| Basic Information | |
|---|---|
| Family ID | F013547 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 270 |
| Average Sequence Length | 42 residues |
| Representative Sequence | LGVPLGTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Number of Associated Samples | 210 |
| Number of Associated Scaffolds | 270 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 1.85 % |
| % of genes from short scaffolds (< 2000 bps) | 1.85 % |
| Associated GOLD sequencing projects | 198 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (98.519 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.296 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.852 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 37.68% Coil/Unstructured: 62.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 270 Family Scaffolds |
|---|---|---|
| PF04545 | Sigma70_r4 | 15.19 |
| PF01242 | PTPS | 10.74 |
| PF08281 | Sigma70_r4_2 | 1.48 |
| PF01066 | CDP-OH_P_transf | 1.48 |
| PF14759 | Reductase_C | 1.48 |
| PF10604 | Polyketide_cyc2 | 1.11 |
| PF00300 | His_Phos_1 | 0.74 |
| PF07690 | MFS_1 | 0.74 |
| PF01220 | DHquinase_II | 0.74 |
| PF00561 | Abhydrolase_1 | 0.37 |
| PF13490 | zf-HC2 | 0.37 |
| PF08501 | Shikimate_dh_N | 0.37 |
| PF09851 | SHOCT | 0.37 |
| PF09594 | GT87 | 0.37 |
| PF13649 | Methyltransf_25 | 0.37 |
| PF03706 | LPG_synthase_TM | 0.37 |
| PF00296 | Bac_luciferase | 0.37 |
| PF01135 | PCMT | 0.37 |
| PF13466 | STAS_2 | 0.37 |
| PF01402 | RHH_1 | 0.37 |
| PF13579 | Glyco_trans_4_4 | 0.37 |
| PF04024 | PspC | 0.37 |
| PF00903 | Glyoxalase | 0.37 |
| PF14016 | DUF4232 | 0.37 |
| PF02852 | Pyr_redox_dim | 0.37 |
| PF04149 | DUF397 | 0.37 |
| COG ID | Name | Functional Category | % Frequency in 270 Family Scaffolds |
|---|---|---|---|
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 10.74 |
| COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 1.48 |
| COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 1.48 |
| COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 1.48 |
| COG0757 | 3-dehydroquinate dehydratase | Amino acid transport and metabolism [E] | 0.74 |
| COG0169 | Shikimate 5-dehydrogenase | Amino acid transport and metabolism [E] | 0.37 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.37 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.37 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.37 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.37 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.37 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.37 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 98.52 % |
| All Organisms | root | All Organisms | 1.48 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300009525|Ga0116220_10164371 | Not Available | 955 | Open in IMG/M |
| 3300011048|Ga0138556_119729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 571 | Open in IMG/M |
| 3300012685|Ga0137397_10959400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 631 | Open in IMG/M |
| 3300025913|Ga0207695_11178728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 646 | Open in IMG/M |
| 3300031708|Ga0310686_103948704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 668 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.67% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.30% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.44% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.70% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.59% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.59% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.22% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.96% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.85% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.48% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.11% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.11% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.11% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.11% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.11% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.11% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.11% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.11% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.11% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.74% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.37% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.37% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.37% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.37% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.37% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.37% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.37% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.37% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.37% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.37% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.37% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.37% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.37% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.37% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559006 | Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembled | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001544 | Cubitermes ugandensis P1 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P1 | Host-Associated | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010860 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010864 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011048 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 37 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012180 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG | Host-Associated | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024187 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13 | Environmental | Open in IMG/M |
| 3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
| 3300025633 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027002 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027030 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF041 (SPAdes) | Environmental | Open in IMG/M |
| 3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
| 3300027307 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027968 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300030046 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_3 | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030622 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE044SO (Eukaryote Community Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031200 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FI_00770220 | 2166559006 | Grass Soil | CRALGVPLSTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| JGI12712J15308_100334292 | 3300001471 | Forest Soil | RALGVPLGTLYRLYLGSACINEIRWHGGGFAAVHCVNDTSHLP* |
| JGI20163J15578_106849252 | 3300001544 | Termite Gut | KILLCRALGVPLGTLYRLYLGSASINEIQWHGRGFASVHRVNDTSHLP* |
| JGIcombinedJ26739_1016410633 | 3300002245 | Forest Soil | LGTLYRLYLGSACINEIRWHGRGFAAVHCVNDTSHLP* |
| JGIcombinedJ51221_101678412 | 3300003505 | Forest Soil | CRALGVPLGTLYRLYLGSACINEIRWHGGGFAAVHCVNDTSHLP* |
| Ga0066388_1038846632 | 3300005332 | Tropical Forest Soil | VPLGTLYRLYLGSACINKIQWHGRGFAAVHCVNDTSHLP* |
| Ga0070680_1015674332 | 3300005336 | Corn Rhizosphere | RALGVPLSTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP* |
| Ga0008090_158253292 | 3300005363 | Tropical Rainforest Soil | ILLCRALGVPLGTVYRLYLGSACINEIQWHGRGFAAVHCVNDTSHLP* |
| Ga0070714_1004957092 | 3300005435 | Agricultural Soil | LGVPLSTLYRLYLGSACINEIQWHGGGFASVHRVNDTSHLP* |
| Ga0070714_1017905441 | 3300005435 | Agricultural Soil | VPLSTLYRLYLGSACINEIQWHGGGFAAVHRVNDTSHLA* |
| Ga0070714_1019653691 | 3300005435 | Agricultural Soil | ALGVPLSTLYRLYLGSACINDIQWYGRGFAAVRCVNDTSHLP* |
| Ga0070713_1007156042 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LGVPLSTLYRLYLGSACINEIQWHGGGFASVHRVNDTSHLA* |
| Ga0070713_1019843111 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | KILLCRALSVPLGTLYRLYLGSACINEIRWHGRGFAAVHSVNDTSHLP* |
| Ga0070733_109641542 | 3300005541 | Surface Soil | VPLGTLYRLYLGSACINEIHWHGRGFAAVHCVNDTSHLP* |
| Ga0066670_106237521 | 3300005560 | Soil | PLATVYRMYLGSACINEIQWHDHEFAAVRCVNDTSHLP* |
| Ga0070762_105454791 | 3300005602 | Soil | LCRALGVPLDTIYRLYLGSACINKIQWHGREFAAVHCVNDTSHLP* |
| Ga0070763_106496262 | 3300005610 | Soil | VPLGTLYRLYLGSACISEIQWHGRGFAAVHRVNDTSHLP* |
| Ga0066903_1012835961 | 3300005764 | Tropical Forest Soil | KILLCRALGVPLGTLYRLYLGSACINEIRWHGRGFAAVHCVNDTSHLA* |
| Ga0070766_102748201 | 3300005921 | Soil | KILLCRALGAPLGTLYRLYLGSACINEIQWHGGGFAAVHCVNDTSHLP* |
| Ga0081540_13194142 | 3300005983 | Tabebuia Heterophylla Rhizosphere | LSTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP* |
| Ga0070717_109326313 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | CRALGVPLSTIYRLYLGSACINKIPVVGREFAAVHCVNDTSHPS* |
| Ga0070717_118543642 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LGVPLGTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP* |
| Ga0075019_109922502 | 3300006086 | Watersheds | LYRLYLGSACINEIQWHGDGFAAVHCVNDTSHLP* |
| Ga0070712_1006262091 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | PLGTLYRLYLGSACINEIQWHGHGFAAVHCVNDTSHLP* |
| Ga0070712_1009411411 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RALGVPLSTLYRLYLGSACINEIQWHGREFAAVRRVNDTSHLP* |
| Ga0074051_117332942 | 3300006572 | Soil | KILLCRALGVPLGTIYRLYLGSACINEIRWHDRGFAAVHCVNDTSHLP* |
| Ga0074055_100088642 | 3300006573 | Soil | IMLCRALGVPLSTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP* |
| Ga0074055_118695612 | 3300006573 | Soil | LGVPLGTLYRLYLGSACINEIRWHGRGFAAVHCVNDTSHLP* |
| Ga0079222_103383801 | 3300006755 | Agricultural Soil | ALGVPLSTVYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP* |
| Ga0066659_118390761 | 3300006797 | Soil | DVPLAALYRMYLGSACINEIQWHDHEFAAVRSVNDTSHLS* |
| Ga0079221_113009351 | 3300006804 | Agricultural Soil | PLGTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP* |
| Ga0075434_1016768772 | 3300006871 | Populus Rhizosphere | MLCRALGVPLSTLYRLYLGSACINEIQWHDRGFAAVHRVNDTSHLP* |
| Ga0075426_102674152 | 3300006903 | Populus Rhizosphere | LGVPLSTVYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP* |
| Ga0075435_1009025041 | 3300007076 | Populus Rhizosphere | VPLGTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP* |
| Ga0099791_104548623 | 3300007255 | Vadose Zone Soil | PLGTLYRLYLGSASINEIQWHGRGFAAVHRVNDTSHLP* |
| Ga0066709_1011563171 | 3300009137 | Grasslands Soil | TLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP* |
| Ga0116220_101643711 | 3300009525 | Peatlands Soil | ALYRIYLGSACINEIQWHDHEFAAVRRVNDTSHLT* |
| Ga0126373_117584582 | 3300010048 | Tropical Forest Soil | LLCRALGVPLGTVYRLYLGSACINEIQWHGRGFATVHCVNDTSHLP* |
| Ga0134080_104495542 | 3300010333 | Grasslands Soil | LCRALGVPLSTVYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP* |
| Ga0126370_125269561 | 3300010358 | Tropical Forest Soil | IKILLCRALGVPLGTLYRLYLGSACINGIQWYGRGFATVHCVNDTSHLP* |
| Ga0126370_125500071 | 3300010358 | Tropical Forest Soil | LYRLYLGSACINEIQWHGRGFAAVHCVNDTSHLP* |
| Ga0126376_111153011 | 3300010359 | Tropical Forest Soil | KILLCRALGVPLGALYRLYLGSACINEIRWHGRGFAAVHRVNDTSHLP* |
| Ga0126376_122343351 | 3300010359 | Tropical Forest Soil | TLYRLYLGSACINEIRWHGSGFAAVHRVNDTSHLP* |
| Ga0126372_102493701 | 3300010360 | Tropical Forest Soil | GVPLGTLYRLYLGSACINEIHWHGRGFAAVHCVNDTSHLP* |
| Ga0126372_109462903 | 3300010360 | Tropical Forest Soil | VPLGTLYRLYLGSACINEIQWHGRGFATVHCVNDTSHLA* |
| Ga0126378_125031291 | 3300010361 | Tropical Forest Soil | LGVPLGTLYRLYLGSACINEIQWHGRGLAAVHRVNDTSHLP* |
| Ga0126378_128134211 | 3300010361 | Tropical Forest Soil | GTLYRLYLGSACINEIRWHGRGFAAVHCVNDTSHLP* |
| Ga0126379_131633202 | 3300010366 | Tropical Forest Soil | APLGTLYRLYLGSACINEIQWYGRGFAAVHCVNDTSHLP* |
| Ga0134125_101114991 | 3300010371 | Terrestrial Soil | TLYRLYLGSACINEIQWHGRGFASVHRVNDTSHLP* |
| Ga0134125_106229461 | 3300010371 | Terrestrial Soil | ILLCRALSVPLGTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP* |
| Ga0134125_110383081 | 3300010371 | Terrestrial Soil | ILLCRALGVPLSTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP* |
| Ga0134128_103573741 | 3300010373 | Terrestrial Soil | LYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP* |
| Ga0105239_107699221 | 3300010375 | Corn Rhizosphere | GVPLGTLYRLYLGSACINEIRWHDRGFAAVHCVNDTSHLP* |
| Ga0126381_1001345951 | 3300010376 | Tropical Forest Soil | LYRMYLGSACINEIQWHDHEFAAVRRVNDTSHLS* |
| Ga0126381_1025215532 | 3300010376 | Tropical Forest Soil | GTVYRLYLGSACINEIQWHGRGFAAVHCVNDTSHLP* |
| Ga0126381_1044387561 | 3300010376 | Tropical Forest Soil | VPLGTLYRLYLGSACINEIQWYGRGFAAVHRVNDTNHLA* |
| Ga0136449_1025494952 | 3300010379 | Peatlands Soil | ALDVPLAALYRIYLGSACINEIQWHDHEFAAVRRVNDTSHLT* |
| Ga0136449_1032206293 | 3300010379 | Peatlands Soil | ALDVPLAALYRIYLGSACINEIQWHDHEFAAVRRVNDTSHLTR* |
| Ga0136449_1038159431 | 3300010379 | Peatlands Soil | LYRIYLGSACINEIQWHDHEFAAVRRVNDTSHLT* |
| Ga0134126_116421872 | 3300010396 | Terrestrial Soil | ALSVPLGTLYRLYLGSACINEIQWHDRGFAAVHRVNDTSHLP* |
| Ga0126383_110378462 | 3300010398 | Tropical Forest Soil | CRALGVPLGTLYRLYLGSACINEIQWHGREFAAVRRVNDTSHLP* |
| Ga0126383_125513782 | 3300010398 | Tropical Forest Soil | CRALGVPLGTLYRLYLGSACINEIQWHGHGFAAVHCVNDTSHLP* |
| Ga0126383_135282231 | 3300010398 | Tropical Forest Soil | KIMLCRALGVPLSTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP* |
| Ga0126352_12611982 | 3300010859 | Boreal Forest Soil | PLGTVYRLYLGSACINEIQWHGREFATVHCVNDTSHLP* |
| Ga0126351_11695043 | 3300010860 | Boreal Forest Soil | RALGVPLDTIYRLYLGSACINKIQWHGREFAAVHCVNDTSHLP* |
| Ga0126357_12245181 | 3300010864 | Boreal Forest Soil | LLCRALGVPLGTIYRLYLGSACINKIEWHGRGFAAVHCVNDTSHLP* |
| Ga0126344_10089963 | 3300010866 | Boreal Forest Soil | LLCRVLGVPLGTIYRLYLGSACINKIEWHGREFAAVHSVNDTSHLP* |
| Ga0126361_105944752 | 3300010876 | Boreal Forest Soil | PLTTLYRLYLGSACINEIQWHGHEFAAVRRVNDTSHLL* |
| Ga0126361_110010461 | 3300010876 | Boreal Forest Soil | LYRLYLGSACINEIHWHGRGFAAVHCVNDTSHLP* |
| Ga0126350_116556551 | 3300010880 | Boreal Forest Soil | ILLCRALGVPLGTIYRLYLGSACINKIEWHGREFAAVHSVNDTSHLP* |
| Ga0138556_1197291 | 3300011048 | Peatlands Soil | LDVPLATLYRIYLGSACINEIQWHDHEFAAVRRVNDTSHLT* |
| Ga0137391_104972903 | 3300011270 | Vadose Zone Soil | LGTLYRLYLGSACINEIQWHGRGFAAVHCVNDTSHLP* |
| Ga0153974_10739542 | 3300012180 | Attine Ant Fungus Gardens | LLCRALGAPLGTLYRLYLGSACINEIQWHGRGFAAVHCVNDTSHLP* |
| Ga0137399_111747081 | 3300012203 | Vadose Zone Soil | TLYRLYLGSACINEIRWHGHGFAAVHRVNDTSHLP* |
| Ga0137380_112567472 | 3300012206 | Vadose Zone Soil | LCRALGVPLGTVYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP* |
| Ga0137377_105028021 | 3300012211 | Vadose Zone Soil | RALGVPLGTLYRLYLGSACINEIQWHGRGFAAVHCVNDTSHLP* |
| Ga0137386_110695002 | 3300012351 | Vadose Zone Soil | LLCRALGVPLGTVYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP* |
| Ga0137371_101887602 | 3300012356 | Vadose Zone Soil | KILLCRALGVPLGTLYRLYLGSACINEVQWHGRGFASVHCVNDTSHLP* |
| Ga0137371_103547312 | 3300012356 | Vadose Zone Soil | VTLYRMYLGSACLNEIQWHDHQYAAVRRFNDTSHLP* |
| Ga0137385_111314842 | 3300012359 | Vadose Zone Soil | GVPLGTVYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP* |
| Ga0137397_109594001 | 3300012685 | Vadose Zone Soil | LLCRALGVPLGTIYRLYLGSACINKIQWHGREFAAVHCVNDTSHLP* |
| Ga0157299_103455882 | 3300012899 | Soil | GVPLSTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP* |
| Ga0137410_109225231 | 3300012944 | Vadose Zone Soil | QALGVPLGTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP* |
| Ga0126375_105359532 | 3300012948 | Tropical Forest Soil | GTLYRLYLGSACINEIQWHGRGFAAVHCVNDTSHLP* |
| Ga0126369_115881342 | 3300012971 | Tropical Forest Soil | CRALGVPLGTVYRLYLGSACINEIQWHGRGFAAVHCVNDTSHLP* |
| Ga0164304_101132641 | 3300012986 | Soil | LGVPLGTLYRLYLGSACINEIQWHDRGFAAVHRVNDTSHLP* |
| Ga0157371_100852701 | 3300013102 | Corn Rhizosphere | GVPLSTLYRLYLGSACINEIQWHDRGFAAVHRVNDTSHLP* |
| Ga0157369_111700231 | 3300013105 | Corn Rhizosphere | PLSALYRLYLGSACISEIQWHGGGFAAVHRVNDTSHLL* |
| Ga0157379_106492151 | 3300014968 | Switchgrass Rhizosphere | RALGVPLSTLYRLYLGSACINEIQWYGRGFAAVHRVNDTSHLP* |
| Ga0132257_1006979122 | 3300015373 | Arabidopsis Rhizosphere | MLCRALGVPLSTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP* |
| Ga0182032_102043631 | 3300016357 | Soil | LGTVYRLYLGSACINEIQWHGRGFAAVHCVNDTSHLP |
| Ga0182040_107792992 | 3300016387 | Soil | GTLYRLYLGSACINEIRWHGRGFAAVHRVNDTGHLP |
| Ga0182037_119877281 | 3300016404 | Soil | GTVYRLYLGSACLNEIQWHGRGFAAVHCVNDTSHLP |
| Ga0182039_104737793 | 3300016422 | Soil | GTLYRLYLGSACINEIQWHGRGFAAIHRVNDTSHLP |
| Ga0182039_114296591 | 3300016422 | Soil | KILLCRALGVPLGTVYRLYLGSACINEIQWHGRGFAAVHSVNDTSHLP |
| Ga0182038_104365402 | 3300016445 | Soil | LLCRALGVPLGTLYRLYLGSACINEIRWHDRGFAAVHCVNDTSHLP |
| Ga0182038_108363901 | 3300016445 | Soil | VPLSTLYRLYLGSACINEIRWHGRGFAAVHRVNDTSHLR |
| Ga0187779_102343492 | 3300017959 | Tropical Peatland | LGVPLGTLYRLYLGSACINEIQWHGCGFAAVHRVNDTSHLP |
| Ga0187767_102178711 | 3300017999 | Tropical Peatland | KILLCRALSVPLGTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0187890_104619572 | 3300018044 | Peatland | LCRALDVPLAALYRIYLGSACINEIQWHDHEFAAVRRVNDTSHLT |
| Ga0187765_110709341 | 3300018060 | Tropical Peatland | CRALGVPLGTLYRLYLGSACINEIRWHGRGFAAVHCVNDTSHLP |
| Ga0187765_111174451 | 3300018060 | Tropical Peatland | ILLCRALGVPLGTLYRLYLGSACINEIQWHGHGFAAVRRVNDTSHLP |
| Ga0187765_113830652 | 3300018060 | Tropical Peatland | ATLYRLYLGSACINKIQWHGRGFAAVHSVNDTSHLP |
| Ga0193747_11460532 | 3300019885 | Soil | LSTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0193726_12439143 | 3300020021 | Soil | ALGVPLDTIYRLYLGSACINKIQWHGREFAAVHSVNDTSHLP |
| Ga0206355_13839891 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | LGVPLGTVYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0206355_16595391 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | IKILLCRALGVPLGTVYRMYLGSACINKIQWHGREFAAVHSVNDTSHLPD |
| Ga0210407_100727982 | 3300020579 | Soil | RALGVPLSTVYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0210407_105450701 | 3300020579 | Soil | RALGVPLDTIYRLYLGSACINKIQWHGRDFAAVHCVNDTSHLP |
| Ga0210403_102403801 | 3300020580 | Soil | KILLCRALGVPLGTLYRLYLGSACINEIRWHGRGFAAVHCVNDTSHLP |
| Ga0210403_105491783 | 3300020580 | Soil | LSVPLGTVYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0210400_105108811 | 3300021170 | Soil | LGVPLGTLYRLYLGSACINEIRWHGGGFAAVHCVNDTSHLP |
| Ga0210405_110331192 | 3300021171 | Soil | LGTLYRLYLGSACINEIQWHGGGFAAVHRVNDTSHLAER |
| Ga0210388_108564572 | 3300021181 | Soil | VPLSTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0210388_110305091 | 3300021181 | Soil | GVPLDTIYRLYLGSACINKIQWHGREIAAVHCVNDTSHLP |
| Ga0213881_100159151 | 3300021374 | Exposed Rock | ALGAPLLAMYRFYLGSACINEIQWHGNEYAAVRKVNDTSHLSWP |
| Ga0213876_104757691 | 3300021384 | Plant Roots | KIMLCRALGVPLSTLYRLYLGSACINEIQWHDRGFAAVHRVNDTSHLP |
| Ga0210385_107206291 | 3300021402 | Soil | VPLGPLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0210385_109673071 | 3300021402 | Soil | QALGVPLGTLYRLYFGSACINEIHWHGRGFASVHRVNDTSHLP |
| Ga0210389_105528102 | 3300021404 | Soil | ILLCRALGVPLSTLYRLYHGSACINEIQWHGGGFAAVHRVNDTSHLP |
| Ga0210389_107247021 | 3300021404 | Soil | KILLCRALVVPLGTVYRLYLGSASINEIQWHGRGFAAVHRVNDTSHLLP |
| Ga0210387_109534901 | 3300021405 | Soil | VVPLGTLYRLYLGSASINEIQWHGREFAAVHRVNDTSHLP |
| Ga0210387_118044071 | 3300021405 | Soil | STLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0210386_102551023 | 3300021406 | Soil | PLDTIYRLYLGSACINKIQWHGSEFSAVHCVNDTSHLP |
| Ga0210383_102626281 | 3300021407 | Soil | GTLYRLYLGSACINEIQWHGREFAAVHRVNDTSHLP |
| Ga0210394_101998104 | 3300021420 | Soil | PLGTVYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0210391_106047851 | 3300021433 | Soil | CRALSVPLGTLYRLYLGSACISEIQWHGRGFAAVHRVNDTSHLS |
| Ga0210391_106122044 | 3300021433 | Soil | CRALSVPLGTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0210390_101079541 | 3300021474 | Soil | CRALGVPLATLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0210392_106602131 | 3300021475 | Soil | LGTLYRLYLGSACISEIQWHDRGFASVHRVNDTSHLP |
| Ga0210392_107475291 | 3300021475 | Soil | GVPLGTLYRLYLGSACINEIQWHDRGFASVHRVNDTSHLP |
| Ga0210398_111582132 | 3300021477 | Soil | TLYRLYLGSACINEIRWHGGGFAAVHCVNDTSHLP |
| Ga0210409_108031001 | 3300021559 | Soil | LSALYRLYLGSACISEIQWHGPGFAAVHRVNDTSHLP |
| Ga0126371_103657711 | 3300021560 | Tropical Forest Soil | IMLCRALGVPLSTVYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0126371_121439622 | 3300021560 | Tropical Forest Soil | ALGVPLGTLYRLYLGSACINEIQWHGREFAAVHCVNDTSHLP |
| Ga0224712_106703501 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | PLGTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0242663_10590342 | 3300022523 | Soil | RALGVPLGTLYRLYLGSACINEIRWHGGGFAAMHCVNDTSHLP |
| Ga0242669_10577692 | 3300022528 | Soil | TLYRLYFGSACINEIHWHGRGFASVHRVNDTSHLP |
| Ga0242660_10761802 | 3300022531 | Soil | TVYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0242661_11306602 | 3300022717 | Soil | VPLDTLYRLYLGSACINEIQWHDHGFAVVHCLNDTSHLR |
| Ga0242675_10917071 | 3300022718 | Soil | LGVPLSTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0242666_10470343 | 3300022721 | Soil | LCRALGVPLDTIYRLYLGSACINKIQWHGREIAAVHCVNDTSHLP |
| Ga0242666_11935751 | 3300022721 | Soil | LGVPLSTVYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0247672_10418911 | 3300024187 | Soil | TLYRLYLGSACINEIQWHGGGFASVHRVNDTSHLP |
| Ga0247661_10033542 | 3300024254 | Soil | SVPLGTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0208480_10386232 | 3300025633 | Arctic Peat Soil | LVVPLGTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0207692_105715772 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | ILLCRALGVPLGTLYRLYLGSACINEIQWHDRGFAAVHRVNDTSHLP |
| Ga0207692_111842812 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VPLGTLYRLYLGSACINEIQWHGHGFAAVHCVNDTSHLP |
| Ga0207684_100089849 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LLCRALGVPLGTLYRLYLGSACINEIQWHDRGFAAVHCVNDTSHLP |
| Ga0207695_105440852 | 3300025913 | Corn Rhizosphere | ALGVPLSTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0207695_111787281 | 3300025913 | Corn Rhizosphere | ILLCRALDVPLGTVYRLYLGSACINKIQWHGREFAAVHCVNDTSHLP |
| Ga0207693_102994312 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | PLSTLYRLYLGSACINEVQWYGRGFAAVRCVNDTSHLP |
| Ga0207660_110086831 | 3300025917 | Corn Rhizosphere | RALGVPLGTLYRLYLGSACINEIQWHGREFAAVHRVNDTSHLP |
| Ga0207700_100125531 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ILLCRALGVPLSTLYRLYLGSACINEIQWHGRGFAAVHCVNDTSHLPDSPR |
| Ga0207700_101585171 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GVPLSTLYRLYLGSACINEIQWHGGGFASVHRVNDTSHLA |
| Ga0207664_107690941 | 3300025929 | Agricultural Soil | RLYLGSACINEIQWHGRGFAAVHCVNDTSHLPDSPR |
| Ga0207661_100562741 | 3300025944 | Corn Rhizosphere | TVYRMYLGSACINKIQWHGREFAAVHSVNDTSHLPD |
| Ga0207651_106063161 | 3300025960 | Switchgrass Rhizosphere | GVPLSTLYRLYLGSACINEIQWHDRGFAAVHRVNDTSHLP |
| Ga0207678_107028161 | 3300026067 | Corn Rhizosphere | LCRALGVPLGTLYRLYLGSACINEIRWHDRGFAAVHCVNDTSHLP |
| Ga0257171_10751781 | 3300026377 | Soil | VPLGTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0257154_10698841 | 3300026467 | Soil | GVPLGTLYRLYLGSACINEIQWHGRGFATVHRVNDTSHLP |
| Ga0209056_102157132 | 3300026538 | Soil | KILLCRALGVPLGTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0179593_11902214 | 3300026555 | Vadose Zone Soil | MLCRALGVPLSTVYRLYLGSACINEIHWYGPGCAAVHRVNDTSRL |
| Ga0179587_104862062 | 3300026557 | Vadose Zone Soil | MLCRALGVPLSTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0209110_10255101 | 3300027002 | Forest Soil | PLGTVYRLYLGSACINKIQWHGGDFAAVHCVNDTSHLP |
| Ga0208240_10409492 | 3300027030 | Forest Soil | SVPLATLYRLYLGSACINTIQWHGRGFAAVHSVNDTSHLP |
| Ga0208099_10590762 | 3300027096 | Forest Soil | PLGTLYRLYLGSACINEIQWHGDGFAAVHCVNDTSHLP |
| Ga0209327_10238321 | 3300027307 | Forest Soil | LLCRAMGVPLGTVYRLYLGSACISKIQWHGREFAAVHCVNDTSHLP |
| Ga0208324_11780643 | 3300027604 | Peatlands Soil | DVPLATLYRIYLGSACINEIQWHDHEFAAVRRVNDTSHLT |
| Ga0209178_12228253 | 3300027725 | Agricultural Soil | LSTIYRLYLGSACINTIQWHGREFAAVHCVNDTSHLP |
| Ga0208989_101740861 | 3300027738 | Forest Soil | PLAALYRMYLGSACINEIQWHGHEFAAVRRVNDTSHLL |
| Ga0209074_100113911 | 3300027787 | Agricultural Soil | MLCRALGVPLSTVYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0209074_100590981 | 3300027787 | Agricultural Soil | TLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0209074_101587702 | 3300027787 | Agricultural Soil | ALSVPLGTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0209074_103535222 | 3300027787 | Agricultural Soil | GVPLGTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0209180_104965353 | 3300027846 | Vadose Zone Soil | PLGTLYRLYLGSACINEIRWYGRGFAAVHRVNDTSHLP |
| Ga0209166_101088412 | 3300027857 | Surface Soil | LCRALGVPLDAVYRLYLGSACINEIRWHDRGFATVHRVNDTSHLP |
| Ga0209701_104274971 | 3300027862 | Vadose Zone Soil | ILLCRALGVPLGTLYRLYLGSACINEIHWHGRGFAAVHCVNDTSHLP |
| Ga0209283_100248471 | 3300027875 | Vadose Zone Soil | GTLYRLYLGSACINEIQWHGRGFAAVHCVNDTSHLP |
| Ga0209488_108200012 | 3300027903 | Vadose Zone Soil | LCRALGVPLGTVYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0209006_103574822 | 3300027908 | Forest Soil | TLYRLYLGSACISEIQWHGHGFAAVHRVNDTSHLP |
| Ga0209006_108607011 | 3300027908 | Forest Soil | STIYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0209061_12301551 | 3300027968 | Surface Soil | IKILLCRALGVPLGTVYRLYLGSACINEIRWHGREFAAVHCVNDTSHLP |
| Ga0209168_100534753 | 3300027986 | Surface Soil | LCRALDAPLGTLYRLYLGSASINEIQWYGREFAAVHCVNDTSHLP |
| Ga0302225_103224161 | 3300028780 | Palsa | GTIYRLYLGSACINKIEWHGREFAAVHSVNDISHLA |
| Ga0302305_13460291 | 3300030046 | Palsa | VPLGTIYRLYLGSACINKIEWHGREFAAVHCVNDTSHLS |
| Ga0311355_111285713 | 3300030580 | Palsa | ALGVPLGTLYRLYLGSACINEIRWHGGGFAAVHCVNDTSHLP |
| Ga0265391_101890761 | 3300030622 | Soil | LGTLYRLYLGSACINEIRWHGRGFAAVHCVNDTSHLP |
| Ga0265459_139746951 | 3300030741 | Soil | RALGVPLDTIYRLYLGSACINKIQWHGGEFAAVHSVNDTSHLP |
| Ga0170823_127204951 | 3300031128 | Forest Soil | TIYRLYLGSACINKVEWHGCEFAAVHTVNDTSHLP |
| Ga0307496_101360911 | 3300031200 | Soil | LLCRALGAPLSTLYRLYLGSACISEIQWHGRGFAAVHRVNDTSHLP |
| Ga0170824_1027185391 | 3300031231 | Forest Soil | PLGTIYRLYLGSACINKIQWYGREFAAVHCVNDTSHLP |
| Ga0170819_124737321 | 3300031469 | Forest Soil | KILLCRALSVPLGTLYRLYLGSACINEIQWHGGGFAAVHRVNDTSHLP |
| Ga0318534_106557572 | 3300031544 | Soil | KILLCRALCVPLDTVYRLYLGSACINEIQWYGRGFAAVHCVNDTSHLP |
| Ga0318534_107849993 | 3300031544 | Soil | TVYRLYLGSACINEIQWHGRGFAAVHCVNDTSHLP |
| Ga0318541_102818061 | 3300031545 | Soil | LGAPLGTLYRLYLGSACINEIQWYGRGFAAVHCVNDTSHLP |
| Ga0318541_104126801 | 3300031545 | Soil | ILLCRALGVPLGTIYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0318528_106185532 | 3300031561 | Soil | KILLCRALGVPLGTLYRLYLGSACISEIQWHGCGFAAVHRVNDTSHLP |
| Ga0318573_101818261 | 3300031564 | Soil | ILLCRALGVPLGTLYRLYLGSACINEIRWHGRGFAAVHCVNDTSHLP |
| Ga0318573_104031771 | 3300031564 | Soil | GTVYRLYLGSACINEIQWYGRGFAAVHCVNDTSHLP |
| Ga0310915_109238272 | 3300031573 | Soil | LCRALGVPLGTVYRLYLGSACINEIQWHGRGFAAVRCVNDTSHLP |
| Ga0310915_110609592 | 3300031573 | Soil | KILLCRALGVPLGTVYRLYLGSACINEIQWHGHGFAAVHCVNDTSHLP |
| Ga0318542_104458761 | 3300031668 | Soil | PLGTVYRLYLGSACINEIQWHGHGFAAVHCVNDTSHLP |
| Ga0318561_100270021 | 3300031679 | Soil | VPLGTVYRLYLGSACINEIQWHGHGFAAVHCVNDTSHLP |
| Ga0318572_105972583 | 3300031681 | Soil | STVYRLYLGSACINEIQWHGRGFAAVHCVNDTSHLP |
| Ga0318572_107774721 | 3300031681 | Soil | ALGVPLGTLYRLYLGSACISEIQWHGCGFAAVHRVNDTSHLP |
| Ga0310686_1000265852 | 3300031708 | Soil | LGTLYRLYLGSACINEIRWHDRGFAVVHCLNDTSHLP |
| Ga0310686_1039487043 | 3300031708 | Soil | GVPLSTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0310686_1173297742 | 3300031708 | Soil | ALSAPLGTLYRLYLGSACINEIQWHGREFAAVHRFNDTSHLP |
| Ga0318496_100414512 | 3300031713 | Soil | GTVYRLYLGSACINEIQWHGRGFAAVRCVNDTSHLP |
| Ga0307476_111562051 | 3300031715 | Hardwood Forest Soil | LCRALGVPLSTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0306917_105442172 | 3300031719 | Soil | TLYRLYLGSACINEIQWHGCGFAAVHRVNDTSHLP |
| Ga0306917_107264471 | 3300031719 | Soil | LLCRALGVPLGTVYRLYLGSACINEIQWHGRGFAAVRCVNDTSHLP |
| Ga0318500_101482871 | 3300031724 | Soil | VPLGTIYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0318501_100536051 | 3300031736 | Soil | LCRALGVPLGTLYRLYLGSACINEIRWHGRGFAAVHCVNDTSHLP |
| Ga0318501_101671361 | 3300031736 | Soil | ILLCRALGVPLGTVYRLYLGSACINEIQWYGRGFAAVHCVNDTSHLP |
| Ga0306918_101541051 | 3300031744 | Soil | ILLCRALGVPLGTVYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0318502_108720281 | 3300031747 | Soil | VPLGTLYRLYLGSACINEIHWHGRGFAAVHCVNDTSHLP |
| Ga0318492_100938211 | 3300031748 | Soil | ILLCRALGVPLGTVYRLYLGSACINEIQWHGHGFAAVHCVNDTSHLP |
| Ga0318494_101201781 | 3300031751 | Soil | TLYRLYLGSACINEIQWHGRGFAAVRCVNDTSHLP |
| Ga0318494_107132602 | 3300031751 | Soil | IKILLCRALGVPVGTIYRLYLGSACINEIQWHGRGFAAVHCVNDTSHLP |
| Ga0318554_106484052 | 3300031765 | Soil | LGVPLATLYRLYLGSACINEIHWHGRGFAAVHCVNDTSHLP |
| Ga0318521_101166221 | 3300031770 | Soil | VPLVTLYRLYLGPACINEIQWHDHEFAAVRRVNDTSHLPDRGPGQSR |
| Ga0318521_107737392 | 3300031770 | Soil | LSTLYRLYLGSACINEIQWHGRGFAAVHCVNDTSHLR |
| Ga0318529_102313482 | 3300031792 | Soil | LGVPLGTLYRLYLGSACINEIQWHGRGFAAVHRVNDTGHLP |
| Ga0318529_102889242 | 3300031792 | Soil | ILLCRALGVPLGTVYRLYLGSACINEIQWHGRGFAAVRCVNDTSHLP |
| Ga0318548_105308332 | 3300031793 | Soil | RALAVPLGTLYRLYLGSACINEIQWHSRGFAAVHCVNDTSHLP |
| Ga0318503_102481021 | 3300031794 | Soil | LLCRALAVPLSTLYRLYLGSACINEIRWHGRGFAAVHRVNDTSHLR |
| Ga0318497_104350791 | 3300031805 | Soil | LSTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLR |
| Ga0318567_102989171 | 3300031821 | Soil | ILLCQALGVPLGTLYRLYLGSACINEIQWYGRGFAAVHCVNDTSHLP |
| Ga0318527_102306032 | 3300031859 | Soil | ALGVPLSTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLR |
| Ga0318495_100374883 | 3300031860 | Soil | GTIYRLYLGSACINEIQWHGRGFAAVHCVNDTSHLP |
| Ga0318522_103607662 | 3300031894 | Soil | ALGVPLGTLYRLYLGSACINEIQWHGCGFAAVHRVNDTSHLP |
| Ga0318551_103939551 | 3300031896 | Soil | LDSLYRLYLGSACINEIQWHGRGFAAVHCVNDTSHLP |
| Ga0318520_104419261 | 3300031897 | Soil | PLGTLYRLYLGSACINEIQWYGRGFAAVHCVNDTSHLP |
| Ga0318520_109353442 | 3300031897 | Soil | CRALGVPLGTLYRLYLGSACINEIQWYGRGFAAVHCVNDTSHLP |
| Ga0306923_113757531 | 3300031910 | Soil | CRALGVPLGTLYRLYLGSACINEIRWHDRGFAAVHCVNDTSHLP |
| Ga0306921_103256193 | 3300031912 | Soil | KILLCRALGVPLGTVYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0310913_105020991 | 3300031945 | Soil | PLVTLYRLYLGPACINEIQWHDHEFAAVRRVNDTSHLPDRGPGQSR |
| Ga0310910_111897731 | 3300031946 | Soil | CRALAVPLSTLYRLYLGSACINEIRWHGRGFAAVHRVNDTSHLR |
| Ga0310909_101401731 | 3300031947 | Soil | ALGVPLGTLYRLYLGSACINEIRWHGRGFAAVHRVNDTGHLP |
| Ga0310909_115873191 | 3300031947 | Soil | KIMLCRALGVPLSTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0306926_130276652 | 3300031954 | Soil | PLSTLYRLYLGSACINEIRWHGRGFAAVHRVNDTSHLP |
| Ga0318531_100731651 | 3300031981 | Soil | LLCRALGAPLGTLYRLYLGSACINEIQWYGRGFAAVHCVNDTSHLP |
| Ga0306922_110669061 | 3300032001 | Soil | GTLYRLYLGSACINEIRWHDRGFAAVHCVNDTSHLP |
| Ga0306922_111394021 | 3300032001 | Soil | GVPLGTLYRLYLGSACISEIQWHGCGFAAVHRVNDTSHLP |
| Ga0306922_120669083 | 3300032001 | Soil | KILLCRALSVPLGTLYRLYLGSACINEIQWHGRGFAAVHCVNDTSHLP |
| Ga0318563_103896932 | 3300032009 | Soil | ILLCRALGVPLGTLYRLYLGSACINEIQWHGRGFAAVRCVNDTSHLP |
| Ga0318549_100431833 | 3300032041 | Soil | IMILLCRALGVPLGTLYRLYLGSACINEIRWHGRGFAAVHCVNDTSHLP |
| Ga0318558_100341232 | 3300032044 | Soil | ALGVPLSTLYRLYLGSACINEIRWHGRGFAAVHRVNDTSHLR |
| Ga0318570_100903911 | 3300032054 | Soil | PLGTLYRLYLGSACINEIRWHGRGFAAVHRVNDTGHLP |
| Ga0318533_112864251 | 3300032059 | Soil | LGVPLGTVYRLYLGSACINEIQWHGRGFAAVHSVNDTSHLPRLTRPVSPC |
| Ga0318505_101800071 | 3300032060 | Soil | LGTVYRLYLGSACINEIQWHGRGFAAVRCVNDTSHLP |
| Ga0318505_104285012 | 3300032060 | Soil | ILLCRALAVPLSTLYRLYLGSACINEIRWHGRGFAAVHRVNDTSHLR |
| Ga0318513_101920491 | 3300032065 | Soil | ALGVPLGTVYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0318513_106547741 | 3300032065 | Soil | IKILLCRALGVPLGTLYRLYLGSACINEIQWHGRGFAAVHCVNDTSHLRARPC |
| Ga0306924_110015812 | 3300032076 | Soil | IKILLCRALSVPLGTLYRLYLGSACINEIQWHGRGFAAVHCVNDTSHLP |
| Ga0318518_103325961 | 3300032090 | Soil | LLCRALSVPLGTLYRLYLGSACINEIQWHGRGFAAVHCVNDTSHLP |
| Ga0318540_100476023 | 3300032094 | Soil | ALGVPLGTLYRLYLGSACINEIRWHGRGFAAVHCVNDTSHLP |
| Ga0307470_114893071 | 3300032174 | Hardwood Forest Soil | CRALGVPLDTIYRLYLGSACINKIQWHGREFAAVHCVNDTSLLP |
| Ga0307471_1039611562 | 3300032180 | Hardwood Forest Soil | CRALGVPLGTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| Ga0306920_1028202571 | 3300032261 | Soil | PLGTLYRLYLGSACINEIQWHDRGFAAVHCVNDTSHLP |
| Ga0335085_113477332 | 3300032770 | Soil | GVPLGTLYRLYLGSACINEIQWHGHGFAAVHCVNDTSHLP |
| Ga0335079_102592454 | 3300032783 | Soil | CRALGVPLDVLYRLYLGSACINEIQWHGRGFAAVHSVNDTSHLPDSPERTR |
| Ga0335080_115694231 | 3300032828 | Soil | LCRALGVPLGTLYRLYLGSACINEIQWHGRGFAAVHCVNDTSHLP |
| Ga0335081_112257281 | 3300032892 | Soil | KILLCRALGVPLATLYRLYLGSACINEIQWHGRGFAAVHCVNDTSHLR |
| Ga0335075_101585025 | 3300032896 | Soil | LGAPLLAVYRFYLGSACINEIQWHGNQFAAVCKVNDTSHLISP |
| Ga0335083_108787912 | 3300032954 | Soil | ALGVPLDTVYRLYLGSACINEIRWHGSGFATVHRVNDTSHLP |
| Ga0310914_112733412 | 3300033289 | Soil | LGVPLGTVYRLYLGSACINEIQWYGRGFAAVHCVNDTSHLP |
| Ga0373959_0034863_920_1030 | 3300034820 | Rhizosphere Soil | GTLYRLYLGSACINEIQWHGRGFAAVHRVNDTSHLP |
| ⦗Top⦘ |