| Basic Information | |
|---|---|
| Family ID | F013546 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 270 |
| Average Sequence Length | 42 residues |
| Representative Sequence | VSRLREVLAERGLGQDQMSPKAYWGRGRANASHGEPARDA |
| Number of Associated Samples | 208 |
| Number of Associated Scaffolds | 270 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.11 % |
| % of genes near scaffold ends (potentially truncated) | 98.52 % |
| % of genes from short scaffolds (< 2000 bps) | 90.37 % |
| Associated GOLD sequencing projects | 197 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.926 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (35.926 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.593 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.111 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.47% β-sheet: 0.00% Coil/Unstructured: 73.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 270 Family Scaffolds |
|---|---|---|
| PF07398 | MDMPI_C | 16.30 |
| PF11716 | MDMPI_N | 12.22 |
| PF00294 | PfkB | 8.89 |
| PF07350 | DUF1479 | 2.22 |
| PF07690 | MFS_1 | 1.85 |
| PF01494 | FAD_binding_3 | 1.48 |
| PF13185 | GAF_2 | 1.48 |
| PF07228 | SpoIIE | 1.11 |
| PF07730 | HisKA_3 | 0.74 |
| PF08044 | DUF1707 | 0.74 |
| PF00753 | Lactamase_B | 0.74 |
| PF09723 | Zn-ribbon_8 | 0.74 |
| PF13546 | DDE_5 | 0.74 |
| PF07858 | LEH | 0.74 |
| PF07992 | Pyr_redox_2 | 0.74 |
| PF01636 | APH | 0.74 |
| PF13376 | OmdA | 0.74 |
| PF00989 | PAS | 0.74 |
| PF03372 | Exo_endo_phos | 0.74 |
| PF02585 | PIG-L | 0.74 |
| PF13671 | AAA_33 | 0.37 |
| PF05988 | DUF899 | 0.37 |
| PF02190 | LON_substr_bdg | 0.37 |
| PF13460 | NAD_binding_10 | 0.37 |
| PF02310 | B12-binding | 0.37 |
| PF01148 | CTP_transf_1 | 0.37 |
| PF16859 | TetR_C_11 | 0.37 |
| PF01022 | HTH_5 | 0.37 |
| PF17032 | zinc_ribbon_15 | 0.37 |
| PF13649 | Methyltransf_25 | 0.37 |
| PF01872 | RibD_C | 0.37 |
| PF13622 | 4HBT_3 | 0.37 |
| PF13367 | PrsW-protease | 0.37 |
| PF12697 | Abhydrolase_6 | 0.37 |
| PF08734 | GYD | 0.37 |
| PF13249 | SQHop_cyclase_N | 0.37 |
| PF01047 | MarR | 0.37 |
| PF10604 | Polyketide_cyc2 | 0.37 |
| PF01370 | Epimerase | 0.37 |
| PF00535 | Glycos_transf_2 | 0.37 |
| PF09957 | VapB_antitoxin | 0.37 |
| PF02567 | PhzC-PhzF | 0.37 |
| PF00581 | Rhodanese | 0.37 |
| PF01979 | Amidohydro_1 | 0.37 |
| PF12802 | MarR_2 | 0.37 |
| PF00440 | TetR_N | 0.37 |
| PF13646 | HEAT_2 | 0.37 |
| PF02771 | Acyl-CoA_dh_N | 0.37 |
| PF04954 | SIP | 0.37 |
| PF04978 | DUF664 | 0.37 |
| PF08922 | DUF1905 | 0.37 |
| PF01609 | DDE_Tnp_1 | 0.37 |
| PF13466 | STAS_2 | 0.37 |
| PF00392 | GntR | 0.37 |
| PF12728 | HTH_17 | 0.37 |
| PF06974 | WS_DGAT_C | 0.37 |
| PF00378 | ECH_1 | 0.37 |
| PF09137 | Glucodextran_N | 0.37 |
| COG ID | Name | Functional Category | % Frequency in 270 Family Scaffolds |
|---|---|---|---|
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 2.96 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.48 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.48 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 1.48 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.74 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.74 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.74 |
| COG3631 | Ketosteroid isomerase-related protein | General function prediction only [R] | 0.74 |
| COG4308 | Limonene-1,2-epoxide hydrolase LimA/EphG | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.74 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.74 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.74 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.37 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.37 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.37 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.37 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.37 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.37 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.37 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.37 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.37 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.37 |
| COG2375 | NADPH-dependent ferric siderophore reductase, contains FAD-binding and SIP domains | Inorganic ion transport and metabolism [P] | 0.37 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.37 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.37 |
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 0.37 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.93 % |
| Unclassified | root | N/A | 24.07 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_100759271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Sandaracinaceae → Sandaracinus → unclassified Sandaracinus → Sandaracinus sp. | 518 | Open in IMG/M |
| 3300004152|Ga0062386_101578125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 547 | Open in IMG/M |
| 3300004633|Ga0066395_10878719 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300005434|Ga0070709_10032628 | All Organisms → cellular organisms → Bacteria | 3141 | Open in IMG/M |
| 3300005467|Ga0070706_100069440 | All Organisms → cellular organisms → Bacteria | 3258 | Open in IMG/M |
| 3300005471|Ga0070698_100158836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 2206 | Open in IMG/M |
| 3300005526|Ga0073909_10620876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 535 | Open in IMG/M |
| 3300005534|Ga0070735_10654855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 622 | Open in IMG/M |
| 3300005537|Ga0070730_10013573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 6568 | Open in IMG/M |
| 3300005537|Ga0070730_10810661 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300005539|Ga0068853_100178733 | Not Available | 1924 | Open in IMG/M |
| 3300005545|Ga0070695_100367280 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300005577|Ga0068857_100622564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1021 | Open in IMG/M |
| 3300005617|Ga0068859_101336804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 790 | Open in IMG/M |
| 3300005764|Ga0066903_103110057 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300005764|Ga0066903_103829256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 808 | Open in IMG/M |
| 3300005894|Ga0075270_1082980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 514 | Open in IMG/M |
| 3300006028|Ga0070717_10635626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 969 | Open in IMG/M |
| 3300006028|Ga0070717_10685275 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300006175|Ga0070712_100691990 | Not Available | 869 | Open in IMG/M |
| 3300006176|Ga0070765_100496533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1146 | Open in IMG/M |
| 3300006755|Ga0079222_11172516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 684 | Open in IMG/M |
| 3300006844|Ga0075428_100545063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1240 | Open in IMG/M |
| 3300006871|Ga0075434_100698651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 1032 | Open in IMG/M |
| 3300006893|Ga0073928_10243848 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300006903|Ga0075426_11314796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 549 | Open in IMG/M |
| 3300006914|Ga0075436_100289720 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300009011|Ga0105251_10520562 | Not Available | 557 | Open in IMG/M |
| 3300009038|Ga0099829_10528217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 980 | Open in IMG/M |
| 3300009137|Ga0066709_102294393 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300009143|Ga0099792_10902648 | Not Available | 585 | Open in IMG/M |
| 3300009520|Ga0116214_1008366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3680 | Open in IMG/M |
| 3300009521|Ga0116222_1352233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 638 | Open in IMG/M |
| 3300009522|Ga0116218_1368523 | Not Available | 642 | Open in IMG/M |
| 3300009545|Ga0105237_10988244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 848 | Open in IMG/M |
| 3300009700|Ga0116217_10097577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. Ag82_O1-15 | 2016 | Open in IMG/M |
| 3300009700|Ga0116217_10490301 | Not Available | 773 | Open in IMG/M |
| 3300009792|Ga0126374_11138671 | Not Available | 621 | Open in IMG/M |
| 3300009792|Ga0126374_11267034 | Not Available | 594 | Open in IMG/M |
| 3300010048|Ga0126373_11757291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 684 | Open in IMG/M |
| 3300010048|Ga0126373_12365231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 591 | Open in IMG/M |
| 3300010048|Ga0126373_12387143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 589 | Open in IMG/M |
| 3300010358|Ga0126370_10134589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1776 | Open in IMG/M |
| 3300010358|Ga0126370_10605115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 947 | Open in IMG/M |
| 3300010358|Ga0126370_11038549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 751 | Open in IMG/M |
| 3300010358|Ga0126370_11954083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 572 | Open in IMG/M |
| 3300010359|Ga0126376_10150401 | Not Available | 1864 | Open in IMG/M |
| 3300010360|Ga0126372_12477434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 570 | Open in IMG/M |
| 3300010361|Ga0126378_11713139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 714 | Open in IMG/M |
| 3300010366|Ga0126379_11831686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 711 | Open in IMG/M |
| 3300010373|Ga0134128_10292587 | All Organisms → cellular organisms → Bacteria | 1825 | Open in IMG/M |
| 3300010376|Ga0126381_101483919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 980 | Open in IMG/M |
| 3300010376|Ga0126381_103859483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 585 | Open in IMG/M |
| 3300010376|Ga0126381_103979247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 575 | Open in IMG/M |
| 3300010396|Ga0134126_11239297 | Not Available | 828 | Open in IMG/M |
| 3300010399|Ga0134127_13290097 | Not Available | 528 | Open in IMG/M |
| 3300010863|Ga0124850_1023858 | Not Available | 1964 | Open in IMG/M |
| 3300010869|Ga0126359_1368133 | Not Available | 523 | Open in IMG/M |
| 3300010880|Ga0126350_12187453 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300011269|Ga0137392_11527024 | Not Available | 527 | Open in IMG/M |
| 3300012201|Ga0137365_10535807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 860 | Open in IMG/M |
| 3300012202|Ga0137363_10770412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 816 | Open in IMG/M |
| 3300012207|Ga0137381_10036703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3985 | Open in IMG/M |
| 3300012210|Ga0137378_11645672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 550 | Open in IMG/M |
| 3300012349|Ga0137387_10299594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1162 | Open in IMG/M |
| 3300012350|Ga0137372_10158696 | Not Available | 1841 | Open in IMG/M |
| 3300012356|Ga0137371_10047848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 3305 | Open in IMG/M |
| 3300012356|Ga0137371_10154078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1802 | Open in IMG/M |
| 3300012356|Ga0137371_10428980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1024 | Open in IMG/M |
| 3300012357|Ga0137384_10247054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1489 | Open in IMG/M |
| 3300012404|Ga0134024_1023207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 530 | Open in IMG/M |
| 3300012944|Ga0137410_12079523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
| 3300012948|Ga0126375_10305946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1106 | Open in IMG/M |
| 3300012985|Ga0164308_10944983 | Not Available | 762 | Open in IMG/M |
| 3300012989|Ga0164305_12225512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 505 | Open in IMG/M |
| 3300013832|Ga0120132_1051763 | Not Available | 796 | Open in IMG/M |
| 3300014838|Ga0182030_11000478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 736 | Open in IMG/M |
| 3300016319|Ga0182033_10804614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 828 | Open in IMG/M |
| 3300016341|Ga0182035_10114174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2008 | Open in IMG/M |
| 3300016341|Ga0182035_11142302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 694 | Open in IMG/M |
| 3300016357|Ga0182032_10694532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 854 | Open in IMG/M |
| 3300016422|Ga0182039_12206888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 508 | Open in IMG/M |
| 3300017924|Ga0187820_1050139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1127 | Open in IMG/M |
| 3300017932|Ga0187814_10242551 | Not Available | 682 | Open in IMG/M |
| 3300017938|Ga0187854_10199430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 885 | Open in IMG/M |
| 3300017942|Ga0187808_10438724 | Not Available | 600 | Open in IMG/M |
| 3300017970|Ga0187783_10049950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3087 | Open in IMG/M |
| 3300017970|Ga0187783_10333090 | Not Available | 1105 | Open in IMG/M |
| 3300017975|Ga0187782_10835394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 713 | Open in IMG/M |
| 3300017975|Ga0187782_10959698 | Not Available | 664 | Open in IMG/M |
| 3300018060|Ga0187765_10836997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 617 | Open in IMG/M |
| 3300018060|Ga0187765_11080687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 555 | Open in IMG/M |
| 3300018062|Ga0187784_11013042 | Not Available | 660 | Open in IMG/M |
| 3300020021|Ga0193726_1037471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2371 | Open in IMG/M |
| 3300020582|Ga0210395_10205983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1475 | Open in IMG/M |
| 3300020582|Ga0210395_11002846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 618 | Open in IMG/M |
| 3300020582|Ga0210395_11298340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 533 | Open in IMG/M |
| 3300020583|Ga0210401_10495662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1084 | Open in IMG/M |
| 3300021171|Ga0210405_10587847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 868 | Open in IMG/M |
| 3300021171|Ga0210405_10708493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 777 | Open in IMG/M |
| 3300021181|Ga0210388_10465388 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300021401|Ga0210393_10204418 | Not Available | 1597 | Open in IMG/M |
| 3300021402|Ga0210385_10521484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 902 | Open in IMG/M |
| 3300021404|Ga0210389_10028515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 4294 | Open in IMG/M |
| 3300021406|Ga0210386_10714486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 863 | Open in IMG/M |
| 3300021407|Ga0210383_10458355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1101 | Open in IMG/M |
| 3300021407|Ga0210383_11566966 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300021433|Ga0210391_10272395 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300021439|Ga0213879_10194666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 601 | Open in IMG/M |
| 3300021474|Ga0210390_10878360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 738 | Open in IMG/M |
| 3300021477|Ga0210398_10263709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1404 | Open in IMG/M |
| 3300021478|Ga0210402_11986632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 507 | Open in IMG/M |
| 3300021560|Ga0126371_11447686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 817 | Open in IMG/M |
| 3300022522|Ga0242659_1031989 | Not Available | 864 | Open in IMG/M |
| 3300024331|Ga0247668_1033650 | Not Available | 1050 | Open in IMG/M |
| 3300025134|Ga0207416_1046152 | All Organisms → cellular organisms → Bacteria | 1867 | Open in IMG/M |
| 3300025320|Ga0209171_10197333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1138 | Open in IMG/M |
| 3300025320|Ga0209171_10525957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 582 | Open in IMG/M |
| 3300025627|Ga0208220_1065984 | Not Available | 1027 | Open in IMG/M |
| 3300025898|Ga0207692_10260140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1043 | Open in IMG/M |
| 3300025910|Ga0207684_10064231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3116 | Open in IMG/M |
| 3300025911|Ga0207654_10794231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 683 | Open in IMG/M |
| 3300025915|Ga0207693_10608364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 850 | Open in IMG/M |
| 3300025916|Ga0207663_10642379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 837 | Open in IMG/M |
| 3300025916|Ga0207663_10659711 | Not Available | 826 | Open in IMG/M |
| 3300025916|Ga0207663_11051483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 654 | Open in IMG/M |
| 3300025922|Ga0207646_10020039 | Not Available | 6203 | Open in IMG/M |
| 3300025928|Ga0207700_10045008 | Not Available | 3253 | Open in IMG/M |
| 3300026078|Ga0207702_11149863 | Not Available | 770 | Open in IMG/M |
| 3300026095|Ga0207676_12338744 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300026116|Ga0207674_11085853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 770 | Open in IMG/M |
| 3300026121|Ga0207683_10502835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1119 | Open in IMG/M |
| 3300026490|Ga0257153_1057265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 794 | Open in IMG/M |
| 3300026498|Ga0257156_1055967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 813 | Open in IMG/M |
| 3300027096|Ga0208099_1051640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 586 | Open in IMG/M |
| 3300027119|Ga0209522_1034876 | Not Available | 619 | Open in IMG/M |
| 3300027590|Ga0209116_1071795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 755 | Open in IMG/M |
| 3300027604|Ga0208324_1008866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3341 | Open in IMG/M |
| 3300027696|Ga0208696_1011720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3534 | Open in IMG/M |
| 3300027725|Ga0209178_1286967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 603 | Open in IMG/M |
| 3300027765|Ga0209073_10158966 | Not Available | 839 | Open in IMG/M |
| 3300027765|Ga0209073_10261919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 675 | Open in IMG/M |
| 3300027812|Ga0209656_10479085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 547 | Open in IMG/M |
| 3300027855|Ga0209693_10092929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1492 | Open in IMG/M |
| 3300027857|Ga0209166_10311653 | Not Available | 827 | Open in IMG/M |
| 3300027889|Ga0209380_10843256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 517 | Open in IMG/M |
| 3300027905|Ga0209415_10326926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1297 | Open in IMG/M |
| 3300027908|Ga0209006_10864807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 728 | Open in IMG/M |
| 3300027915|Ga0209069_10465376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 705 | Open in IMG/M |
| 3300028379|Ga0268266_10538634 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300028801|Ga0302226_10417515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 561 | Open in IMG/M |
| 3300028828|Ga0307312_10703232 | Not Available | 669 | Open in IMG/M |
| 3300028906|Ga0308309_10130555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1994 | Open in IMG/M |
| 3300028906|Ga0308309_11401904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 599 | Open in IMG/M |
| 3300029882|Ga0311368_10917957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 585 | Open in IMG/M |
| 3300029943|Ga0311340_10097617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3248 | Open in IMG/M |
| 3300029997|Ga0302302_1248603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 655 | Open in IMG/M |
| 3300029999|Ga0311339_10807723 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300030057|Ga0302176_10208495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 780 | Open in IMG/M |
| 3300030399|Ga0311353_10667583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 901 | Open in IMG/M |
| 3300030399|Ga0311353_11456637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 556 | Open in IMG/M |
| 3300030503|Ga0311370_11839566 | Not Available | 613 | Open in IMG/M |
| 3300030520|Ga0311372_10419116 | Not Available | 2017 | Open in IMG/M |
| 3300030618|Ga0311354_10819427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 876 | Open in IMG/M |
| 3300030718|Ga0307919_1018910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 934 | Open in IMG/M |
| 3300030730|Ga0307482_1285920 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300031090|Ga0265760_10369754 | Not Available | 515 | Open in IMG/M |
| 3300031234|Ga0302325_13081061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 536 | Open in IMG/M |
| 3300031525|Ga0302326_10171798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3683 | Open in IMG/M |
| 3300031546|Ga0318538_10409244 | Not Available | 734 | Open in IMG/M |
| 3300031564|Ga0318573_10701534 | Not Available | 544 | Open in IMG/M |
| 3300031640|Ga0318555_10114579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1429 | Open in IMG/M |
| 3300031640|Ga0318555_10574267 | Not Available | 611 | Open in IMG/M |
| 3300031679|Ga0318561_10279250 | Not Available | 912 | Open in IMG/M |
| 3300031681|Ga0318572_10483764 | Not Available | 737 | Open in IMG/M |
| 3300031708|Ga0310686_104286388 | Not Available | 1149 | Open in IMG/M |
| 3300031719|Ga0306917_11209314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 586 | Open in IMG/M |
| 3300031723|Ga0318493_10038633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2209 | Open in IMG/M |
| 3300031723|Ga0318493_10232746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 980 | Open in IMG/M |
| 3300031724|Ga0318500_10578323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 568 | Open in IMG/M |
| 3300031724|Ga0318500_10604882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 556 | Open in IMG/M |
| 3300031736|Ga0318501_10223925 | Not Available | 990 | Open in IMG/M |
| 3300031744|Ga0306918_11238957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 575 | Open in IMG/M |
| 3300031747|Ga0318502_10136134 | Not Available | 1391 | Open in IMG/M |
| 3300031747|Ga0318502_10700469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 612 | Open in IMG/M |
| 3300031751|Ga0318494_10895168 | Not Available | 520 | Open in IMG/M |
| 3300031751|Ga0318494_10954171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 504 | Open in IMG/M |
| 3300031765|Ga0318554_10089755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1721 | Open in IMG/M |
| 3300031765|Ga0318554_10175093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1220 | Open in IMG/M |
| 3300031765|Ga0318554_10250159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1009 | Open in IMG/M |
| 3300031765|Ga0318554_10577736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 634 | Open in IMG/M |
| 3300031768|Ga0318509_10392671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 776 | Open in IMG/M |
| 3300031768|Ga0318509_10562796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 636 | Open in IMG/M |
| 3300031769|Ga0318526_10321534 | Not Available | 633 | Open in IMG/M |
| 3300031771|Ga0318546_10151193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1565 | Open in IMG/M |
| 3300031778|Ga0318498_10017335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 3006 | Open in IMG/M |
| 3300031779|Ga0318566_10206619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microtetraspora | 975 | Open in IMG/M |
| 3300031779|Ga0318566_10244999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 889 | Open in IMG/M |
| 3300031781|Ga0318547_10173561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1278 | Open in IMG/M |
| 3300031782|Ga0318552_10247383 | Not Available | 904 | Open in IMG/M |
| 3300031792|Ga0318529_10306339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 739 | Open in IMG/M |
| 3300031795|Ga0318557_10006858 | Not Available | 3992 | Open in IMG/M |
| 3300031796|Ga0318576_10583301 | Not Available | 527 | Open in IMG/M |
| 3300031797|Ga0318550_10494685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 590 | Open in IMG/M |
| 3300031798|Ga0318523_10048727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1985 | Open in IMG/M |
| 3300031798|Ga0318523_10288774 | Not Available | 818 | Open in IMG/M |
| 3300031799|Ga0318565_10443322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 628 | Open in IMG/M |
| 3300031819|Ga0318568_10393069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 864 | Open in IMG/M |
| 3300031819|Ga0318568_10673818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 643 | Open in IMG/M |
| 3300031819|Ga0318568_10953331 | Not Available | 530 | Open in IMG/M |
| 3300031833|Ga0310917_11070477 | Not Available | 539 | Open in IMG/M |
| 3300031833|Ga0310917_11176662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
| 3300031859|Ga0318527_10259439 | Not Available | 739 | Open in IMG/M |
| 3300031879|Ga0306919_10853670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 699 | Open in IMG/M |
| 3300031890|Ga0306925_11061543 | Not Available | 821 | Open in IMG/M |
| 3300031893|Ga0318536_10134950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1251 | Open in IMG/M |
| 3300031894|Ga0318522_10388733 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300031896|Ga0318551_10629022 | Not Available | 620 | Open in IMG/M |
| 3300031896|Ga0318551_10659110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 605 | Open in IMG/M |
| 3300031896|Ga0318551_10918733 | Not Available | 511 | Open in IMG/M |
| 3300031897|Ga0318520_10188773 | Not Available | 1211 | Open in IMG/M |
| 3300031897|Ga0318520_10397100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 842 | Open in IMG/M |
| 3300031897|Ga0318520_10525749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 732 | Open in IMG/M |
| 3300031912|Ga0306921_12364631 | Not Available | 555 | Open in IMG/M |
| 3300031941|Ga0310912_10898350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 682 | Open in IMG/M |
| 3300031941|Ga0310912_11448224 | Not Available | 518 | Open in IMG/M |
| 3300031942|Ga0310916_10434357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1118 | Open in IMG/M |
| 3300031942|Ga0310916_11178209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 634 | Open in IMG/M |
| 3300031942|Ga0310916_11279234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 604 | Open in IMG/M |
| 3300031945|Ga0310913_10779567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 675 | Open in IMG/M |
| 3300031946|Ga0310910_10913744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 688 | Open in IMG/M |
| 3300031947|Ga0310909_10195199 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
| 3300031954|Ga0306926_10920313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1046 | Open in IMG/M |
| 3300032001|Ga0306922_11198347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 773 | Open in IMG/M |
| 3300032008|Ga0318562_10436080 | Not Available | 761 | Open in IMG/M |
| 3300032009|Ga0318563_10557348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 619 | Open in IMG/M |
| 3300032010|Ga0318569_10123856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1179 | Open in IMG/M |
| 3300032035|Ga0310911_10790593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 549 | Open in IMG/M |
| 3300032043|Ga0318556_10184642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1083 | Open in IMG/M |
| 3300032043|Ga0318556_10336695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 789 | Open in IMG/M |
| 3300032044|Ga0318558_10364790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 717 | Open in IMG/M |
| 3300032052|Ga0318506_10004932 | All Organisms → cellular organisms → Bacteria | 4040 | Open in IMG/M |
| 3300032052|Ga0318506_10417092 | Not Available | 595 | Open in IMG/M |
| 3300032060|Ga0318505_10371868 | Not Available | 675 | Open in IMG/M |
| 3300032060|Ga0318505_10450129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 608 | Open in IMG/M |
| 3300032060|Ga0318505_10459926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 601 | Open in IMG/M |
| 3300032065|Ga0318513_10267071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 830 | Open in IMG/M |
| 3300032065|Ga0318513_10515188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 585 | Open in IMG/M |
| 3300032067|Ga0318524_10358710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 757 | Open in IMG/M |
| 3300032067|Ga0318524_10419635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 698 | Open in IMG/M |
| 3300032067|Ga0318524_10556306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 603 | Open in IMG/M |
| 3300032068|Ga0318553_10264989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 898 | Open in IMG/M |
| 3300032160|Ga0311301_13001952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 507 | Open in IMG/M |
| 3300032180|Ga0307471_100201978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1990 | Open in IMG/M |
| 3300032770|Ga0335085_11043051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 880 | Open in IMG/M |
| 3300032783|Ga0335079_10173171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2409 | Open in IMG/M |
| 3300032783|Ga0335079_11284116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 732 | Open in IMG/M |
| 3300032892|Ga0335081_11323502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 811 | Open in IMG/M |
| 3300032892|Ga0335081_12150435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 589 | Open in IMG/M |
| 3300032895|Ga0335074_11305349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 599 | Open in IMG/M |
| 3300032896|Ga0335075_10075185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4552 | Open in IMG/M |
| 3300032896|Ga0335075_11424297 | Not Available | 582 | Open in IMG/M |
| 3300032896|Ga0335075_11548920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 548 | Open in IMG/M |
| 3300032898|Ga0335072_10323848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1708 | Open in IMG/M |
| 3300032898|Ga0335072_10927717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 811 | Open in IMG/M |
| 3300032898|Ga0335072_11403062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 604 | Open in IMG/M |
| 3300033004|Ga0335084_10444013 | Not Available | 1335 | Open in IMG/M |
| 3300033158|Ga0335077_11426688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 666 | Open in IMG/M |
| 3300033289|Ga0310914_10350443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1335 | Open in IMG/M |
| 3300033828|Ga0334850_052475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 767 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 35.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.56% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.19% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.19% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.44% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.33% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.22% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.85% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.48% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.48% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.48% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.48% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.48% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.11% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.11% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.74% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.74% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.74% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.37% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.37% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.37% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.37% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.37% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.37% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.37% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.37% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.37% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.37% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.37% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.37% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005894 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_203 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012404 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025134 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
| 3300027119 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029997 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030718 | Metatranscriptome of soil microbial communities from Risofladan, Vaasa, Finland - OX-1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033828 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P1 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1007592711 | 3300000559 | Soil | SRLREVLAGRGLGQDQMSPKAYWGRGRANASHGEPARDT* |
| Ga0062386_1015781251 | 3300004152 | Bog Forest Soil | TVATLRDAFAARGLAPAQISPKAYWGRGRANASHGEPARS* |
| Ga0066395_108787191 | 3300004633 | Tropical Forest Soil | RGHAYLAGEATVVLRLRERLAARGLAPEQISPKAYWGRGRANASHGEPAKDG* |
| Ga0070709_100326283 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | YLLGEARVVSRLREVMADRGLPGSQVSPKAYWGRGKANASHGEPAKDS* |
| Ga0070706_1000694404 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | PLPAGLGHAYLLGEARVVARLREVLAGRGIRPDQISPKAYWGRGRANASHGEPAKDS* |
| Ga0070698_1001588363 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LAGEARQVLALREAVAALGLAPDQVSPKAYWGLGRANAAHGEPARD* |
| Ga0073909_106208761 | 3300005526 | Surface Soil | GEATVVSRLREVLAGRGLAQDQMSPKAYWGRGRANAGHGEPARDT* |
| Ga0070735_106548551 | 3300005534 | Surface Soil | FGEAKAVLALREMVANRGLAADQVSPKAYWGRGKANASHGEPARDS* |
| Ga0070730_100135736 | 3300005537 | Surface Soil | VLAGRGLGQDQMSPKAYWGRGRANASHGEPARDA* |
| Ga0070730_108106611 | 3300005537 | Surface Soil | REVLAGRGLGQDQMSPKAYWGRGRANASHGEPARDT* |
| Ga0068853_1001787331 | 3300005539 | Corn Rhizosphere | VVSRLREVLAGRGLGQDQMSPKAYWGRGRANAGHGEPARDT* |
| Ga0070695_1003672802 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | HCYLFGEAKVVLRLREVLAARGLADGQVSAKAYWGRGRANAQHGEPARDS* |
| Ga0068857_1006225641 | 3300005577 | Corn Rhizosphere | VLRLREVLAARGLADGQVSAKAYWGRGRANAQHGEPARDS* |
| Ga0068859_1013368042 | 3300005617 | Switchgrass Rhizosphere | EAKVVLRLREVLAARGLADGQVSAKAYWGRGRANAQHGEPARDS* |
| Ga0066903_1031100571 | 3300005764 | Tropical Forest Soil | AGHAYLAGEARLVLALREALAARGLDGDQVSPKAYWGLGKANAAHGEPARDG* |
| Ga0066903_1038292561 | 3300005764 | Tropical Forest Soil | LREALAARGLDGDQVSPKAYWGLGKANAAHGEPARDS* |
| Ga0075270_10829802 | 3300005894 | Rice Paddy Soil | AVLAMREVIAARGLPPEQVSAKAYWGRGRANAPHGEPAKD* |
| Ga0070717_106356261 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GEARVVSRLREILAERGLGQDQMSPKAYWGRGRANAGHGEPARDA* |
| Ga0070717_106852751 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GHCYLFGEAKVVLRLREVLAARGLGDGQVSAKAYWGRGRANAQHGEPARDG* |
| Ga0070712_1006919902 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | EVMADRGLPGSQVSPKAYWGRGKANASHGEPAKDG* |
| Ga0070765_1004965331 | 3300006176 | Soil | REVLAGRGLGQDQMSPKAYWGRGRANASHGEPARDA* |
| Ga0079222_111725161 | 3300006755 | Agricultural Soil | EALAARGLPGDQVSPKAYWGLGKANAAHGEPPRD* |
| Ga0075428_1005450633 | 3300006844 | Populus Rhizosphere | LALRDAVQARGLAPEQVSPKAYWGRGRANAVHGEPAKDA* |
| Ga0075434_1006986513 | 3300006871 | Populus Rhizosphere | REVLAGRGLGQDQMSPKAYWGRGRANAGHGEPARDT* |
| Ga0073928_102438483 | 3300006893 | Iron-Sulfur Acid Spring | EARVVSALRETLQARGLEPAQLSPKAYWGRGKANASHGEPAKDG* |
| Ga0075426_113147962 | 3300006903 | Populus Rhizosphere | VLALREALAARGLDGDQVSPKAYWGLGKANAAHGEPAREA* |
| Ga0075436_1002897201 | 3300006914 | Populus Rhizosphere | GHAYLAGEARQVLALREAVAARGLTPDQVSPKAYWGLGRANAAHGEPARD* |
| Ga0105251_105205621 | 3300009011 | Switchgrass Rhizosphere | RLREVMADRGLPGSQVSPKAYWGRGKANASHGEPAKDS* |
| Ga0099829_105282171 | 3300009038 | Vadose Zone Soil | RVVARLREVLAARGLGPDQVSPKAYWGRGRANAGHGEPAKDA* |
| Ga0066709_1022943931 | 3300009137 | Grasslands Soil | GHAYLAGEARVVLALRDAVQARGLAPEQVSPKAYWGRGRANATHGEPAKDA* |
| Ga0099792_109026482 | 3300009143 | Vadose Zone Soil | TVVSRLREILAGRGLGQDQMSPKAYWGRGRANASHGEPARDA* |
| Ga0116214_10083666 | 3300009520 | Peatlands Soil | RLREVLAERGFGQDQMSPKAYWGRGRANASHGEPARDA* |
| Ga0116222_13522332 | 3300009521 | Peatlands Soil | LREVLAERGFGQDQMSPKAYWGRGRANASHGEPARDA* |
| Ga0116218_13685231 | 3300009522 | Peatlands Soil | VVSRLREILAERGLGQDQMSPKAYWGRGRANASHGEPARDA* |
| Ga0105237_109882441 | 3300009545 | Corn Rhizosphere | HAYLAGEATVVLRLRETLAARGLAPEQMSPKAYWGRGRANASHGEPARDG* |
| Ga0116217_100975775 | 3300009700 | Peatlands Soil | RLREVLAGRGLGQDQMSPKAYWGRGRGNASHGEPARDA* |
| Ga0116217_104903012 | 3300009700 | Peatlands Soil | FGEATVVSRLREVLAGRGLGQDQMSPKAYWGRGRANASHGEPARDA* |
| Ga0126374_111386711 | 3300009792 | Tropical Forest Soil | LLGEASVVLAMRERLAARGLPQDQMSPKAYWGRGRANAGHGEPAKDA* |
| Ga0126374_112670342 | 3300009792 | Tropical Forest Soil | ARVVSRLRDVMAERGLPGSQVSPKAYWGRGKANASHGEPAKDS* |
| Ga0126373_117572911 | 3300010048 | Tropical Forest Soil | REVLAERGLGQDQMSPKAYWGRGRANASHGEPARDA* |
| Ga0126373_123652312 | 3300010048 | Tropical Forest Soil | GNGHAYLLGEAKVVLAMREVLASRGLPQEHMSPKAYWGRGRANAGHGEPARDAR* |
| Ga0126373_123871431 | 3300010048 | Tropical Forest Soil | VVSAVRGVLGEQGLADDQVSPKAYWGRGRANAGHGEPARDA* |
| Ga0126370_101345891 | 3300010358 | Tropical Forest Soil | GEATVVLRLRETLAARGLAPEQISPKAYWGRGKANAAHGEPAKDA* |
| Ga0126370_106051151 | 3300010358 | Tropical Forest Soil | NGHAYLLGEAKVVLAVREVLASRGLPQERMSPKAYWGRGRANAGHGEPARDA* |
| Ga0126370_110385491 | 3300010358 | Tropical Forest Soil | AYVFAEASVVNAVRDALIGRGLAPEQISPKAYWGRGRANASHGEPLKA* |
| Ga0126370_119540831 | 3300010358 | Tropical Forest Soil | GEATVVLRLRETLAARGLAPEQISPKAYWGRGRANASHGEPAKDG* |
| Ga0126376_101504011 | 3300010359 | Tropical Forest Soil | AGEARLVLALREALAARGMPGDRVSPKAYWGLGKANAAHGEPAKDG* |
| Ga0126372_124774341 | 3300010360 | Tropical Forest Soil | ARLVLALREALAARGMPSDRVSPKAYCGLGKANAPHGEPAKDG* |
| Ga0126378_117131392 | 3300010361 | Tropical Forest Soil | GEAKLVLALREVLAGRGMQAGQVSPKAYWGLGRANAPHGEPPKE* |
| Ga0126379_118316861 | 3300010366 | Tropical Forest Soil | REVLGARGLPQDQISPKAYWGRGRANAGHGEPARDA* |
| Ga0134128_102925871 | 3300010373 | Terrestrial Soil | SRLREVLAGRGLGQDQMSPKAYWGRGRANAGHGEPARDT* |
| Ga0126381_1014839191 | 3300010376 | Tropical Forest Soil | PAGSGHAYLLGEASVVLALRERLTARGLPPDQMSPKAYWGRGRANAGHGEPARDS* |
| Ga0126381_1038594832 | 3300010376 | Tropical Forest Soil | RLREILASRGLPEEQMSPKAYWGRGRANAGHGEPARDA* |
| Ga0126381_1039792472 | 3300010376 | Tropical Forest Soil | ATVVLRLRETLAARGLAPEQMSPKAYWGRGRANASHGEPAKDG* |
| Ga0134126_112392972 | 3300010396 | Terrestrial Soil | PAGHGHVYLLGEARVVSRLREVMAGRGLPGSQVSPKAYWGRGKANASHGEPAKDS* |
| Ga0134127_132900972 | 3300010399 | Terrestrial Soil | YLFGEAKVVLRLREVLAARGLADGQVSAKAYWGRGRANAQHGEPARDS* |
| Ga0124850_10238581 | 3300010863 | Tropical Forest Soil | YLAGEARQVLALREALAARGLEGDQVSPKAYWGLGKANAAHGEPARDG* |
| Ga0126359_13681332 | 3300010869 | Boreal Forest Soil | EVLAARGVPGEQVSAKAYWGRGKANAQHGEPARDG* |
| Ga0126350_121874532 | 3300010880 | Boreal Forest Soil | VSRLREILAERGLGQDQMSPKAYWGRGRANASHGEPARDA* |
| Ga0137392_115270243 | 3300011269 | Vadose Zone Soil | VSRLREVLAERGLGQDQMSPKAYWGRGRANASHGEPARDA* |
| Ga0137365_105358071 | 3300012201 | Vadose Zone Soil | EVLAGRGLGQDQMSPKAYWGRGRANASHGEPARDT* |
| Ga0137363_107704122 | 3300012202 | Vadose Zone Soil | ASVVLALRERLGARGLTPEQISPKAYWGRGRANAGHGEPARDS* |
| Ga0137381_100367031 | 3300012207 | Vadose Zone Soil | VSRLRETLAARGLGQDQISPKAYWGRGRGNAGHGEPAKQG* |
| Ga0137378_116456722 | 3300012210 | Vadose Zone Soil | AGEAGQVLALRAALAARGLPADQVSPKAYWGLGRANAAHGEPARD* |
| Ga0137387_102995942 | 3300012349 | Vadose Zone Soil | EATVVSRLRDVLAGRGLGRDQMSPKAYWGRGRANASHGEPARDT* |
| Ga0137372_101586961 | 3300012350 | Vadose Zone Soil | ALRGALQARGLGPEQISPKAYWGRGRANAAHGEPAKDA* |
| Ga0137371_100478485 | 3300012356 | Vadose Zone Soil | GEATVVSRLREVLAGRGLGQDQMSPKAYWGRGRANASHGEPTRDT* |
| Ga0137371_101540783 | 3300012356 | Vadose Zone Soil | GEATVVSRLREVLAGRGLGQDQMSPKAYWGRGRANASHGEPARDT* |
| Ga0137371_104289802 | 3300012356 | Vadose Zone Soil | YLAGEARMVLALRGALQARGLGPEQISPKAYWGRGRANAAHGEPAKDA* |
| Ga0137384_102470541 | 3300012357 | Vadose Zone Soil | RLRDVLAGRGLGRDQMSPKAYWGRGRANASHGEPARDT* |
| Ga0134024_10232072 | 3300012404 | Grasslands Soil | GEATVVSRLREVLAGRGLSQDQISPKAYWGRGRANASHGEPARDT* |
| Ga0137410_120795232 | 3300012944 | Vadose Zone Soil | EVLAARGVPGEQVSAKAYWGRGKANAQHGEPAREG* |
| Ga0126375_103059462 | 3300012948 | Tropical Forest Soil | ALREAVAARGLGGDQVSPKAYWGLGKANAAHGEPAKDG* |
| Ga0164308_109449833 | 3300012985 | Soil | EATVVSRLREVLAGRGLGQDQMSPKAYWGRGRANASHGEPARDA* |
| Ga0164305_122255121 | 3300012989 | Soil | EATVVLRLRETLAARGLAPEQMSPKAYWGRGRANASHGEPARDG* |
| Ga0120132_10517632 | 3300013832 | Permafrost | VLALREVLAARGVPGEQVSAKAYWGRGKANAQHGEPARDS* |
| Ga0182030_110004781 | 3300014838 | Bog | RLREVLAGRGFGQDQMSPKAYWGRGRDNASHGEPARDA* |
| Ga0182033_108046142 | 3300016319 | Soil | EARLVLALREAVAARGLGGDQVSPKAYWGLGKANAAHGEPARDS |
| Ga0182035_101141744 | 3300016341 | Soil | VSRLREVLAGRGLGQHQMSPKAYWGRGRANAGHGEPARDA |
| Ga0182035_111423021 | 3300016341 | Soil | VVSRLREVLAERGLDQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0182032_106945321 | 3300016357 | Soil | LALRETLAARGMPADRTSPKAYWGLGKANAAHGEPAKEG |
| Ga0182039_122068881 | 3300016422 | Soil | RLVLALREALAARGLPADQVSPKAYWGLGRANAFHGEPARD |
| Ga0187820_10501392 | 3300017924 | Freshwater Sediment | EVLAGRGLGQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0187814_102425511 | 3300017932 | Freshwater Sediment | YLFGEATVVSRLREVLAGRGLGQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0187854_101994302 | 3300017938 | Peatland | SVVLRLREVLAGRGLPEAQMSPKAYWGRGRANAGHGEPARDA |
| Ga0187808_104387242 | 3300017942 | Freshwater Sediment | VSRLREVLAGRGLGQDQMSPKAYWGRGRGNASHGEPARDA |
| Ga0187783_100499503 | 3300017970 | Tropical Peatland | YLSGEATVVSRLREVLAGRGLGQDQISPKAYWGRGRANASHGEPARDA |
| Ga0187783_103330902 | 3300017970 | Tropical Peatland | EILAGRGLGQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0187782_108353943 | 3300017975 | Tropical Peatland | ATVVSRLREVLAGRGLGQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0187782_109596981 | 3300017975 | Tropical Peatland | TVVSRLREVLAGRGLGQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0187765_108369971 | 3300018060 | Tropical Peatland | LREALAARGLAPEQISPKAYWGRGRANASHGEPARDG |
| Ga0187765_110806872 | 3300018060 | Tropical Peatland | GHAYLAGEATVVLRLREALAARGLAPEQMSPKAYWGRGRANASHGEPAKDG |
| Ga0187784_110130421 | 3300018062 | Tropical Peatland | YLLGEARVVLAMREVLARRGLAEDQISPKAYWGRGRANAGHGEPARDA |
| Ga0193726_10374713 | 3300020021 | Soil | REVLADRGFAVDQISPKAYWGRGKANASHGEPAKDA |
| Ga0210395_102059832 | 3300020582 | Soil | KVVLRLREILADRGLGEDQMSPKAYWGRGRANASHGEPARDA |
| Ga0210395_110028461 | 3300020582 | Soil | AGVTPPPQGGHAYLAGEARLVLALREALAARGLADGQVSPKAYWGLGRANAAHGEPARDG |
| Ga0210395_112983401 | 3300020582 | Soil | FGEAKVVLRLREILADRGLGEDQMSPKAYWGRGRANASHGEPARDA |
| Ga0210401_104956621 | 3300020583 | Soil | AYLLGEASMVLALRERLASRGLPQDQMSPKAYWGRGRANAGHGEPARDA |
| Ga0210405_105878471 | 3300021171 | Soil | GRGHAYLSGEATVVSRLREVLAGRGLGQDQISPKAYWGRGRANASHGEPPRDT |
| Ga0210405_107084932 | 3300021171 | Soil | ALREALAARGLADGQVSPKAYWGLGRANAAHGEPARDG |
| Ga0210388_104653881 | 3300021181 | Soil | EVLAERGLGQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0210393_102044183 | 3300021401 | Soil | REVLAGRGLSQDQMSPKAYWGRGRANAGHGEPARDA |
| Ga0210385_105214841 | 3300021402 | Soil | AYLLGEAKVVLQLRDVLAGRGIRPEQMSPKAYWGLGRANAGHGEPARDA |
| Ga0210389_100285154 | 3300021404 | Soil | LREVLASRGLPQDQMSPKAYWGRGRANAGHGEPARDA |
| Ga0210386_107144862 | 3300021406 | Soil | VVSRLREVLAGRGLSQDQMSPKAYWGRGRANAGHGEPARDV |
| Ga0210383_104583551 | 3300021407 | Soil | REVLAARGVPGEQVSAKAYWGRGKANAQHGEPARDG |
| Ga0210383_115669662 | 3300021407 | Soil | LFGEATVVSRLREVLAERGLSQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0210391_102723951 | 3300021433 | Soil | TVVSRLREVLAERGLGQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0213879_101946661 | 3300021439 | Bulk Soil | LFGEATVVSRLREVLAGRGLGQDQMSPKAYWGRGRANAGHGEPARDA |
| Ga0210390_108783601 | 3300021474 | Soil | KVVLRLREILADRGLGEDQMSPKAYWGRGRANASHGEPARDG |
| Ga0210398_102637091 | 3300021477 | Soil | EILADRGLGEDQMSPKAYWGRGRANASHGEPARDA |
| Ga0210402_119866322 | 3300021478 | Soil | AYLAGEARLVLALREVLAGRGMQAGQMSPKAYWGLGRANAPHGEPPKE |
| Ga0126371_114476862 | 3300021560 | Tropical Forest Soil | EILAARGLRQDQISPKAYWGRGRANAGHGEPAKDV |
| Ga0242659_10319892 | 3300022522 | Soil | REVLAERGLGQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0247668_10336502 | 3300024331 | Soil | LREVMADRGLPGSQVSPKAYWGRGKANASHGEPAKDS |
| Ga0207416_10461521 | 3300025134 | Iron-Sulfur Acid Spring | LREILAERGLGQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0209171_101973333 | 3300025320 | Iron-Sulfur Acid Spring | VSALRETLQARGLEPAQLSPKAYWGRGKANASHGEPAKDG |
| Ga0209171_105259572 | 3300025320 | Iron-Sulfur Acid Spring | RLVLALREALAARGLADAQVSPKAYWGLGRANAAHGEPARDG |
| Ga0208220_10659841 | 3300025627 | Arctic Peat Soil | EARVVLALREALAARGLRQDQMSPKAYWGRGRANAGHGEPARDA |
| Ga0207692_102601402 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | KLVLALREALAARGLPADQVSPKAYWGLGRANASHGEPARD |
| Ga0207684_100642311 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | RLREVLAGRGLGQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0207654_107942312 | 3300025911 | Corn Rhizosphere | REVLAGRGLGQDQMSPKAYWGRGRANAGHGEPARDT |
| Ga0207693_106083641 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | REILEARGLDQDQMSPKAYWGRGRANASHGEPARDG |
| Ga0207663_106423791 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | ALREALAARGLPADQVSPKAYWGLGRANASHGEPARD |
| Ga0207663_106597112 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VVSRLREVMADRGLPGSQVSPKAYWGRGKANASHGEPAKDS |
| Ga0207663_110514832 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | GHAYVFAEAAVVNMCRDKLAERGFAPERVSPKAYWGRGRANASHGEPLK |
| Ga0207646_100200395 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LALREGLTARGLAPEQMSPKAYWGRGRANAGHGEPARDA |
| Ga0207700_100450081 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | RLRDVLADRGLEASQVSPKAYWGRGRANASHGEPAKDS |
| Ga0207702_111498631 | 3300026078 | Corn Rhizosphere | GLGHVYLLGEARVVSRLREVMADRGLPGSQVSPKAYWGRGKANASHGEPAKDS |
| Ga0207676_123387442 | 3300026095 | Switchgrass Rhizosphere | VALARGLAAEQLSPKAYWGRGKSNADNGEPEKTAG |
| Ga0207674_110858531 | 3300026116 | Corn Rhizosphere | VLRLREVLAARGLADGQVSAKAYWGRGRANAQHGEPARDS |
| Ga0207683_105028352 | 3300026121 | Miscanthus Rhizosphere | SRLREVMADRGLPGSQVSPKAYWGRGKANASHGEPAKDS |
| Ga0257153_10572651 | 3300026490 | Soil | GHAYVFGEATVVSRLREVLAKRGLGQDQISPKAYWGRGRANAGHGEPARDA |
| Ga0257156_10559672 | 3300026498 | Soil | RETLAARGLRQDQIAPKAYWGLGRGNAGHGEPSKDV |
| Ga0208099_10516402 | 3300027096 | Forest Soil | AGEAVQVLALREAVAARGLADGQVSPKAYWGLGRANASHGEPARDG |
| Ga0209522_10348761 | 3300027119 | Forest Soil | MAKVVLALREMLANRGLAANQVSPKAYWGRGKANASHGEPARDS |
| Ga0209116_10717951 | 3300027590 | Forest Soil | EASVVLALREVLESRGLRPDQMSPKAYWGRGRANGGHGEPARS |
| Ga0208324_10088661 | 3300027604 | Peatlands Soil | SRLREVLAERGFGQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0208696_10117201 | 3300027696 | Peatlands Soil | EVLAERGFGQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0209178_12869672 | 3300027725 | Agricultural Soil | AGEARLVLALREALAARGLDGDQVSPKAYWGLGKANAAHGEPAREA |
| Ga0209073_101589662 | 3300027765 | Agricultural Soil | SRLREVMAGRGLPGSQVSPKAYWGRGKANASHGEPAKDS |
| Ga0209073_102619191 | 3300027765 | Agricultural Soil | AYLAGEARLVLALREALAARGLPGDQVSPKAYWGLGKANAAHGEPSRD |
| Ga0209656_104790851 | 3300027812 | Bog Forest Soil | TVATLRDAFAARGLAPAQISPKAYWGRGRANASHGEPARS |
| Ga0209693_100929292 | 3300027855 | Soil | VVLRLREILAGRGLAESRMSPKAYWGRGRANAGHGEPARDA |
| Ga0209166_103116532 | 3300027857 | Surface Soil | VVSGLRETLAGRGLRQDQISPKAYWGRGRGNAGHGEPVRPPAASD |
| Ga0209380_108432561 | 3300027889 | Soil | GHAYLLGEASVVLALRERLAARGLPPDQISPKAYWGRGRANAGHGEPAKDA |
| Ga0209415_103269262 | 3300027905 | Peatlands Soil | LFGEAGVVLRLREVLAERGLEPGQVSPKAYWGRGRANAQHGEPARDE |
| Ga0209006_108648071 | 3300027908 | Forest Soil | GSGHAYLLGEASVVLAMRETLAGRGMPQDQMSPKAYWGRGRANAGHGEPARDA |
| Ga0209069_104653761 | 3300027915 | Watersheds | ARMVLLLRDVLESRGLTPDQMSPKAYWGRGRANASHGEPAREA |
| Ga0268266_105386342 | 3300028379 | Switchgrass Rhizosphere | EVLAGRGLGQDQMSPKAYWGRGRANAGHGEPARDT |
| Ga0302226_104175152 | 3300028801 | Palsa | ELLAARGLEPDQVSPKAYWGRGRANASHGEPARNA |
| Ga0307312_107032322 | 3300028828 | Soil | LREVLAGRGLGQDQMSPKAYWGRGRANASHGEPARNA |
| Ga0308309_101305551 | 3300028906 | Soil | VLTLRERLTARGLPSDQMSPKAYWGRGRANAEHGEPARDS |
| Ga0308309_114019041 | 3300028906 | Soil | YLLGEARVVLALREVLAGRGLPQDQMSPKAYWGRGRANGGHGEPARDA |
| Ga0311368_109179572 | 3300029882 | Palsa | AYLLGEAKVVSRLREVLAARGLEPDQVSPKAYWGRGRANASHGEPARDA |
| Ga0311340_100976171 | 3300029943 | Palsa | LRLREVLAEHGLTGDQVSAKAYWGRGRANASHGEPARDG |
| Ga0302302_12486033 | 3300029997 | Palsa | EAKVVSRLREVLAERGLGQDQMSPKAYWGRGRANASHGEPAGDA |
| Ga0311339_108077231 | 3300029999 | Palsa | REVLAERGLDEDQMSPKAYWGRGRANAGHGEPARDS |
| Ga0302176_102084951 | 3300030057 | Palsa | AYLLGEARVVAALRELLAARGLEPDQVSPKAYWGRGRANASHGEPARDA |
| Ga0311353_106675831 | 3300030399 | Palsa | VARLREVLAARGLEPGQVSPKAYWGRGRANASHGEPARDG |
| Ga0311353_114566372 | 3300030399 | Palsa | YLLGEARVVAALRELLAARGLEPDQVSPKAYWGRGRANASHGEPARNA |
| Ga0311370_118395662 | 3300030503 | Palsa | LPPGRGHVSLFGEATVVSRLREVLAGRGLGQDQMSPKAYWGRGRANASHGEPAGDA |
| Ga0311372_104191161 | 3300030520 | Palsa | GAGQAYLLGEARVVLALREVLAGRGLPQDQMSPKAYWGRGRANGGHGEPARDA |
| Ga0311354_108194271 | 3300030618 | Palsa | RGHAYLLGEARVVARLREVLAARGLEPGQVSPKAYWGRGRANASHGEPARDG |
| Ga0307919_10189101 | 3300030718 | Soil | LALREVLAGRGLAQDQMSPKAYWGRGRANSGHGEPARDA |
| Ga0307482_12859201 | 3300030730 | Hardwood Forest Soil | VVSRLREVLAERGLSQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0265760_103697541 | 3300031090 | Soil | FGEATVVSRLREVLAERGLGQDQMSPQAYWGRGRGNASHGEPARDA |
| Ga0302325_130810612 | 3300031234 | Palsa | PGRGHAYLLGEAKVVLRLREILASRGFPPDQMSPKAYWGRGRANAGHGEPARDA |
| Ga0302326_101717981 | 3300031525 | Palsa | GRGAGAAAPGLAGDQVSAKAYWGRGRANASHGEPARDA |
| Ga0318538_104092441 | 3300031546 | Soil | RLREVLAERGLGQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0318573_107015341 | 3300031564 | Soil | EAKVVSRLRDILAERGLAQDQMSPKAYWGRGRANASHGEPARNA |
| Ga0318555_101145794 | 3300031640 | Soil | QREDLAERGLGQDQMSPKAYWGRGRANAGHGEPARDA |
| Ga0318555_105742672 | 3300031640 | Soil | VLGEARVVSAVRGVLGERGLADDQVSPKAYWGRGRANAGHGEPARDA |
| Ga0318561_102792501 | 3300031679 | Soil | TVVSRLREVLAGRGFGQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0318572_104837642 | 3300031681 | Soil | SRLREVLAGRGFGQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0310686_1042863881 | 3300031708 | Soil | RLREVLAERGLGQDQMSPKAYWGRGRGNASHGEPARDA |
| Ga0306917_112093142 | 3300031719 | Soil | AYLAGEARLVLALREALAARGLPADQVSPKAYWGLGRANAAHGEPARDG |
| Ga0318493_100386334 | 3300031723 | Soil | AAVVSRLREVLAERGLDQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0318493_102327462 | 3300031723 | Soil | ATVVLRLRETLAARGLAPEQISPKAYWGRGRANASHGEPAKDG |
| Ga0318500_105783231 | 3300031724 | Soil | EALAARGLPADQVSPKAYWGLGRANAAHGEPARDG |
| Ga0318500_106048822 | 3300031724 | Soil | HADLAGEATVELRLRETLAARGLAPEQISPKAYWGRGRANASHGEPAKDG |
| Ga0318501_102239251 | 3300031736 | Soil | YLFGEATVVSRLREVLAGRGLGQDQMSPKAYWGRGRGNAGHGEPARDA |
| Ga0306918_112389572 | 3300031744 | Soil | REVLAERGLGQDQMSPKAYWGRGRGNASHGEPVRDA |
| Ga0318502_101361342 | 3300031747 | Soil | VVSRLRDILAERGLGQDQMSPKAYWGRGRANASHGEPARDG |
| Ga0318502_107004691 | 3300031747 | Soil | LRLREALAARGLAAEQISPKAYWGRGRANASHGEPAKDG |
| Ga0318494_108951682 | 3300031751 | Soil | LVLAGRGLGQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0318494_109541712 | 3300031751 | Soil | VLALRKALTARGLTEDQVSPKAYWGLGKANAAHGEPARNG |
| Ga0318554_100897553 | 3300031765 | Soil | YLAGEARLVLALRKALTARGLTEDQVSPKAYWGLGKANAAHGEPARNG |
| Ga0318554_101750932 | 3300031765 | Soil | GLAGQVGVAGEATVVLRLRKALAARGLAPEQISPKAYWGRGRANASHGEPAKDG |
| Ga0318554_102501591 | 3300031765 | Soil | DLLRLRETLAARGLAPEQISPKAYWGRGRANASHGEPAKDG |
| Ga0318554_105777361 | 3300031765 | Soil | GEATVVLAMREVLAGRGLPPEQVSPKAYWGRGRANAGHGEPARGS |
| Ga0318509_103926712 | 3300031768 | Soil | REALAARGLAAEQISPKAYWGRGRANASHGEPAKDG |
| Ga0318509_105627962 | 3300031768 | Soil | GEATVVLRLRKALAARGLAPEQISPKAYWGRGRANASHGEPAKDG |
| Ga0318526_103215341 | 3300031769 | Soil | LFGEATVVSRLREVLAGRGLGQHQMSPKAYWGRGRANAGHGEPARDA |
| Ga0318546_101511933 | 3300031771 | Soil | ARLVLALRKALTARGLTEDQVSPKAYWGLGKANAAHGEPARNG |
| Ga0318498_100173351 | 3300031778 | Soil | HAYLAGEARVVLALREALAARGMAAEQISPKAYWGRGRANAEHGEPTRDG |
| Ga0318566_102066191 | 3300031779 | Soil | LREVLAERGLGQDQMSPKAYWGRGRANAGHGEPARDA |
| Ga0318566_102449992 | 3300031779 | Soil | EAKLVLALREVLAGRGMQAGQVSPKAYWGLGRANAPHGEPPKE |
| Ga0318547_101735613 | 3300031781 | Soil | LRLRETLAACGLAPEQISPKAYWGRGRANASHGEPAKTARAIVQV |
| Ga0318552_102473831 | 3300031782 | Soil | SRLREVLAGRGLGQHQMSPKAYWGRGRANAGHGEPARDA |
| Ga0318529_103063392 | 3300031792 | Soil | AYLLGEAKVILAMREVLASRGLPQEQISPKAYWGRGRANASHGEPARDP |
| Ga0318557_100068581 | 3300031795 | Soil | LVLAERGFGQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0318576_105833012 | 3300031796 | Soil | RLREVLAGRGLGQHQMSPKAYWGRGRANAGHGEPARDA |
| Ga0318550_104946852 | 3300031797 | Soil | VLALREALAARGLDGDQVSPKAYWGLGKANAAHGEPARDS |
| Ga0318523_100487272 | 3300031798 | Soil | AGEATVVLRLRETLAACGLAPEQISPKAYWGRGRANASHGEPAKDG |
| Ga0318523_102887742 | 3300031798 | Soil | VVSRLREVLAGRGFGQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0318565_104433222 | 3300031799 | Soil | LVLALRETLAARGMPADRTSPKAYWGLGKANAAHGEPAKEG |
| Ga0318568_103930691 | 3300031819 | Soil | AYLLGEASVVLALRERLASRGLPQDQMSPKAYWGRGRANAGHGEPPRDA |
| Ga0318568_106738181 | 3300031819 | Soil | AGALAAMPLPPGAGHADLAGEARLVLALREALAARGLAGDQVSPKAYWGLGRANAAHGEPARDG |
| Ga0318568_109533313 | 3300031819 | Soil | HLILAGRGLGQDQMSPKAYWGRGRGNAGHGEPARDA |
| Ga0310917_110704771 | 3300031833 | Soil | VSRLREVLAGRGLGQDQMSPKAYWGRGRANAGHGEPARDA |
| Ga0310917_111766621 | 3300031833 | Soil | EAAVVSRLREVLAERGLDQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0318527_102594391 | 3300031859 | Soil | FGEATVVSRLREILAERGFGQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0306919_108536701 | 3300031879 | Soil | LREVLAGRGLGQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0306925_110615431 | 3300031890 | Soil | REVLAGRGLGQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0318536_101349501 | 3300031893 | Soil | VLRLRKALAARGLAPEQISPKAYWGRGRANASHGEPAKDG |
| Ga0318522_103887331 | 3300031894 | Soil | VVSRLREVLGERGLSQDQMSPKAYWGRGRANASHGEPARDT |
| Ga0318551_106290222 | 3300031896 | Soil | REVLAERGLGQDQMSPKAYWGRGRANAGHGEPARDA |
| Ga0318551_106591102 | 3300031896 | Soil | AYLAGEATVVLRLREALAARGLAAEQISPKAYWGRGRANASHGEPAKDG |
| Ga0318551_109187332 | 3300031896 | Soil | SRLREVLAGRGLGQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0318520_101887731 | 3300031897 | Soil | LVLAGRGFGQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0318520_103971001 | 3300031897 | Soil | LRDILAERGLGQDQMSPKAYWGRGRANASHGEPARDG |
| Ga0318520_105257491 | 3300031897 | Soil | RETLAARGMPADRTSPKAYWGLGKANAAHGEPAKEG |
| Ga0306921_123646312 | 3300031912 | Soil | LFGVATVVSRLRVVLAERGLGQDQMSPKAYWGRGRANAGHGEPARDA |
| Ga0310912_108983502 | 3300031941 | Soil | GHAYLAGEARLVLALREAVAARGLAPDQVSPKAYWGLGKANAAHGEPARDG |
| Ga0310912_114482242 | 3300031941 | Soil | EILAERGFGQDQMSPKAYWGRGRANASHGEPTRDA |
| Ga0310916_104343572 | 3300031942 | Soil | RDILTERGLGQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0310916_111782091 | 3300031942 | Soil | YLAGEARLVLALREALTARGLTEDQVSPKAYWGLGKANAAHGEPARDG |
| Ga0310916_112792342 | 3300031942 | Soil | YLAGEARLVLALREALAARGLPGDQVSPKAYWGLGRANAAHGEPARDG |
| Ga0310913_107795671 | 3300031945 | Soil | VLRLREALAARGLAAEQISPKAYWGRGRANASHGEPAKDG |
| Ga0310910_109137442 | 3300031946 | Soil | GHAYLAGEARLVLALREALAARGLPADQVSPKAYWGLGRANAAHGEPARDG |
| Ga0310909_101951991 | 3300031947 | Soil | LRDILAERGLGQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0306926_109203131 | 3300031954 | Soil | ALREVLAGRGMQAGQVSPKAYWGLGRANAPHGEPPKE |
| Ga0306922_111983471 | 3300032001 | Soil | ARLVLALREALAARGMPSDRVSPKAYWGLGKANAPHGEPAKEG |
| Ga0318562_104360803 | 3300032008 | Soil | ATVVSRLREVLAGRGLGQHQMSPKAYWGRGRANAGHGEPARDA |
| Ga0318563_105573481 | 3300032009 | Soil | GHAYLAGEARLVLALREALAARGMPSDRVSPKAYWGLGKANAPHGEPAKEG |
| Ga0318569_101238563 | 3300032010 | Soil | VVLRLRETLAARGLAPEQISPKAYWGRGRANASHGEPAKDG |
| Ga0310911_107905932 | 3300032035 | Soil | HAYIFGEAKVVSRLRDILAERGLGQDQMSPKAYWGRGRANASHGEPARDG |
| Ga0318556_101846422 | 3300032043 | Soil | LVLALREALAARGMPSDRVSPKAYWGLGKANAAHGEPAKEG |
| Ga0318556_103366952 | 3300032043 | Soil | FGEATVVSRLREVLAGRGLGQDQMSPKAYWGRGRANASHGEPARDT |
| Ga0318558_103647901 | 3300032044 | Soil | EALAARGLAAEQISPKAYWGRGRANASHGEPAKDG |
| Ga0318506_100049321 | 3300032052 | Soil | VLALREALAARGMAAGQISAKAYWGRGRANAEHGEPARDS |
| Ga0318506_104170921 | 3300032052 | Soil | HLVLAGRGLGQHQMSPKAYWGRGRANAGHGEPARDA |
| Ga0318505_103718683 | 3300032060 | Soil | VVSRLREVLAGRGLGQHQMSPKAYWGRGRANAGHGEPARDA |
| Ga0318505_104501291 | 3300032060 | Soil | VVSRLREVLAGRGLGQDQMSPKAYWGRGRANASHGEPARDT |
| Ga0318505_104599262 | 3300032060 | Soil | LRETLAARGMPADRTSPKAYWGLGKANAAHGEPAKEG |
| Ga0318513_102670711 | 3300032065 | Soil | EATVVSRLREVLAERGLGQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0318513_105151881 | 3300032065 | Soil | AGEARLVLALREALTARGLTEDQVSPKAYWGLGKANAAHGEPARDG |
| Ga0318524_103587101 | 3300032067 | Soil | VGVATVVLRLRKALAARGLAPEQISPKAYWGRGRANASHGEPAKDG |
| Ga0318524_104196351 | 3300032067 | Soil | AGEARLVLALREALAARGLPGDQVSPKAYWGLGRANAAHGEPARDG |
| Ga0318524_105563062 | 3300032067 | Soil | HAYLAGEATVVLRLRETLAARGLAPEQISPKAYWGRGRANASHGEPAKDG |
| Ga0318553_102649892 | 3300032068 | Soil | REVLESRGLPQEHMSPKAYWGRGRANASHGEPARDP |
| Ga0311301_130019521 | 3300032160 | Peatlands Soil | HAYLSGEATVVSRLREVLAGRGLGQDQMSPKAYWGRGRANASHGEPARDA |
| Ga0307471_1002019781 | 3300032180 | Hardwood Forest Soil | AYLAGEATVVLRLRETLAARGLAPEQMSPKAYWGRGRANASHGEPARDG |
| Ga0335085_110430512 | 3300032770 | Soil | REILAGRGLGQDQMSPKAYWGRGRANASHGEPARDP |
| Ga0335079_101731712 | 3300032783 | Soil | LREVLAGRGLGEGQMSPKAYWGRGRANAGHGEPPRDA |
| Ga0335079_112841162 | 3300032783 | Soil | RLREVLAARGLADGQVSAKAYWGRGRANAQHGEPARD |
| Ga0335081_113235022 | 3300032892 | Soil | PGRGHAYLAGEATVVLRLRETRAARGLAPEQISPKAYWGRGRANASHGEPARDG |
| Ga0335081_121504351 | 3300032892 | Soil | RETLAARGLAPEQISPKAYWGRGRANASHGEPAREG |
| Ga0335074_113053491 | 3300032895 | Soil | RLREILESRGLPQDQMSPKAYWGRGRANAGHGEPARDA |
| Ga0335075_100751851 | 3300032896 | Soil | AGRGHANLFGEAKVVLRLREILTGRGLGEDQISPKAYWGRGRANAGHGEPARDA |
| Ga0335075_114242971 | 3300032896 | Soil | RLREVLAERGLGEDQMSPKAYWGRGRANASHGEPARDA |
| Ga0335075_115489201 | 3300032896 | Soil | VLRLREILTSRELGEDQISPNAYWGRGWANVGHGEPARDA |
| Ga0335072_103238481 | 3300032898 | Soil | GEAKVVLALREMAAHRGLAADQVSPKAYWGRGKANASHGEPARDS |
| Ga0335072_109277171 | 3300032898 | Soil | HAYLLGEARVVLRLREILAGRGLAQDQMSPKAYWGRGRANAGHGEPARDA |
| Ga0335072_114030621 | 3300032898 | Soil | KVVLRLREILTARGLGEDQISPKAYWGRGRANAGHGEPARDA |
| Ga0335084_104440132 | 3300033004 | Soil | LAGEATVVLRLREALAARGLAPEQMSPKAYWGRGRANASHGEPARDG |
| Ga0335077_114266881 | 3300033158 | Soil | VVSRLREVLAGRGLGQDQMSPKAYWGRGRANAGHGEPARDA |
| Ga0310914_103504431 | 3300033289 | Soil | EATVVLRLREALAARGLAPEQISPKAYWGRGRANASHGEPAKDG |
| Ga0334850_052475_645_767 | 3300033828 | Soil | VLAMRERLAARGLPQDQMSPKAYWGRGRANAGHGEPARDS |
| ⦗Top⦘ |