| Basic Information | |
|---|---|
| Family ID | F013519 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 270 |
| Average Sequence Length | 47 residues |
| Representative Sequence | VRRTVPPSAEIEEQIDQLLAVGVGENPRESLSELAKLGARLIIQR |
| Number of Associated Samples | 206 |
| Number of Associated Scaffolds | 270 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 75.37 % |
| % of genes near scaffold ends (potentially truncated) | 81.48 % |
| % of genes from short scaffolds (< 2000 bps) | 88.89 % |
| Associated GOLD sequencing projects | 198 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.64 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.963 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil (12.593 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.741 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.556 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.21% β-sheet: 0.00% Coil/Unstructured: 54.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 270 Family Scaffolds |
|---|---|---|
| PF00872 | Transposase_mut | 7.04 |
| PF04299 | FMN_bind_2 | 2.59 |
| PF13191 | AAA_16 | 2.22 |
| PF02371 | Transposase_20 | 2.22 |
| PF07883 | Cupin_2 | 1.85 |
| PF12680 | SnoaL_2 | 1.48 |
| PF13751 | DDE_Tnp_1_6 | 1.48 |
| PF12697 | Abhydrolase_6 | 0.74 |
| PF01548 | DEDD_Tnp_IS110 | 0.74 |
| PF01867 | Cas_Cas1 | 0.74 |
| PF00589 | Phage_integrase | 0.74 |
| PF08388 | GIIM | 0.74 |
| PF08281 | Sigma70_r4_2 | 0.74 |
| PF00211 | Guanylate_cyc | 0.74 |
| PF00196 | GerE | 0.74 |
| PF08241 | Methyltransf_11 | 0.37 |
| PF13417 | GST_N_3 | 0.37 |
| PF00069 | Pkinase | 0.37 |
| PF01872 | RibD_C | 0.37 |
| PF01613 | Flavin_Reduct | 0.37 |
| PF13683 | rve_3 | 0.37 |
| PF13450 | NAD_binding_8 | 0.37 |
| PF14329 | DUF4386 | 0.37 |
| PF14534 | DUF4440 | 0.37 |
| PF02452 | PemK_toxin | 0.37 |
| PF04828 | GFA | 0.37 |
| PF11760 | CbiG_N | 0.37 |
| PF13419 | HAD_2 | 0.37 |
| PF01695 | IstB_IS21 | 0.37 |
| PF02012 | BNR | 0.37 |
| PF07690 | MFS_1 | 0.37 |
| PF08240 | ADH_N | 0.37 |
| PF08386 | Abhydrolase_4 | 0.37 |
| PF07553 | Lipoprotein_Ltp | 0.37 |
| PF01878 | EVE | 0.37 |
| PF07652 | Flavi_DEAD | 0.37 |
| PF00884 | Sulfatase | 0.37 |
| PF08447 | PAS_3 | 0.37 |
| PF04185 | Phosphoesterase | 0.37 |
| PF01527 | HTH_Tnp_1 | 0.37 |
| PF14430 | Imm1 | 0.37 |
| PF01906 | YbjQ_1 | 0.37 |
| PF00027 | cNMP_binding | 0.37 |
| PF01063 | Aminotran_4 | 0.37 |
| PF01292 | Ni_hydr_CYTB | 0.37 |
| PF00614 | PLDc | 0.37 |
| PF02386 | TrkH | 0.37 |
| PF13474 | SnoaL_3 | 0.37 |
| PF04075 | F420H2_quin_red | 0.37 |
| PF00353 | HemolysinCabind | 0.37 |
| PF01596 | Methyltransf_3 | 0.37 |
| PF00903 | Glyoxalase | 0.37 |
| PF13602 | ADH_zinc_N_2 | 0.37 |
| PF10057 | MpsC | 0.37 |
| PF01636 | APH | 0.37 |
| PF12796 | Ank_2 | 0.37 |
| PF13361 | UvrD_C | 0.37 |
| PF12833 | HTH_18 | 0.37 |
| PF14870 | PSII_BNR | 0.37 |
| PF00665 | rve | 0.37 |
| PF08818 | DUF1801 | 0.37 |
| PF04191 | PEMT | 0.37 |
| PF02557 | VanY | 0.37 |
| PF13518 | HTH_28 | 0.37 |
| PF00392 | GntR | 0.37 |
| PF08327 | AHSA1 | 0.37 |
| PF13401 | AAA_22 | 0.37 |
| PF03992 | ABM | 0.37 |
| PF01361 | Tautomerase | 0.37 |
| PF14478 | DUF4430 | 0.37 |
| COG ID | Name | Functional Category | % Frequency in 270 Family Scaffolds |
|---|---|---|---|
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 7.04 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 2.96 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.48 |
| COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 0.74 |
| COG1518 | CRISPR-Cas system-associated integrase Cas1 | Defense mechanisms [V] | 0.74 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.74 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.37 |
| COG2947 | Predicted RNA-binding protein, contains EVE domain | General function prediction only [R] | 0.37 |
| COG3038 | Cytochrome b561 | Energy production and conversion [C] | 0.37 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.37 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.37 |
| COG3658 | Cytochrome b subunit of Ni2+-dependent hydrogenase | Energy production and conversion [C] | 0.37 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.37 |
| COG4117 | Thiosulfate reductase cytochrome b subunit | Inorganic ion transport and metabolism [P] | 0.37 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.37 |
| COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 0.37 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.37 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.37 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.37 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.37 |
| COG2864 | Cytochrome b subunit of formate dehydrogenase | Energy production and conversion [C] | 0.37 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.37 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.37 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.37 |
| COG2173 | D-alanyl-D-alanine dipeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.37 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.37 |
| COG1969 | Ni,Fe-hydrogenase I cytochrome b subunit | Energy production and conversion [C] | 0.37 |
| COG1942 | Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.37 |
| COG1876 | LD-carboxypeptidase LdcB, LAS superfamily | Cell wall/membrane/envelope biogenesis [M] | 0.37 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.37 |
| COG1673 | Predicted RNA-binding protein, contains PUA-like EVE domain | General function prediction only [R] | 0.37 |
| COG1502 | Phosphatidylserine/phosphatidylglycerophosphate/cardiolipin synthase | Lipid transport and metabolism [I] | 0.37 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.37 |
| COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 0.37 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.37 |
| COG0168 | Trk-type K+ transport system, membrane component | Inorganic ion transport and metabolism [P] | 0.37 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.33 % |
| Unclassified | root | N/A | 6.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459019|G14TP7Y02HUOB4 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 613 | Open in IMG/M |
| 2189573001|GZR05M102IQV80 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 535 | Open in IMG/M |
| 3300000956|JGI10216J12902_103196759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 508 | Open in IMG/M |
| 3300001356|JGI12269J14319_10140214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1062 | Open in IMG/M |
| 3300001989|JGI24739J22299_10088611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 944 | Open in IMG/M |
| 3300004013|Ga0055465_10167743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 705 | Open in IMG/M |
| 3300004016|Ga0058689_10091731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 630 | Open in IMG/M |
| 3300004081|Ga0063454_101190543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 630 | Open in IMG/M |
| 3300004092|Ga0062389_104622428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 518 | Open in IMG/M |
| 3300004635|Ga0062388_102753989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 518 | Open in IMG/M |
| 3300005093|Ga0062594_100323519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1191 | Open in IMG/M |
| 3300005179|Ga0066684_10842923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 603 | Open in IMG/M |
| 3300005184|Ga0066671_10480965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 797 | Open in IMG/M |
| 3300005184|Ga0066671_10913105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 556 | Open in IMG/M |
| 3300005186|Ga0066676_10518858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 809 | Open in IMG/M |
| 3300005337|Ga0070682_100779942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 774 | Open in IMG/M |
| 3300005344|Ga0070661_100186934 | Not Available | 1578 | Open in IMG/M |
| 3300005436|Ga0070713_102393580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 511 | Open in IMG/M |
| 3300005557|Ga0066704_10393005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 923 | Open in IMG/M |
| 3300005562|Ga0058697_10328110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 738 | Open in IMG/M |
| 3300005764|Ga0066903_108086641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 539 | Open in IMG/M |
| 3300005981|Ga0081538_10120842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Mizugakiibacter → Mizugakiibacter sediminis | 1259 | Open in IMG/M |
| 3300005985|Ga0081539_10008078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9312 | Open in IMG/M |
| 3300006046|Ga0066652_100252786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1544 | Open in IMG/M |
| 3300006046|Ga0066652_102051866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300006575|Ga0074053_11905957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 991 | Open in IMG/M |
| 3300006581|Ga0074048_13126094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 575 | Open in IMG/M |
| 3300006800|Ga0066660_10726009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 813 | Open in IMG/M |
| 3300006804|Ga0079221_11377799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 559 | Open in IMG/M |
| 3300006845|Ga0075421_101736312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 674 | Open in IMG/M |
| 3300006847|Ga0075431_100337247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1517 | Open in IMG/M |
| 3300006847|Ga0075431_100690830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 999 | Open in IMG/M |
| 3300006847|Ga0075431_100764864 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300006847|Ga0075431_101988165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
| 3300006852|Ga0075433_11364289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 614 | Open in IMG/M |
| 3300006903|Ga0075426_10098524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2097 | Open in IMG/M |
| 3300006918|Ga0079216_10322418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 927 | Open in IMG/M |
| 3300006918|Ga0079216_11164628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 615 | Open in IMG/M |
| 3300007004|Ga0079218_10996117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 839 | Open in IMG/M |
| 3300007004|Ga0079218_11646832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 707 | Open in IMG/M |
| 3300007076|Ga0075435_101473173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 597 | Open in IMG/M |
| 3300007790|Ga0105679_10214762 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
| 3300009012|Ga0066710_102043078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 847 | Open in IMG/M |
| 3300009092|Ga0105250_10426945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 591 | Open in IMG/M |
| 3300009137|Ga0066709_102659264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 668 | Open in IMG/M |
| 3300009147|Ga0114129_11349900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Iamiaceae → Aquihabitans → unclassified Aquihabitans → Aquihabitans sp. Kera 3 | 882 | Open in IMG/M |
| 3300009147|Ga0114129_11495097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 830 | Open in IMG/M |
| 3300009162|Ga0075423_10431834 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
| 3300009162|Ga0075423_10541478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1225 | Open in IMG/M |
| 3300009520|Ga0116214_1190106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 771 | Open in IMG/M |
| 3300009525|Ga0116220_10519822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 542 | Open in IMG/M |
| 3300009551|Ga0105238_12466713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 556 | Open in IMG/M |
| 3300009553|Ga0105249_10114281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2556 | Open in IMG/M |
| 3300009553|Ga0105249_10865122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 970 | Open in IMG/M |
| 3300009553|Ga0105249_12240257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 619 | Open in IMG/M |
| 3300009698|Ga0116216_10039651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2918 | Open in IMG/M |
| 3300009698|Ga0116216_10757129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300009700|Ga0116217_10086011 | Not Available | 2174 | Open in IMG/M |
| 3300009789|Ga0126307_10019995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5047 | Open in IMG/M |
| 3300009789|Ga0126307_10110358 | All Organisms → cellular organisms → Bacteria | 2185 | Open in IMG/M |
| 3300009789|Ga0126307_10227300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1499 | Open in IMG/M |
| 3300009789|Ga0126307_10322948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1243 | Open in IMG/M |
| 3300009789|Ga0126307_10842756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 740 | Open in IMG/M |
| 3300009801|Ga0105056_1060246 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300009824|Ga0116219_10329939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 857 | Open in IMG/M |
| 3300009840|Ga0126313_10572870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 908 | Open in IMG/M |
| 3300009840|Ga0126313_11322501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 596 | Open in IMG/M |
| 3300009840|Ga0126313_11367871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 586 | Open in IMG/M |
| 3300010036|Ga0126305_10044011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2503 | Open in IMG/M |
| 3300010036|Ga0126305_10543713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 777 | Open in IMG/M |
| 3300010037|Ga0126304_10024599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3482 | Open in IMG/M |
| 3300010037|Ga0126304_10045712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2642 | Open in IMG/M |
| 3300010037|Ga0126304_11184416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 524 | Open in IMG/M |
| 3300010038|Ga0126315_10090934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1736 | Open in IMG/M |
| 3300010038|Ga0126315_10128451 | Not Available | 1483 | Open in IMG/M |
| 3300010038|Ga0126315_10354685 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300010038|Ga0126315_10356225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 913 | Open in IMG/M |
| 3300010038|Ga0126315_10362803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 905 | Open in IMG/M |
| 3300010038|Ga0126315_10505127 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Pseudococcidae → Paracoccus | 771 | Open in IMG/M |
| 3300010038|Ga0126315_10738013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 645 | Open in IMG/M |
| 3300010039|Ga0126309_10468169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 769 | Open in IMG/M |
| 3300010040|Ga0126308_10069208 | All Organisms → cellular organisms → Bacteria | 2098 | Open in IMG/M |
| 3300010040|Ga0126308_10311426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium SCGC AG-212-D09 | 1037 | Open in IMG/M |
| 3300010040|Ga0126308_10584152 | Not Available | 761 | Open in IMG/M |
| 3300010040|Ga0126308_10633851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 731 | Open in IMG/M |
| 3300010040|Ga0126308_10731127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 682 | Open in IMG/M |
| 3300010041|Ga0126312_10049986 | All Organisms → cellular organisms → Bacteria | 2800 | Open in IMG/M |
| 3300010041|Ga0126312_10078320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2236 | Open in IMG/M |
| 3300010041|Ga0126312_10083680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2165 | Open in IMG/M |
| 3300010041|Ga0126312_10717697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 722 | Open in IMG/M |
| 3300010042|Ga0126314_10154068 | All Organisms → cellular organisms → Bacteria | 1602 | Open in IMG/M |
| 3300010042|Ga0126314_10612586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 795 | Open in IMG/M |
| 3300010044|Ga0126310_10977927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 665 | Open in IMG/M |
| 3300010044|Ga0126310_11642530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 532 | Open in IMG/M |
| 3300010114|Ga0127460_1139517 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300010321|Ga0134067_10143972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 846 | Open in IMG/M |
| 3300010329|Ga0134111_10172077 | Not Available | 866 | Open in IMG/M |
| 3300010341|Ga0074045_10428650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 855 | Open in IMG/M |
| 3300010361|Ga0126378_12976452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 540 | Open in IMG/M |
| 3300010376|Ga0126381_104610154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 531 | Open in IMG/M |
| 3300010379|Ga0136449_100250769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 3289 | Open in IMG/M |
| 3300010396|Ga0134126_11299368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 806 | Open in IMG/M |
| 3300010396|Ga0134126_12442408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 569 | Open in IMG/M |
| 3300012021|Ga0120192_10053239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 729 | Open in IMG/M |
| 3300012198|Ga0137364_11055659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 612 | Open in IMG/M |
| 3300012204|Ga0137374_10405683 | Not Available | 1082 | Open in IMG/M |
| 3300012206|Ga0137380_11348443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 598 | Open in IMG/M |
| 3300012206|Ga0137380_11651388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 525 | Open in IMG/M |
| 3300012211|Ga0137377_10223543 | All Organisms → cellular organisms → Bacteria | 1809 | Open in IMG/M |
| 3300012211|Ga0137377_10371222 | Not Available | 1368 | Open in IMG/M |
| 3300012212|Ga0150985_107551206 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300012212|Ga0150985_110705645 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300012212|Ga0150985_121675645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 709 | Open in IMG/M |
| 3300012285|Ga0137370_11029243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 506 | Open in IMG/M |
| 3300012350|Ga0137372_10839540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 657 | Open in IMG/M |
| 3300012355|Ga0137369_10638110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 737 | Open in IMG/M |
| 3300012360|Ga0137375_10190297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1954 | Open in IMG/M |
| 3300012360|Ga0137375_11229932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 571 | Open in IMG/M |
| 3300012403|Ga0134049_1134382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Cystobacter → Cystobacter fuscus | 549 | Open in IMG/M |
| 3300012409|Ga0134045_1158851 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300012469|Ga0150984_101783400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 573 | Open in IMG/M |
| 3300012513|Ga0157326_1083719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 526 | Open in IMG/M |
| 3300012951|Ga0164300_10764872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 594 | Open in IMG/M |
| 3300012975|Ga0134110_10198888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 840 | Open in IMG/M |
| 3300012977|Ga0134087_10437470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 645 | Open in IMG/M |
| 3300012986|Ga0164304_11080138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 641 | Open in IMG/M |
| 3300012988|Ga0164306_11718814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 545 | Open in IMG/M |
| 3300013013|Ga0169969_1044819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1041 | Open in IMG/M |
| 3300013096|Ga0157307_1146805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300013307|Ga0157372_12755137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
| 3300013765|Ga0120172_1063977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 927 | Open in IMG/M |
| 3300014501|Ga0182024_10073198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5168 | Open in IMG/M |
| 3300014655|Ga0181516_10700235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 525 | Open in IMG/M |
| 3300014820|Ga0120160_1055881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 674 | Open in IMG/M |
| 3300014838|Ga0182030_10678501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 972 | Open in IMG/M |
| 3300014838|Ga0182030_11607484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300014969|Ga0157376_12888754 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300015053|Ga0137405_1378628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2115 | Open in IMG/M |
| 3300015054|Ga0137420_1333102 | All Organisms → cellular organisms → Bacteria | 3427 | Open in IMG/M |
| 3300015077|Ga0173483_10079157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1324 | Open in IMG/M |
| 3300015201|Ga0173478_10694063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 543 | Open in IMG/M |
| 3300015372|Ga0132256_102125314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 667 | Open in IMG/M |
| 3300016294|Ga0182041_11703582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 583 | Open in IMG/M |
| 3300016404|Ga0182037_10543152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum → Sorangium cellulosum So ce56 | 980 | Open in IMG/M |
| 3300016422|Ga0182039_10808431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 833 | Open in IMG/M |
| 3300016445|Ga0182038_10880830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 788 | Open in IMG/M |
| 3300017792|Ga0163161_10708006 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300017936|Ga0187821_10229789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 720 | Open in IMG/M |
| 3300017942|Ga0187808_10333522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 687 | Open in IMG/M |
| 3300017959|Ga0187779_10080555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1936 | Open in IMG/M |
| 3300017959|Ga0187779_10165198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1371 | Open in IMG/M |
| 3300017961|Ga0187778_10082784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1981 | Open in IMG/M |
| 3300017961|Ga0187778_10112867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1695 | Open in IMG/M |
| 3300017961|Ga0187778_10149751 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
| 3300017961|Ga0187778_10949645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 593 | Open in IMG/M |
| 3300017966|Ga0187776_10233024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 1171 | Open in IMG/M |
| 3300017973|Ga0187780_10159293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1567 | Open in IMG/M |
| 3300017973|Ga0187780_10783356 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300017974|Ga0187777_10545776 | Not Available | 813 | Open in IMG/M |
| 3300017974|Ga0187777_10922264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 629 | Open in IMG/M |
| 3300017974|Ga0187777_11005605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 603 | Open in IMG/M |
| 3300018034|Ga0187863_10486821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 690 | Open in IMG/M |
| 3300018058|Ga0187766_10127842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1562 | Open in IMG/M |
| 3300018058|Ga0187766_10491817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 825 | Open in IMG/M |
| 3300018058|Ga0187766_10777406 | Not Available | 667 | Open in IMG/M |
| 3300018058|Ga0187766_11049079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 583 | Open in IMG/M |
| 3300018058|Ga0187766_11218022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 546 | Open in IMG/M |
| 3300018064|Ga0187773_10564531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 690 | Open in IMG/M |
| 3300018089|Ga0187774_10791541 | Not Available | 639 | Open in IMG/M |
| 3300018422|Ga0190265_10425654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1430 | Open in IMG/M |
| 3300018465|Ga0190269_11773867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 525 | Open in IMG/M |
| 3300018466|Ga0190268_10193235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1101 | Open in IMG/M |
| 3300018468|Ga0066662_11703542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 659 | Open in IMG/M |
| 3300018469|Ga0190270_10896752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 904 | Open in IMG/M |
| 3300018469|Ga0190270_11224017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 790 | Open in IMG/M |
| 3300018476|Ga0190274_10842204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 979 | Open in IMG/M |
| 3300018476|Ga0190274_12973836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 569 | Open in IMG/M |
| 3300019356|Ga0173481_10124296 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300021184|Ga0196959_10108781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 644 | Open in IMG/M |
| 3300023101|Ga0224557_1201446 | Not Available | 692 | Open in IMG/M |
| 3300023259|Ga0224551_1052380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 710 | Open in IMG/M |
| 3300025527|Ga0208714_1042266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 1017 | Open in IMG/M |
| 3300025627|Ga0208220_1095036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 808 | Open in IMG/M |
| 3300025928|Ga0207700_11582930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 580 | Open in IMG/M |
| 3300025932|Ga0207690_10523261 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300025934|Ga0207686_10061081 | All Organisms → cellular organisms → Bacteria | 2388 | Open in IMG/M |
| 3300025942|Ga0207689_10023347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5192 | Open in IMG/M |
| 3300026041|Ga0207639_11076923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 753 | Open in IMG/M |
| 3300026078|Ga0207702_12165881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 545 | Open in IMG/M |
| 3300026089|Ga0207648_11215668 | Not Available | 708 | Open in IMG/M |
| 3300026328|Ga0209802_1119300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1161 | Open in IMG/M |
| 3300026527|Ga0209059_1281927 | Not Available | 561 | Open in IMG/M |
| 3300027497|Ga0208199_1111918 | Not Available | 560 | Open in IMG/M |
| 3300027535|Ga0209734_1021966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1174 | Open in IMG/M |
| 3300027604|Ga0208324_1142757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 654 | Open in IMG/M |
| 3300027696|Ga0208696_1153871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 743 | Open in IMG/M |
| 3300027722|Ga0209819_10351314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300027907|Ga0207428_10375159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1044 | Open in IMG/M |
| 3300027968|Ga0209061_1122336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 879 | Open in IMG/M |
| 3300028536|Ga0137415_10347248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1287 | Open in IMG/M |
| 3300028705|Ga0307276_10186391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 541 | Open in IMG/M |
| 3300028711|Ga0307293_10043540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1384 | Open in IMG/M |
| 3300028713|Ga0307303_10087930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 700 | Open in IMG/M |
| 3300028739|Ga0302205_10091405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 778 | Open in IMG/M |
| 3300028742|Ga0302220_10000050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 110343 | Open in IMG/M |
| 3300028744|Ga0307318_10376948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 501 | Open in IMG/M |
| 3300028755|Ga0307316_10088339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1073 | Open in IMG/M |
| 3300028768|Ga0307280_10409807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 506 | Open in IMG/M |
| 3300028776|Ga0302303_10098613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 1073 | Open in IMG/M |
| 3300028791|Ga0307290_10144603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 871 | Open in IMG/M |
| 3300028810|Ga0307294_10074102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1035 | Open in IMG/M |
| 3300028814|Ga0307302_10064023 | Not Available | 1723 | Open in IMG/M |
| 3300028884|Ga0307308_10538500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella ureilytica | 560 | Open in IMG/M |
| 3300030006|Ga0299907_11213230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 541 | Open in IMG/M |
| 3300030336|Ga0247826_10459013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 954 | Open in IMG/M |
| 3300030503|Ga0311370_10479590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1532 | Open in IMG/M |
| 3300030520|Ga0311372_11127487 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300030707|Ga0310038_10430742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 568 | Open in IMG/M |
| 3300031091|Ga0308201_10305608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 568 | Open in IMG/M |
| 3300031198|Ga0307500_10109903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 750 | Open in IMG/M |
| 3300031548|Ga0307408_100764767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 874 | Open in IMG/M |
| 3300031548|Ga0307408_101517987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 634 | Open in IMG/M |
| 3300031564|Ga0318573_10588473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 599 | Open in IMG/M |
| 3300031572|Ga0318515_10137735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum → Sorangium cellulosum So ce56 | 1297 | Open in IMG/M |
| 3300031640|Ga0318555_10439662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 707 | Open in IMG/M |
| 3300031670|Ga0307374_10251001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1183 | Open in IMG/M |
| 3300031672|Ga0307373_10355261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 884 | Open in IMG/M |
| 3300031679|Ga0318561_10786425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 523 | Open in IMG/M |
| 3300031708|Ga0310686_116960923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300031724|Ga0318500_10284189 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300031731|Ga0307405_10355777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1131 | Open in IMG/M |
| 3300031731|Ga0307405_11032719 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300031778|Ga0318498_10023622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2624 | Open in IMG/M |
| 3300031778|Ga0318498_10284292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 743 | Open in IMG/M |
| 3300031792|Ga0318529_10550076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 536 | Open in IMG/M |
| 3300031819|Ga0318568_10133529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum → Sorangium cellulosum So ce56 | 1509 | Open in IMG/M |
| 3300031852|Ga0307410_10392901 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300031859|Ga0318527_10511103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 512 | Open in IMG/M |
| 3300031879|Ga0306919_10609878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 842 | Open in IMG/M |
| 3300031893|Ga0318536_10546343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 581 | Open in IMG/M |
| 3300031897|Ga0318520_10935840 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300031901|Ga0307406_10730980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. S30A1 | 829 | Open in IMG/M |
| 3300031903|Ga0307407_11335986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 563 | Open in IMG/M |
| 3300031911|Ga0307412_10991848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 742 | Open in IMG/M |
| 3300031918|Ga0311367_12323843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 512 | Open in IMG/M |
| 3300031942|Ga0310916_10247155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum → Sorangium cellulosum So ce56 | 1503 | Open in IMG/M |
| 3300031962|Ga0307479_11933909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 540 | Open in IMG/M |
| 3300031995|Ga0307409_102116180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 592 | Open in IMG/M |
| 3300032039|Ga0318559_10256679 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300032043|Ga0318556_10660771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 544 | Open in IMG/M |
| 3300032051|Ga0318532_10222439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 670 | Open in IMG/M |
| 3300032059|Ga0318533_11059142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 594 | Open in IMG/M |
| 3300032076|Ga0306924_10525262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1346 | Open in IMG/M |
| 3300032126|Ga0307415_100003841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7709 | Open in IMG/M |
| 3300032126|Ga0307415_102458774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 513 | Open in IMG/M |
| 3300032160|Ga0311301_10037212 | All Organisms → cellular organisms → Bacteria | 12011 | Open in IMG/M |
| 3300032160|Ga0311301_12669374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 551 | Open in IMG/M |
| 3300032261|Ga0306920_100095384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Glycomycetales → Glycomycetaceae → Glycomyces → Glycomyces xiaoerkulensis | 4400 | Open in IMG/M |
| 3300032805|Ga0335078_10041235 | Not Available | 6847 | Open in IMG/M |
| 3300032892|Ga0335081_10046020 | All Organisms → cellular organisms → Bacteria | 6883 | Open in IMG/M |
| 3300032895|Ga0335074_10047669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5914 | Open in IMG/M |
| 3300032895|Ga0335074_10761225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 915 | Open in IMG/M |
| 3300033290|Ga0318519_10161701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum → Sorangium cellulosum So ce56 | 1258 | Open in IMG/M |
| 3300033290|Ga0318519_10952060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 532 | Open in IMG/M |
| 3300033551|Ga0247830_10239438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 1370 | Open in IMG/M |
| 3300033808|Ga0314867_044554 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300034151|Ga0364935_0304677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 526 | Open in IMG/M |
| 3300034268|Ga0372943_0839370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 610 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 12.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.41% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 7.04% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.19% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.19% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.07% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 4.07% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.22% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.85% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.48% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.11% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.11% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.11% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.74% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.74% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.74% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.74% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.74% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.74% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.74% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.74% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.37% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.37% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.37% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.37% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.37% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.37% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.37% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.37% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.37% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.37% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.37% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.37% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.37% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.37% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.37% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.37% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Rock | 0.37% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.37% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.37% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.37% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.37% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.37% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.37% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.37% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.37% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.37% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Host-Associated | Open in IMG/M |
| 3300004013 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 | Environmental | Open in IMG/M |
| 3300004016 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz | Host-Associated | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010114 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012409 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Host-Associated | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013013 | Gypsum rock endolithic microbial communities from the Atacama Desert, Chile - Monturaqui | Environmental | Open in IMG/M |
| 3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014820 | Permafrost microbial communities from Nunavut, Canada - A15_80cm_0.25M | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300021184 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_20 | Environmental | Open in IMG/M |
| 3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027968 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031672 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-2 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4MG_05205880 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | VRRTVPPSAEIEAQIDQLLAVGVGDNPRESLSELAKL |
| FD2_07961230 | 2189573001 | Grass Soil | KEAYAVKRTVPPSAEIEARIDQMLSVGVGESPRETLSELARLGARLIIQGRFEDEFDAWL |
| JGI10216J12902_1031967591 | 3300000956 | Soil | MEEAYAVKRTVPPSAEIEEQIDRLLAVGVGENPREALSEL |
| JGI12269J14319_101402143 | 3300001356 | Peatlands Soil | VRRTVPPSAEIEEQIDQLLAVGVGENPRESLSSLAKLGARL |
| JGI24739J22299_100886112 | 3300001989 | Corn Rhizosphere | VRRTVPPSAEIEEQIDRLLAVGVGVPRESLSELARLGARLI |
| Ga0055465_101677431 | 3300004013 | Natural And Restored Wetlands | MKEAYAVRRTVPPSAEIEARIEHMLSVGVGENPRESLSELARLGARLIIQRAVEDEFDAW |
| Ga0058689_100917311 | 3300004016 | Agave | VRRTVPPSAEIQAEIDKLLSSGMVDDPQKKLGELARLGARLIIQRAVEE |
| Ga0063454_1011905431 | 3300004081 | Soil | RPRRETYAVRRTLPPSAEIEVQIDQLLAVGVGENPRESLSELAKLGARLII* |
| Ga0062389_1046224281 | 3300004092 | Bog Forest Soil | VKRTLPPSAEIETQIDQLLAVGVGENPRESLSELAKLGARLIIQRAVEDEFDAWL |
| Ga0062388_1027539891 | 3300004635 | Bog Forest Soil | VERTLPPSAEIETQIDQLLAVGVGENPRESLSELAKLGARLIIQRAVEDEFDAWL |
| Ga0062594_1003235191 | 3300005093 | Soil | VRRTVPPSAEIEEQIDRLLAVGVGVPRESLSELARLGARLIIQRAL* |
| Ga0066684_108429231 | 3300005179 | Soil | VGRTVPPSAEIQASIDKLLSKGLVDDPQKMLSELARLGARLIIQRAVEDE |
| Ga0066671_104809651 | 3300005184 | Soil | KTMKEAYAVRRTVPPSAEIEEQIESLLAVGVGENPRESLSELARLGAG* |
| Ga0066671_109131051 | 3300005184 | Soil | VRRTVPPSAEIQASIDKLLSKGMVDDPQRMLSELARLGARLIIQRAVEDEFD |
| Ga0066676_105188582 | 3300005186 | Soil | MKEAYAVRRTVPPSAELEAQIDQLLAVGVGEDPRAALSQLASSARG* |
| Ga0070682_1007799421 | 3300005337 | Corn Rhizosphere | VRRTVPPSAEIEEQIDRLLAVGVGENPRESLSELAKLGARLIIQRAL* |
| Ga0070661_1001869342 | 3300005344 | Corn Rhizosphere | VRRTVPPSAEIEEQIDRLLAVGVGENPRESLSELAKLGARLIIQRAVE |
| Ga0070713_1023935802 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VRRTVPPSAEIETQIDQLLAVGVGENPCESLSELARLGARLIIQRAVEDEFDAWRR |
| Ga0066704_103930052 | 3300005557 | Soil | VRRTVPPSAEIQQKIDGLLASMTVSEAPAQTLSELARLGARLIIQRAVEDEFDAWL |
| Ga0058697_103281102 | 3300005562 | Agave | VRRTVPPSAEIEEQIEGLLAMGVGENEPRSLAVRR* |
| Ga0066903_1080866411 | 3300005764 | Tropical Forest Soil | MKEAYAVRRTVPPSAVIEARIEHMLSVGVGENPRETLSELARLGARLIIQRAVEDEFDAW |
| Ga0081538_101208421 | 3300005981 | Tabebuia Heterophylla Rhizosphere | VRRTVPPSAEIEAQIDQLLAVGVGDNPRESLSELARLGARLIIQRAVED |
| Ga0081539_1000807812 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MKEAYAVRRTVPPSAEIEARIEHMLSVGVGENPRESLSELARLGAR* |
| Ga0066652_1002527861 | 3300006046 | Soil | VRRTVPPSAEIEEQIDELLAVGVGENPREALSGLAKLGARLIIQ |
| Ga0066652_1020518661 | 3300006046 | Soil | VRRTVPPSAEIQQKIDGLLASMTVSEAPAQTLSELARLGARLIIQRAVEDEFD |
| Ga0074053_119059572 | 3300006575 | Soil | VRRTVPPSAEIEEQIDRLLAVGVGDNPRGALSELAKLGAR |
| Ga0074048_131260941 | 3300006581 | Soil | MKEAYAVRRTVPPSAEIQASIDKLLSKGMVDDPQKMLSELARLGARLIIQRAVEDEFD |
| Ga0066660_107260091 | 3300006800 | Soil | KEAYAVRRTVPPSAEIEEQIDQLLAVGVGENPRESLS* |
| Ga0079221_113777991 | 3300006804 | Agricultural Soil | VRRTVPPSAEIEAQIETLLAVGVGENPRESLSELAKLGARLIIQRAVEDEFDAWL |
| Ga0075421_1017363122 | 3300006845 | Populus Rhizosphere | VRRTLPPSAEIEAQIDELLAVGVGENPGESLSELARLGARLIVQRAVEDE |
| Ga0075431_1003372471 | 3300006847 | Populus Rhizosphere | VKRTLPPSAEIEEQIDQLLAVGVGENPRESLSELGKRGARLIIQRAVEDEFSRG* |
| Ga0075431_1006908301 | 3300006847 | Populus Rhizosphere | VRRTVPPSAEIEDQIDELLAVGVGENPRESLSELAKLG |
| Ga0075431_1007648641 | 3300006847 | Populus Rhizosphere | VRRTVPPSAEIEAQIDQLLAVGVGENPRQSLSELAKLGARLIIQRAVEDEFDAWLG |
| Ga0075431_1019881652 | 3300006847 | Populus Rhizosphere | VRRTVPPSAEIEEQIDRLLCVGVGENPRESLSELA |
| Ga0075433_113642892 | 3300006852 | Populus Rhizosphere | PSAEIEEQIDQLLAVGVGENPRESLSELGKRGARLIIQRAVEDEFSRG* |
| Ga0075426_100985241 | 3300006903 | Populus Rhizosphere | MKEAYAVRGTVPPSAELEARIDELLSVGVGENPRESLSELAKLGARLIIRRAVEDEFDAWLG |
| Ga0079216_103224181 | 3300006918 | Agricultural Soil | VRRTVPPSAEIEEQIDELLSVGVGENPRDSLSELARLGARLIIQRAVEDEFDAW |
| Ga0079216_111646281 | 3300006918 | Agricultural Soil | VRRTVPPSAEIEEQIDQLLAVGVGENPRESLSELAKLGARLIIQRAVEDEFDAW |
| Ga0079218_109961171 | 3300007004 | Agricultural Soil | VRRTVPPSAEIEEQIDRLLAVGVGENPRESLSELARLGARLIIQRAVEDEFDA |
| Ga0079218_116468323 | 3300007004 | Agricultural Soil | VRRTVPPSAEIEAQIDRLLAVGVGEKPREALSELARLGARLIIQRAVEDEFGAW |
| Ga0075435_1014731731 | 3300007076 | Populus Rhizosphere | MLRVGGDEEQIDQLLAVGVGENPRESLSELGKRGARLIIQRAVEDEFSRG* |
| Ga0105679_102147623 | 3300007790 | Soil | VRRTVPPSAEIEEQIDRLLAVGVGENPRESLSELAKLGARLIIQRAVED |
| Ga0066710_1020430781 | 3300009012 | Grasslands Soil | VRRTVPPSAEIEAQIEQLLAVGVGENPRESLSELARLGARLIIQRAVEDEFDA |
| Ga0105250_104269451 | 3300009092 | Switchgrass Rhizosphere | VRRTVPPSAEIEEQIDGLLAVGVGENPREALSELAKLGARLIIQ |
| Ga0066709_1026592642 | 3300009137 | Grasslands Soil | VRRTVPPSAEIEDQIDQLLAVGVGESPRESLSNLAKLGARLIIQRAVEDEFDAWLG |
| Ga0114129_113499001 | 3300009147 | Populus Rhizosphere | MKEAYAVRRTVPPSAEIEARIEQMLSVGVGENPRESLSELARL |
| Ga0114129_114950972 | 3300009147 | Populus Rhizosphere | VRRTVPPSAEIEEQIDRLLAVEVGENPRESLSELAKPTH* |
| Ga0075423_104318342 | 3300009162 | Populus Rhizosphere | VKRTLPAAAEIEEQIDQLLAVGVGESPRQSLSELA |
| Ga0075423_105414783 | 3300009162 | Populus Rhizosphere | VRRTVPPSAEIEEQIDRLLAVGVGENPRESLSELAKLGARLIIQRAVEDEFDAWL |
| Ga0116214_11901061 | 3300009520 | Peatlands Soil | MKEAYAVRRTVPPSAEIQANIDKLLASWPVDDPQKMLSELARLGARLIIQRAGQEEFDS* |
| Ga0116220_105198221 | 3300009525 | Peatlands Soil | MKEAYAVRRTVPPSAEIQAEIDKLLAKGMVDDPQKLLGELGRLGARLIIQRAVEDE |
| Ga0105238_124667132 | 3300009551 | Corn Rhizosphere | VRRTLPPSAEIEARIDELLAVGVGENPRESLSELARLGARLIIQRAVEDEF |
| Ga0105249_101142811 | 3300009553 | Switchgrass Rhizosphere | VRRTVPPSAEIEEQIDALLAVGVGENPRESLSELARLGARLIIQRAVE |
| Ga0105249_108651221 | 3300009553 | Switchgrass Rhizosphere | VRRTLPPSAEIEAQIDELLAVGVGENPRESLSELARLGARLIIQ |
| Ga0105249_122402571 | 3300009553 | Switchgrass Rhizosphere | MKEAYAVRRTVPPSAELEAQIDQLLAVGVGENPRESPSEPAKLGPG* |
| Ga0116216_100396511 | 3300009698 | Peatlands Soil | LKEAFAVRRTVPPSAEIEAQIEQLLAVGVGENPRESLSELARLGARLIIQRA |
| Ga0116216_107571291 | 3300009698 | Peatlands Soil | VKRTLPPSAETGEQIDQLLAVGVGENPRESLSELAKLGAL* |
| Ga0116217_100860112 | 3300009700 | Peatlands Soil | LKEAYAVRRTVPPSAEIEDQIDQLLAVGVGENPREALSELAK |
| Ga0126307_100199951 | 3300009789 | Serpentine Soil | VRRTVPPSAEIEAQIDQLLAVGVGENPRESLSELAKLGARLIIQRAVEDE* |
| Ga0126307_101103582 | 3300009789 | Serpentine Soil | VRRTVPPSAEIEAQIDRLLAVGVGENPRESLSGLARLGARLIIQRAVEH* |
| Ga0126307_102273003 | 3300009789 | Serpentine Soil | VRRTVPPSAEIEEQIDRLLAVGVGENPRESLSELAKLGARLIIQRAVEDEF |
| Ga0126307_103229483 | 3300009789 | Serpentine Soil | VRRTVPPSAELEEQIDQLLAVGVGESPRESLSELA |
| Ga0126307_108427561 | 3300009789 | Serpentine Soil | MKEAYAVRRTVPPSAEIETQIDQLLAVGVGEDPRAALSQLAKLGARLIIQ |
| Ga0105056_10602461 | 3300009801 | Groundwater Sand | VRRTVPPSAEIEQRIDGLLAVGVGENPRESLSELAKLGARLIIQRA |
| Ga0116219_103299391 | 3300009824 | Peatlands Soil | LKEAYAVRRTVQPSAEIEAQIDELLAVGVGDNPRESLSALAKLGARLIIQRAVEDEFDA |
| Ga0126313_105728701 | 3300009840 | Serpentine Soil | VRRTLPPSAEIEAQIDQLLAVGAGENPRESLSELAKLGARLIIQRAVED |
| Ga0126313_113225012 | 3300009840 | Serpentine Soil | VRRTVPPSAEIEAQIDQLLAVGVGDNPRESLSELARLGARLIIQRAVEDEFD |
| Ga0126313_113678712 | 3300009840 | Serpentine Soil | VRRTVPPSAEIEARIDQLLAVGVGENPRETLSELAK |
| Ga0126305_100440112 | 3300010036 | Serpentine Soil | VRRTVPPSAELEEQIDQLLAVGVGESPRESLSELAKLGARLIIQRAVEDE* |
| Ga0126305_105437131 | 3300010036 | Serpentine Soil | VRRTLSPSAEIENQIDQLLAVGVGENPRQSLSELAKLGARLII |
| Ga0126304_100245997 | 3300010037 | Serpentine Soil | VRRTLPPSAEIESQIDRLLAVGVGENARRSLSGLAKLGA |
| Ga0126304_100457122 | 3300010037 | Serpentine Soil | VSRTVPPSAEIEDRIDRLLAVGVGEGPGESLSELARLGARLIIQRAVQDEFGRLAGPRQV |
| Ga0126304_111844161 | 3300010037 | Serpentine Soil | VRRTVPPSAELEEQIDQLLAVGVGESPRESLSELAKLGARLSIQRAVEDE* |
| Ga0126315_100909343 | 3300010038 | Serpentine Soil | VRRTVPPSAEIEEQIDRLLAVGVGENPRESLSELA* |
| Ga0126315_101284511 | 3300010038 | Serpentine Soil | VRRTVPRSAEIEARIEDLLAVGVAEDRHGALSKLAKLGARLIIQR |
| Ga0126315_103546852 | 3300010038 | Serpentine Soil | VRRTVPPSAEIEARIERLLAVGVGENPRESLSELARLGARLII |
| Ga0126315_103562251 | 3300010038 | Serpentine Soil | VRRTVPPSAEIEERIERLLAVGVGENPRESLSELARLGARLIIQRAV |
| Ga0126315_103628031 | 3300010038 | Serpentine Soil | VRRTVPPSAEIEAQIDELLAVGVGENPRDSLSELAKLGARLI |
| Ga0126315_105051272 | 3300010038 | Serpentine Soil | VRRTVPPSAEIEEQIDRLLAVGVGENPRESLSELAKLGARLIIQRAVEDEFDA |
| Ga0126315_107380131 | 3300010038 | Serpentine Soil | VRRTVPPSAEIEAQIDQLLAVGVGENPRESLSELARL |
| Ga0126309_104681692 | 3300010039 | Serpentine Soil | VRRTVPPSAEIEEQIDRLLAVGVGENPREALSELAKLG |
| Ga0126308_100692081 | 3300010040 | Serpentine Soil | LKEDLAVRRTVPPSAEIEERIDRLLAVGVGESPRESLSE |
| Ga0126308_103114262 | 3300010040 | Serpentine Soil | VRRTVPPSAEVEEQIDQLLAVGVGENPRESLSELAKLGARLIIQRAAET* |
| Ga0126308_105841521 | 3300010040 | Serpentine Soil | VRRTVPPSAEIEQQIDALLAVGVGENSRAALSELAKLGARLIIQ |
| Ga0126308_106338512 | 3300010040 | Serpentine Soil | VRRTVPPSAQIDQLLAVGVGDNPRESLSELAKLGARLI |
| Ga0126308_107311272 | 3300010040 | Serpentine Soil | VRRTVPPSAEIEDQIDTLLAVGVGENPREALSELAKLGARLIIQ |
| Ga0126312_100499864 | 3300010041 | Serpentine Soil | VRRTVPPSAEIEEQIDRLLAVGVGENPRESLSELA |
| Ga0126312_100783204 | 3300010041 | Serpentine Soil | VRRTVAPSAEIEAQIDQLLAVGVGDNPRESLSELAKLGA |
| Ga0126312_100836801 | 3300010041 | Serpentine Soil | MKEAYAVRRTVPPSAEIEERIDQLLAVGVGENPRESLSELAKL |
| Ga0126312_107176971 | 3300010041 | Serpentine Soil | VRRTVPPSAEIEERIDKLLSVGVGENPRESLSELARLGARLIIQ |
| Ga0126314_101540683 | 3300010042 | Serpentine Soil | VRRTVPPSAEIEEQIDRLLAVGVGENPRESLSELAKLGARLIIQR |
| Ga0126314_106125861 | 3300010042 | Serpentine Soil | VRRTVPPSAEIEAQIDRLLAVGVGDNPRESLAELARLGARLIIQR |
| Ga0126310_109779272 | 3300010044 | Serpentine Soil | VRRTVPPSAEIEAQIDRLLVVGVGENPRESLAELVRLGARLII* |
| Ga0126310_116425302 | 3300010044 | Serpentine Soil | MKEAYAVRRTVPPSAEIEAQIDELLAVGVGDNPRESLSELAKLGAR |
| Ga0127460_11395171 | 3300010114 | Grasslands Soil | MKEAYAVRRTVPPSAELEAQIDQLLAVGVGEDPRAALSQLAKL |
| Ga0134067_101439721 | 3300010321 | Grasslands Soil | VRRTVPPSAEIEEQIDQLLAVGVGENPRQSLSVRSLN |
| Ga0134111_101720771 | 3300010329 | Grasslands Soil | VRRTVPPSAEIEEQIDALLAVGVGENPREALSELAKL |
| Ga0074045_104286501 | 3300010341 | Bog Forest Soil | MKEAYAVRRTVPPSAEIEDQIDELLAVGVGENPRESLSGLAKLGARLIIQ |
| Ga0126378_129764521 | 3300010361 | Tropical Forest Soil | VRRTVPPSAEIEEQIDQLLAVGVGDHPRESLSELAKLAG* |
| Ga0126381_1046101541 | 3300010376 | Tropical Forest Soil | VRRTVPPSAEIEAQIDELLAVGVGDNPRESLSVLARL |
| Ga0136449_1002507691 | 3300010379 | Peatlands Soil | LKEAYAVRRTVPPAAEIEDQNERLVAVGVVEDPRESLSGPAKLGARL |
| Ga0134126_112993681 | 3300010396 | Terrestrial Soil | MKEAYAVRGTVPPSAEIEARIEHMLSVGVGENPRESLSELARLGALLIIQRAVE |
| Ga0134126_124424081 | 3300010396 | Terrestrial Soil | MKEAYAVRRTVPPSAEIQAEIDKLLGKSLADDPQKMLSELARLGARLIIQRAVEDE |
| Ga0120192_100532391 | 3300012021 | Terrestrial | VRRTVPPSAEIEEQIDRLLAVGVGEHPREALSELAR |
| Ga0137364_110556592 | 3300012198 | Vadose Zone Soil | VRRTVPPSAEIEEQIDQLLAVGVGENPRESLSELAK |
| Ga0137374_104056831 | 3300012204 | Vadose Zone Soil | MKEAYAVKRTVPPSAEIEEQIDRLLAVGVGENPREALSEL |
| Ga0137380_113484431 | 3300012206 | Vadose Zone Soil | VRRTVPPSAEIEDQIDELLAVGVGENPRESLSGLAKLGARLIIQR |
| Ga0137380_116513881 | 3300012206 | Vadose Zone Soil | VRRTVPPSAEIEEQIDELLAVGAGENPREALSGLAKLGARLIIQRAV |
| Ga0137377_102235434 | 3300012211 | Vadose Zone Soil | LKEAYAVRRTVPPSAEIEEQIDQLLAVGVGENPRESLSSLA |
| Ga0137377_103712223 | 3300012211 | Vadose Zone Soil | VRRTVPPSAEIEEQIDQLLAVGVGENPRESLSELAKLGARLIIQRAVE |
| Ga0150985_1075512062 | 3300012212 | Avena Fatua Rhizosphere | VRRTVPPSAEIEERIDRLLAVGVGENPRESLSELAKLGRV* |
| Ga0150985_1107056452 | 3300012212 | Avena Fatua Rhizosphere | VRRTVPPSAEIEEQIDRLLAVGVGENPRESLSELAKLGARLII* |
| Ga0150985_1216756452 | 3300012212 | Avena Fatua Rhizosphere | MKEAYAVRRTVPPSAELEAQIDQLVAVGVGEDPHAALSQL |
| Ga0137370_110292431 | 3300012285 | Vadose Zone Soil | MKEAYAVRRTVPPSAEIEEQIDQLLAVGVGENPRESLSGLAKLGARLIIQ |
| Ga0137372_108395402 | 3300012350 | Vadose Zone Soil | MKEAYAVRRTVPPSAEIEEQIDELLAVGVGENPRESLSELAKLGARLII |
| Ga0137369_106381102 | 3300012355 | Vadose Zone Soil | MKEAYAVRRTVPPSAEIEEQIDQLLAVGVGENPRESLSELARPGARLIIRRAVEDEFDA* |
| Ga0137375_101902971 | 3300012360 | Vadose Zone Soil | VRRTVPPSAEIEAQIDQLLAVGVGENPRESLSELARLGARLIIQRAVE |
| Ga0137375_112299322 | 3300012360 | Vadose Zone Soil | MKEAYAVRRTVPPSAEIEEQIDRLLAVGVGENPRESLSELAKLGARLIIQRAVED |
| Ga0134049_11343822 | 3300012403 | Grasslands Soil | VRRTVPPSAEIEAQIDRLLAVGVGENPRESLSELAKLGARLII |
| Ga0134045_11588511 | 3300012409 | Grasslands Soil | MKEAYAVRRTVPPSAEIEAQIDQLLAVGVGEDPRAALSQLAK |
| Ga0150984_1017834002 | 3300012469 | Avena Fatua Rhizosphere | VRRTVPPSAEIEERIDRLLAVGVGENPRESLSELARLGARLIIQRAVE |
| Ga0157326_10837191 | 3300012513 | Arabidopsis Rhizosphere | VRRTVPPSAEIEDQIDELLAVGVGENPRESLSELAKLGARLI |
| Ga0164300_107648721 | 3300012951 | Soil | MKEAYAVRRTVPPSAEIEARIEQMLSVGVGEHPRESLSELAKLGARLIIQRAVEDEFDAW |
| Ga0134110_101988881 | 3300012975 | Grasslands Soil | MKEAYAVKRTVPPSAEIEEQIDQLLAVGVGENPRESLSELAKLGARL |
| Ga0134087_104374702 | 3300012977 | Grasslands Soil | VRRTVPPSAEIEARIEHMLSVGVGENPRESLSELAR |
| Ga0164304_110801381 | 3300012986 | Soil | MKEAYAVRRTVPPSAEIQASIDKLLSKGMVDDPQKMLSELARLGARLIIQRAV |
| Ga0164306_117188141 | 3300012988 | Soil | VRRTVPPSAEIEERIDRLLAVGVGENPRESLSELAK |
| Ga0169969_10448192 | 3300013013 | Rock | VGRTVPPSEIEERITQLPAVGVGENPREALPELAKLGAR* |
| Ga0157307_11468051 | 3300013096 | Soil | VRRTLPPSAEIEEQIDGLLGVGVGENPRESLSELAKLGARLIIQRAVEDEFDV* |
| Ga0157372_127551371 | 3300013307 | Corn Rhizosphere | MKEAYAVRRTVPPSAEIEARIEHMLSVGVGESPRESLS |
| Ga0120172_10639772 | 3300013765 | Permafrost | MKEAYAVRRTVPPSAEIEARIEHMLSVGVGESPRESLSELAK |
| Ga0182024_100731986 | 3300014501 | Permafrost | VRRTVPPSAEIEDQIDELLAVGVGENPREALSGLAKLGARLIIQRAVEDEFDAWL |
| Ga0181516_107002352 | 3300014655 | Bog | MSCKTMKEAYAVRRTVPPSAEIEARIEHMLSVGLGENPRESLSEPARLGARLII |
| Ga0120160_10558811 | 3300014820 | Permafrost | MKEAYAVRRTVPPSAEIQASIDKLLGKGMVDDPQKMLSELARLGARLIIQRAVED |
| Ga0182030_106785011 | 3300014838 | Bog | MSCKTTKEAYAVKRTVPPSAEIQANIDKLLSGGVVEDPSKMLSELARLGARLIIQR |
| Ga0182030_116074842 | 3300014838 | Bog | MSCKTMKEAYAVRGTVPPSAEIEARIEQMLSVGVGEHPRESLSELAKLGARLII* |
| Ga0157376_128887542 | 3300014969 | Miscanthus Rhizosphere | VRRTVPPSAEIEEQIDRLLAVGVGENPRESLSELAKLGARLIIQRAV |
| Ga0137405_13786284 | 3300015053 | Vadose Zone Soil | VRRTVPPSAEIEEQIDRLLAVGVGENPRESLSELAKLG |
| Ga0137420_13331027 | 3300015054 | Vadose Zone Soil | VRRTVPPSAEIEEQIDQLLAVGLVRNPRQSLSELTREAGRKADHPAGCGDEFDAWLGRRLV* |
| Ga0173483_100791571 | 3300015077 | Soil | VRRTVAPSAELGARIDELFAVGVGENPRGSLRPQRR |
| Ga0173478_106940631 | 3300015201 | Soil | VLSTSAEIEAQIDQLLAVGVGESPRESLSELARLGARLIIQRAVEDE |
| Ga0132256_1021253141 | 3300015372 | Arabidopsis Rhizosphere | MKEAYAVRRTVPPSAEIEAQIDALLAVGVGEHPREALSELAKLGARLIIQRAVEDEFDAW |
| Ga0182041_117035821 | 3300016294 | Soil | MKEAYAVRRTVPPSAEIEEQIDNLLAVGVGDDPRESLSELARLGARLIIQR |
| Ga0182037_105431522 | 3300016404 | Soil | MKEAYAVRRTVPPSAEIEEQIENLLAVGVGENPRESLSELARLGA |
| Ga0182039_108084313 | 3300016422 | Soil | MKEAYAVRRTVPPSAEIQASIDKLLSKGMVDDPTKMLSELARLGARLIIQRAVED |
| Ga0182038_108808301 | 3300016445 | Soil | VRRTVPPSAEIQASIEKLLGKEMVDDPQRMLSELARLGARLIIQRAVEE |
| Ga0163161_107080061 | 3300017792 | Switchgrass Rhizosphere | VRRTVPPSAEIEEQIDRLLAVGVGVPRESLSELARLGARLIIQRAL |
| Ga0187821_102297891 | 3300017936 | Freshwater Sediment | VRRTVPPSAEIEAQIDELLAVGVGDNPRESLSELARLGARLIIQRAVEDEF |
| Ga0187808_103335221 | 3300017942 | Freshwater Sediment | VRRTVPPSAEIEEQIDKLLAVGVGENPRESLSDLAKLVAR |
| Ga0187779_100805551 | 3300017959 | Tropical Peatland | VRGTVRPSAEIEAQVDQLLAVGVGENPRETLSELAKLGARLIIQRAVEDGF |
| Ga0187779_101651981 | 3300017959 | Tropical Peatland | VRRTLPPSAEIEARIDQLLAVGVGEDPRQTLSELARLGARLIIQRAVEDEF |
| Ga0187778_100827842 | 3300017961 | Tropical Peatland | RTVPPSAEIETQIDQLLAVGVGENPRETLSELARLGARLIMEERLSSEQR |
| Ga0187778_101128671 | 3300017961 | Tropical Peatland | VRRTVPPSAEIEAQIDQLLAVGVGENPRETLSELARLGARLIIQRAVEDEF |
| Ga0187778_101497513 | 3300017961 | Tropical Peatland | VRRTVPPSAEIETQIDQLLAVGVGENPRETLSELARLGARLI |
| Ga0187778_109496451 | 3300017961 | Tropical Peatland | VRRTVPPSAEIEAEIDQLLAVGVGENPRETLSELAK |
| Ga0187776_102330242 | 3300017966 | Tropical Peatland | MKEAYAVRRTVPPSAEIQASIDKLLSKGMVDDRQKMLGELARLGARLIIQRAVEDEF |
| Ga0187780_101592931 | 3300017973 | Tropical Peatland | VRGTVRPSAEIEAQVDQLLAVGVGENPRETLSELAKLGARLIIQ |
| Ga0187780_107833562 | 3300017973 | Tropical Peatland | VRRTVPPSAEIEARIDQLLAVGVGENPRHTLSELAKLGARLIIQRAV |
| Ga0187777_105457762 | 3300017974 | Tropical Peatland | VSRTVPPSAEIEARIDQLLAVRGENPRQTLSELAK |
| Ga0187777_109222641 | 3300017974 | Tropical Peatland | VRGTVPPSAEIEARIEQLLAVGVGDNPRETLSELARLGARLIIQRAVEDEFDAW |
| Ga0187777_110056051 | 3300017974 | Tropical Peatland | LKEAYAVRGTVRPSAEIEAQVDQLLAVGVGENPRETLSELAKLGAR |
| Ga0187863_104868211 | 3300018034 | Peatland | VRRTVPPSAEIEDQIDQLLAVAVGENPRESLSSLAKLGARLIIQRAVEDEF |
| Ga0187766_101278421 | 3300018058 | Tropical Peatland | KEAYAVRRTVPPSAEIEAQIEQLLAVGVGDNPRESLSDLAKLGARLITELAWD |
| Ga0187766_104918171 | 3300018058 | Tropical Peatland | MREAYAVRRTVPPSAEIEAQIDELLAVGVGENPRESLSGLAR |
| Ga0187766_107774061 | 3300018058 | Tropical Peatland | VRRTVPPSSEIQASIDKLLSRGMVDDPEKMLSQLARLGARLIIQRAVE |
| Ga0187766_110490791 | 3300018058 | Tropical Peatland | MKEAYAVRRTVPPSAEIEAQIDELLAVGVGENPRESLSGLAR |
| Ga0187766_112180221 | 3300018058 | Tropical Peatland | MKEAYAVIRTVPPSAEIEARIEQMLSVGVGENPRESLSELVKLGAHLIIQRAVEHEFDAW |
| Ga0187773_105645311 | 3300018064 | Tropical Peatland | MKEAYAVRRTVPPSAEIEAQIDQLLAVGVGENPRESLSELARLGAG |
| Ga0187774_107915411 | 3300018089 | Tropical Peatland | VKRTLPPSAEIEVQIDQLLAVGVGESPRESLSELAKLGARLIIQRAVEDEFDAWL |
| Ga0190265_104256542 | 3300018422 | Soil | VRRTVPPSAEIEERIDALLAVGVGETPREALSELAKL |
| Ga0190269_117738671 | 3300018465 | Soil | VRRTVPPSAEIEAQIDQLLAVGGGEHPREALSELAKLGARLIIQRA |
| Ga0190268_101932351 | 3300018466 | Soil | VRRTVPPSAEIEERIDQLLAVGVGENPRESLSELAKLGARLIIQRAVEDEFDAWL |
| Ga0066662_117035422 | 3300018468 | Grasslands Soil | VRRTVPPSAEIEKRIDELLAVGVAAEDPKGALSELAQ |
| Ga0190270_108967521 | 3300018469 | Soil | MKEAYAVRRTVPPSAEIEAQIDQLLAVGVGENPHESLSELARLGARLIIQRAVEDE |
| Ga0190270_112240171 | 3300018469 | Soil | VRRTVPPSAVIEEQIDELLAVGVGENPRESLSELARLGARLIIQRAVEDEFDAWL |
| Ga0190274_108422042 | 3300018476 | Soil | VRRTVPPSAEIEGQIDELLAVGVGENPRESLSKLAK |
| Ga0190274_129738361 | 3300018476 | Soil | VRRTVPPSAEIEVQIDRLLAVGVGEHPREALSELARLGARLIIQRAVEDEFDAWL |
| Ga0173481_101242961 | 3300019356 | Soil | VRRTVPPSAEIEERIDRLLAVGVGENPRESLSELARLG |
| Ga0196959_101087811 | 3300021184 | Soil | VRRTVPPSAEIEEQIDQLLAVGVGENPRESLSELAKLGARLIIQRAVEDEFDA |
| Ga0224557_12014461 | 3300023101 | Soil | MKEAYAVRRTVPPSAEIEARIEHMLSVGVGESPRESLSELARLGA |
| Ga0224551_10523801 | 3300023259 | Soil | MKEAYAVRRTVPPSAEIEASIDKLLSRRMVDEPQKMLSELARLGARLIIQRAV |
| Ga0208714_10422662 | 3300025527 | Arctic Peat Soil | MKEAYAVRRTVPLSAEIEARIERMLSVGVGENPRVVV |
| Ga0208220_10950361 | 3300025627 | Arctic Peat Soil | VRRTVPPSAEIQASIDKLLGKGMVDDPQKMLSELARLGARLIIQRAVE |
| Ga0207700_115829301 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MKEAYAVRRTVPPSAEIEARIEHMLSVGVGENPRESLSEL |
| Ga0207690_105232612 | 3300025932 | Corn Rhizosphere | VRRTVPPSAEIEEQIDRLLAVGVGENPRESLSELAKLGARLIIQRAL |
| Ga0207686_100610812 | 3300025934 | Miscanthus Rhizosphere | RRSYAVRRTVPPSAEIEEQIDRLLAVGVGVPRESLSELARLGARLIIQRAL |
| Ga0207689_100233475 | 3300025942 | Miscanthus Rhizosphere | VRRTVPPSAEIEEQIDRLLAVGVGVPRESLSELARLGARLIIQH |
| Ga0207639_110769231 | 3300026041 | Corn Rhizosphere | VRRTVPPSAEIEEPIDRLLAVGVGENPRESLSELAKLGARLIIQRAL |
| Ga0207702_121658811 | 3300026078 | Corn Rhizosphere | VRRTVPPSAEIEDQIDALLAVGVGENPRESLSELAK |
| Ga0207648_112156681 | 3300026089 | Miscanthus Rhizosphere | VKRTLPPSAEKEEQIDRLLAVGVGENPRESLSELAKLGARLIIQRAVEDEFDAWRH |
| Ga0209802_11193001 | 3300026328 | Soil | VRRTVPPSAEIEEQIDELLAVGVGENPRESLSGLAKLG |
| Ga0209059_12819271 | 3300026527 | Soil | VRRTVPPSAEIEARIEHMLSVGVGENARESLSELARLGARLIIQRA |
| Ga0208199_11119181 | 3300027497 | Peatlands Soil | MKEAYAVRRTVPPSAEIQANIDKLLASWPVDDPQKMLSELARLGARLIIQRAGQEEFDS |
| Ga0209734_10219663 | 3300027535 | Forest Soil | VRRTVPPSAEIEDQIDQLLAVGVGENPRESLSGLAKLGARLIIQRAVEDE |
| Ga0208324_11427571 | 3300027604 | Peatlands Soil | VRRTVPPSAEIEARIEQMLSVGVGENPREMLSELAKLGARLIIQRAVEDEFDVW |
| Ga0208696_11538712 | 3300027696 | Peatlands Soil | VRRTVPPSAEIQASIDKLLSRGMVDDPQKMLSELARLGARLIIQRAVE |
| Ga0209819_103513142 | 3300027722 | Freshwater Sediment | VRRTVPPSAEIEEQIDQLLAVGVGENPRESLSELAKLGARLIIQR |
| Ga0207428_103751592 | 3300027907 | Populus Rhizosphere | VRRTVPPSAEIEEQIDRLLFVGVGENPRESLSELAKLGARLIIQRAV |
| Ga0209061_11223361 | 3300027968 | Surface Soil | VRRTVPPSAEIEAKIDGLLAGGLASEDPQGALSELAALGARLII |
| Ga0137415_103472481 | 3300028536 | Vadose Zone Soil | VRRTVPPSAEIEGQIDRLLAVGVGENPRESLSELAKLGARLIIQRAVEDEFDA |
| Ga0307276_101863911 | 3300028705 | Soil | VRRTLPPSAEIEAQIDQLLAVGVGENPRQSLCELAKLGARLIIQRPVQD |
| Ga0307293_100435401 | 3300028711 | Soil | VRRRVPPSAEIEEQIDRLLAVGVGESPREALSELARLGARLIIQR |
| Ga0307303_100879302 | 3300028713 | Soil | VRRTLPPSAEIEAQIDQLLAVGVGENPRQSLCELAKL |
| Ga0302205_100914052 | 3300028739 | Fen | VRRTVPPSAEIEARIEQMLSVGVGENPRETLSELAKL |
| Ga0302220_1000005047 | 3300028742 | Palsa | MKEAYAVRRTVPPSAEIEARIEHMLSVGVGENPRESLSELAKLGRV |
| Ga0307318_103769481 | 3300028744 | Soil | VRRTVPPSAEIEEQIDAVLAVGVGENPRESLSELAKLG |
| Ga0307316_100883391 | 3300028755 | Soil | VKRTLPPSAEIEEQIDQLLAVGVGENPRESLSELAKLGARLIIQRAVEDE |
| Ga0307280_104098071 | 3300028768 | Soil | VRRTLPPSAEIENQIDELLAVGVGENPRRSLSELAKLGARLIIQRAVEDE |
| Ga0302303_100986132 | 3300028776 | Palsa | PKSCKTMKEAYAVRRTVPPSAEIEARIEHMLSVGVGENPRESLSELAKLGRV |
| Ga0307290_101446032 | 3300028791 | Soil | VRRTVPPSAEIEEQIDRLLAVGVGENPRESLSELAK |
| Ga0307294_100741021 | 3300028810 | Soil | VRRTVPPSAEIEAQIDQLLAVGVGENPREPLSELARLGARLI |
| Ga0307302_100640231 | 3300028814 | Soil | VRRTVPPSAEIEAQIDQLLAGGVGENPRESLSELAKLGARLIIQRAVEDEFDAWL |
| Ga0307308_105385001 | 3300028884 | Soil | VRRTLPPSAEIEAQIDQLFAVGVGENPRQSLSELAKLGARLIIQCAVEDEFD |
| Ga0299907_112132302 | 3300030006 | Soil | VRRTVPPSAEIEEQIDQLLAVGVGENPRESLSELARLGARLIIQRAVEDEFDAW |
| Ga0247826_104590131 | 3300030336 | Soil | VRRAVPPSAEIEEQIDRLLAVGVGEHPREALSELAKLGARLII |
| Ga0311370_104795902 | 3300030503 | Palsa | VRRTVPPSAEIQAEIDKLRASRLADDPQKLLSELARLGARLIIQRAVEDEFDQWLG |
| Ga0311372_111274871 | 3300030520 | Palsa | MKEAYAVRRTVPPSAEIRASIEKLLSRGSADDPQKMLSELARLGARLIIQRAVE |
| Ga0310038_104307421 | 3300030707 | Peatlands Soil | VRRTVPPSAEIEDRIDQLLAVGVGENPREALSELAK |
| Ga0308201_103056082 | 3300031091 | Soil | VRRTLPPSAEIEAQIDQLLAVGVGENPRESLSELAKLGARLIIQRAVEDEF |
| Ga0307500_101099031 | 3300031198 | Soil | VSRTVPPSAEIEEQIDRLLAVGVGENPRESLSELAKLGARLIIQRAV |
| Ga0307408_1007647671 | 3300031548 | Rhizosphere | VRRTVPPSAEIEEQTDRLLAVGVGENPRESLSELAKLG |
| Ga0307408_1015179872 | 3300031548 | Rhizosphere | VRRTVPPSAEIEAQIDRLLAVVVGENQRESLSGLARLGARLIIQRAVEH |
| Ga0318573_105884731 | 3300031564 | Soil | VRRTVPPSAEIEEQVDQLLAVGVGENPRESLSELAKLGARLIIQRAVEDEFDAW |
| Ga0318515_101377351 | 3300031572 | Soil | VRRTVPPSAEIEAQIETLLAVGVGENPRESLSELAK |
| Ga0318555_104396621 | 3300031640 | Soil | VRRTVPPSAEIEEQVDQLLAVGVGENPRESLSELA |
| Ga0307374_102510011 | 3300031670 | Soil | VRRTVPPSAEIQASIDKLLSRGSVDDPQKMLSELARLGARLIIQRAVEDE |
| Ga0307373_103552612 | 3300031672 | Soil | VRRTVPPSAEIEKKIDELLVAGLVAEDPQGTLSELAQLGA |
| Ga0318561_107864252 | 3300031679 | Soil | VRRTVPPSAEIEARIEHMLSVGVGENPRESLSELARLGARLIIQRAVEDE |
| Ga0310686_1169609231 | 3300031708 | Soil | VRRTVPPSAEIEEQIDQLLAVGVGENPRESLSSLAKLGARLIIQRAVEDEFDAWLGARQV |
| Ga0318500_102841891 | 3300031724 | Soil | VRRTVPPSAEIEAQIETLLAVGVGENPRESLSELAKL |
| Ga0307405_103557772 | 3300031731 | Rhizosphere | LKEAYAVRRTVPPSAEIEEQTDRLLAVGVGENPRESLSELAKLGAG |
| Ga0307405_110327191 | 3300031731 | Rhizosphere | VRRTVPPSAEIEAQIDQLLAVGVGENPRESLSGLARLGARLIIQRAVEH |
| Ga0318498_100236221 | 3300031778 | Soil | VRRTVPPSAEIQASIDKLLGRELVDDPQEMLSELARLGARLIIQRAVED |
| Ga0318498_102842923 | 3300031778 | Soil | VRRTVPPSAEIEAQIDQLLAVGVGENPRETLSELARLGARLI |
| Ga0318529_105500762 | 3300031792 | Soil | VRRTVPPSAEIEAQIETLLAVGVGENPRESLSELAKLGARLTDSV |
| Ga0318568_101335291 | 3300031819 | Soil | VRRTVPPSAEIEAQIETLLAVGVGENPRESLSELAKLGARL |
| Ga0307410_103929012 | 3300031852 | Rhizosphere | VRRTVPPSAKIEAQIDRLLAVVVGENQRESLSGLARLGARLIIQRAVEH |
| Ga0318527_105111031 | 3300031859 | Soil | VRRTVPPSAEIETQIETLLAVGVGENPRESLSALAKLGARLIIQRA |
| Ga0306919_106098781 | 3300031879 | Soil | MKEAYAVRRTVPPSAEIQASIDKLLAKGMVDEPQRMLSELARLGARLIIQRAV |
| Ga0318536_105463431 | 3300031893 | Soil | VKRTLPPSAEIEAQIDQLLAVGVGENPRESLSELAKLGARLIIQRAVEDEF |
| Ga0318520_109358401 | 3300031897 | Soil | VRRTVPPSAEIEARIEHLLSVGVGENPRESLSVLARLGARLIIQRAVEDEFDA |
| Ga0307406_107309801 | 3300031901 | Rhizosphere | GSLKSWQTLKEAYAVRRTVPPSAEIEEQTDRLLAVGVGENPRESLSELAKLGAG |
| Ga0307407_113359861 | 3300031903 | Rhizosphere | VRRTVPPSAEIEERIDRLLAVGVGENPRESLSELARLGAR |
| Ga0307412_109918483 | 3300031911 | Rhizosphere | VRRTVPPSAVIEEQIDELLAVGVGENPRESLSELARLGARL |
| Ga0311367_123238432 | 3300031918 | Fen | MKEAYAVRRTVPPLAEIEARIEQMLSVGVGENPRESLSELAKLGARLIIQRAVEDGFDAS |
| Ga0310916_102471553 | 3300031942 | Soil | VRRTVPPSAEIEEQIDKLLAVGVGDDPRESLSELARLGA |
| Ga0307479_119339091 | 3300031962 | Hardwood Forest Soil | MKEAYAVRRTVPPSAEIEDQIDELLAVGVGENPRESLSDLAKLGARLILQRAVEDQFNAWLG |
| Ga0307409_1021161801 | 3300031995 | Rhizosphere | VRRTVPPSAEIEEQIDRLLAVGVGENPRESLSELAKLGARLIIQRA |
| Ga0318559_102566792 | 3300032039 | Soil | VRRTVPPSAEIETQIETLLAVGVGENPRESLSALAKLGARLIIQRAVED |
| Ga0318556_106607712 | 3300032043 | Soil | VRRTVPPSAEIEEQVDQLLAVGVGENPRESLSKLAK |
| Ga0318532_102224391 | 3300032051 | Soil | VRRTVPPSAEIEAQIETLLAVGVGENPRQSLSELARLGARLIIQRAVEE |
| Ga0318533_110591422 | 3300032059 | Soil | VRRTVPPSAEIEARIEHLLSVGVGENPRESLSVLA |
| Ga0306924_105252621 | 3300032076 | Soil | VRRTVPPSAEIEAQIDELLAVGVGDNPRESLSVLARLGARLIIQRAVEDEFDGWL |
| Ga0307415_1000038418 | 3300032126 | Rhizosphere | VRRTVPPSAEIEEQTDRLLAVGVGENPRESLSELAKLGAG |
| Ga0307415_1024587741 | 3300032126 | Rhizosphere | VRRTVPPSAEIEAQIDRLLAVGVGENPRESLSELARLGARLII |
| Ga0311301_1003721211 | 3300032160 | Peatlands Soil | VKRTLPPSAETGEQIDQLLAVGVGENPRESLSELAKLGAL |
| Ga0311301_126693742 | 3300032160 | Peatlands Soil | VRRTVPPSAEIEDQIDELLAVGVGENPREQTEPTL |
| Ga0306920_1000953841 | 3300032261 | Soil | LKEAYAVRRTVPPSAEIEAQIDELLAVGVGDNPRESLSVLARLGARLIIQRAVEDEFDGWLGR |
| Ga0335078_1004123512 | 3300032805 | Soil | VRRTVPPSAEIEAQIEQLLAVGVGENPRESLSELARLG |
| Ga0335081_100460201 | 3300032892 | Soil | VRRTVPPSAEIEAQIEQLLAVGVGENPRESLSELARLGARL |
| Ga0335081_112055552 | 3300032892 | Soil | VRRTVPPSAEIQASIDRLLASKMVDDPSQMLSELARLGARLIIQR |
| Ga0335074_100476691 | 3300032895 | Soil | VRRTVPPSAEIEARIEQLLAVGVGDNPRESLSELAKLGARLIIQ |
| Ga0335074_107612252 | 3300032895 | Soil | MKEAYAVRRTVPPSAEIEDQIEKLLAVGVSENPRESL |
| Ga0335073_100260391 | 3300033134 | Soil | VRLAVPSSPEIEEQIENLSAVWVGENPRETLSELARLDAADHPAG |
| Ga0318519_101617011 | 3300033290 | Soil | VRRTVPPSAEIEAQIETLLAVGVGENPRESLSELAKLGARLIIQRAVEDEFDA |
| Ga0318519_109520601 | 3300033290 | Soil | MKEAYAVRRTVAPSAEIQARIERVLAVGVGESPRESLSELAKLGALLIIQR |
| Ga0247830_102394382 | 3300033551 | Soil | VRRAVPLSAEIEEQIDWLLAVGVGEHPREALSELAKLGARLII |
| Ga0314867_044554_1_171 | 3300033808 | Peatland | MKEAYAVRRTVSPSAEIETRIEQLLAVGVGENPRESLSELARLGARLIIQRAVEDEF |
| Ga0364935_0304677_399_524 | 3300034151 | Sediment | LKEAYAVRRTVPASAEIEERIDRLLAVGVGENPRESLSELAR |
| Ga0372943_0839370_1_168 | 3300034268 | Soil | MSWQTMKEAYAVRRTVPPSSEIQASIDKLMSEGVVDDPQKMLSELARLGARLIIQR |
| ⦗Top⦘ |