFMLLVLALILLALPGFAAKAAKRVTGPALRFA |
Ga0210382_100071402 | 3300021080 | Groundwater Sediment | MRKKHFYFMLLVLAVILLALPGFAAKAAKKAAGPALRFA |
Ga0210382_101051242 | 3300021080 | Groundwater Sediment | MRKKHFYFMLLVLALILLALPGFAAKAARRTARPVLRFA |
Ga0222623_102602552 | 3300022694 | Groundwater Sediment | MRKKHLYFILLVLALILLALPGFAAKAAKRTARPVLRFA |
Ga0137417_12815082 | 3300024330 | Vadose Zone Soil | MKRRFYFMLLVLALILLALPGFAAKAAKRAAGPALRFA |
Ga0207684_106372141 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRRFYFILVVLALILLAIPGFAAKAARRVAGPALRFA |
Ga0207652_112267622 | 3300025921 | Corn Rhizosphere | MKRRFYFTLVVLALILLALPGFAAKAAKRAAGPALRFA |
Ga0207646_1000288418 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKKHFYFVLLVLALVLLALPGFAAKAAKRAAGPALRFA |
Ga0207646_105272822 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKRFYFILLVLALILLALPGFAAKVTKRLTGTRLRVATA |
Ga0207665_100242915 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | PQSEMKRRFYFTLVVLALILLAVPGFAAKAAKRAAGPALRFA |
Ga0207665_107280832 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKRRFYFILLVLALILLALPGFAAKAAKRAAGPALRFA |
Ga0209237_11452972 | 3300026297 | Grasslands Soil | MKKRFYFMLLVLALILLALPGFAAKAAKRAAGPALRFA |
Ga0209153_10571683 | 3300026312 | Soil | MKRRFYFILVVLALILLAIPGFAAKAARRTARPVLRLA |
Ga0209268_11435292 | 3300026314 | Soil | MKRRFYFILVVLALVLLAIPGFAAKAAKRAAGAPLRFA |
Ga0209472_12558511 | 3300026323 | Soil | MKRRFYFILVVLALVLLAIPGFAAKAAKRASGAPLRFA |
Ga0209152_102813322 | 3300026325 | Soil | GAEGGTMKKRFYFTLLVLALLLLALPGFAAKAARRTVRPALRFA |
Ga0209801_10651314 | 3300026326 | Soil | MRRRRFYFILLVLALILLALPGFAAKAAKRTVRPALRFA |
Ga0209375_11691831 | 3300026329 | Soil | GGLAMKRRFYFILVVLALVLLAIPGFAAKAAKRASGAPLRFA |
Ga0209808_10549485 | 3300026523 | Soil | MKRRFYFILVVLALVLLAIPGFAAKAAKRAGPALRFA |
Ga0209805_12268061 | 3300026542 | Soil | MKRRLYFILVVLALILLAIPGFAAKAAKRTARPVLRFA |
Ga0209474_107192372 | 3300026550 | Soil | MKRRFYFILVVLALILLAIPGFAAKAARRTARPVL |
Ga0209577_104844641 | 3300026552 | Soil | RRLYFILVVLALILLAIPGFAAKAAKRTARPVLRFA |
Ga0209577_107884032 | 3300026552 | Soil | MKRRFYFILVVLALILLAIPGFAAKAARRAAGPALRFA |
Ga0209879_10281002 | 3300027056 | Groundwater Sand | VRKKHLYFTLLVLALLLLALPGFAAKAAKRAVGPVLRFA |
Ga0209887_10672302 | 3300027561 | Groundwater Sand | MKKRLYFALLVLALILLALPGFAAKAARRVVGAASPTGG |
Ga0209874_10037143 | 3300027577 | Groundwater Sand | VRKKHLYFMLLVLALLLLALPGFAAKAAKRAVGPVLRFA |
Ga0209590_100229495 | 3300027882 | Vadose Zone Soil | MRRKHFYFMLLVLALILLALPGFAAKAAKRAAGPALRFA |
Ga0209590_101590812 | 3300027882 | Vadose Zone Soil | MKKRFYFMLLVLALILLALPGFAAKAAKRVAGPALGFA |
Ga0207428_112091952 | 3300027907 | Populus Rhizosphere | MRRRFYFILVVLALLLLAIPGFAAKAAKRAARPALRFA |
Ga0307276_100583942 | 3300028705 | Soil | MKRRFYFILVVLALVLLALPGFAAKAAKRAARPALRFA |
Ga0307303_100423192 | 3300028713 | Soil | MRKKHFYFVLLVLALILLALPGFAAKAAKRVTGPALRFA |
Ga0307303_101281942 | 3300028713 | Soil | MRRRFYFILVVLALLLLAIPGFAARAARSAARPALRFA |
Ga0307313_100828321 | 3300028715 | Soil | MRKKHFYFMLLVLALILLALPGFAAKAAKKAAGPALR |
Ga0307313_101244522 | 3300028715 | Soil | RPSPRSDMRKKHFYFMLLVLALILLALPGFAAKAARRTARPVLRFA |
Ga0307313_101635732 | 3300028715 | Soil | MKRRFYFVLVVLALILLSLPGFAAKAVKRVARPAVRYA |
Ga0307313_101766581 | 3300028715 | Soil | MRKKHFYFMLLVLALILLALPGFAANAAKKAAGPALRFA |
Ga0307298_102534172 | 3300028717 | Soil | MRKKHFYFMLLVLALILLALPGFAAKAAKRMTGPAL |
Ga0307315_101119471 | 3300028721 | Soil | GGLAMKRRFYFILVVLALVLLAIPGFAAKAARRAVRPAVRFA |
Ga0307319_101103811 | 3300028722 | Soil | MKRRFYFILVVLALVLLAIPGFAAKAARRAARPAVRFA |
Ga0307282_100915622 | 3300028784 | Soil | MRKKHLYFMLLVLALILLALPGFAAKAAKRTARPVLRFA |
Ga0307282_101338751 | 3300028784 | Soil | RKKHFYFMLLVLVLALILLALPGFAAKAAKKAAGPALRFA |
Ga0307282_102049922 | 3300028784 | Soil | MRKRHIYFMLLVLALILLALPGFAAKAAKRVTGPALRFA |
Ga0307290_102937462 | 3300028791 | Soil | MKRRFYFILVVLALVLLALPGFAAKAAKRAGRPALRFA |
Ga0307284_100118241 | 3300028799 | Soil | MKRRFYFILVVLALVLLAIPGFAAKAARRATRPALRFA |
Ga0307292_100901911 | 3300028811 | Soil | HFYFMLLVLALILLALPGFAANAAKKAAGPALRFA |
Ga0307302_103311462 | 3300028814 | Soil | MRRKHFYFVLVVLALILLALPGFAAKAAKRVTRPALRFA |
Ga0307310_101090673 | 3300028824 | Soil | PRSLMRKKHFYFMLLVLALILLALPGFAANAAKKAAGPALRFA |
Ga0307312_106568503 | 3300028828 | Soil | MRKKHFYFMLLVLALILLALPGFAAKAAKRAAGPALRFA |
Ga0307286_100309263 | 3300028876 | Soil | LMKRRFYFMLLVLALILLALPGFAAKGTKRAAGPALRFA |
Ga0307278_100474783 | 3300028878 | Soil | MKRRFYFMLLVLALILLALPGFAAKGAKRAAGPALRFA |
Ga0307278_105401361 | 3300028878 | Soil | RRFYFTLVVLALILLALPGFAAKAAKRAAGPALRFA |
Ga0307277_103941672 | 3300028881 | Soil | MRKKHFYFMLLVLALILLALPGFAARAAKRVAGPALRFA |
Ga0308178_10691201 | 3300030990 | Soil | MKRRFYFMLLVLALILLALPGFAAMGTKRAAGPALRFA |
Ga0307497_100225552 | 3300031226 | Soil | MKRRFYFTLVILALILLALPGFAAKAAKRAAGPALRFA |
Ga0310813_111529681 | 3300031716 | Soil | MRKRRFYFILLVLALILLALPGFAAKAAKRAAGPALRF |
Ga0307469_117329961 | 3300031720 | Hardwood Forest Soil | AAGGLTMRRPFYFVLAVLALLLLALPGFAAKGVRRAVRPALRFA |
Ga0307468_1002236712 | 3300031740 | Hardwood Forest Soil | MKRRFYFTLVVLALILLAMPGFAAKAAKRAAGPALRFA |
Ga0308175_1013158372 | 3300031938 | Soil | MKRRFYFILLVLALIVLAVPGFAAKAAKRAARPAPRLA |
⦗Top⦘ |