| Basic Information | |
|---|---|
| Family ID | F013517 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 270 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MFESLFAAVLPVMKDLLWAAAGMLLTYVLNKFQSQFN |
| Number of Associated Samples | 125 |
| Number of Associated Scaffolds | 270 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 15.19 % |
| % of genes from short scaffolds (< 2000 bps) | 65.19 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (57.778 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (37.037 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.222 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (56.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.85% β-sheet: 0.00% Coil/Unstructured: 46.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 270 Family Scaffolds |
|---|---|---|
| PF13392 | HNH_3 | 11.11 |
| PF00436 | SSB | 3.70 |
| PF00210 | Ferritin | 3.70 |
| PF13640 | 2OG-FeII_Oxy_3 | 2.22 |
| PF00476 | DNA_pol_A | 1.11 |
| PF16363 | GDP_Man_Dehyd | 0.74 |
| PF13385 | Laminin_G_3 | 0.74 |
| PF02945 | Endonuclease_7 | 0.74 |
| PF05565 | Sipho_Gp157 | 0.37 |
| PF13936 | HTH_38 | 0.37 |
| PF01728 | FtsJ | 0.37 |
| PF00847 | AP2 | 0.37 |
| PF01041 | DegT_DnrJ_EryC1 | 0.37 |
| PF14284 | PcfJ | 0.37 |
| PF02511 | Thy1 | 0.37 |
| PF08707 | PriCT_2 | 0.37 |
| PF00589 | Phage_integrase | 0.37 |
| PF08291 | Peptidase_M15_3 | 0.37 |
| COG ID | Name | Functional Category | % Frequency in 270 Family Scaffolds |
|---|---|---|---|
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 3.70 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 3.70 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 1.11 |
| COG0293 | 23S rRNA U2552 (ribose-2'-O)-methylase RlmE/FtsJ | Translation, ribosomal structure and biogenesis [J] | 0.37 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.37 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.37 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.37 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.37 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.37 |
| COG1189 | Predicted rRNA methylase YqxC, contains S4 and FtsJ domains | Translation, ribosomal structure and biogenesis [J] | 0.37 |
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.37 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.37 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 57.78 % |
| All Organisms | root | All Organisms | 42.22 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10004132 | Not Available | 8169 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10013442 | Not Available | 4164 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10036459 | Not Available | 2252 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10082444 | Not Available | 1268 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10172373 | Not Available | 718 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_108178040 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1184 | Open in IMG/M |
| 3300002408|B570J29032_109844638 | Not Available | 1608 | Open in IMG/M |
| 3300003860|Ga0031658_1004730 | Not Available | 2380 | Open in IMG/M |
| 3300004240|Ga0007787_10110158 | Not Available | 1294 | Open in IMG/M |
| 3300005525|Ga0068877_10646110 | Not Available | 571 | Open in IMG/M |
| 3300005527|Ga0068876_10000190 | Not Available | 47410 | Open in IMG/M |
| 3300005527|Ga0068876_10050498 | Not Available | 2536 | Open in IMG/M |
| 3300005527|Ga0068876_10701392 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 541 | Open in IMG/M |
| 3300005805|Ga0079957_1018498 | Not Available | 4944 | Open in IMG/M |
| 3300005805|Ga0079957_1073408 | All Organisms → Viruses → Predicted Viral | 1965 | Open in IMG/M |
| 3300005805|Ga0079957_1269744 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 780 | Open in IMG/M |
| 3300006025|Ga0075474_10001080 | Not Available | 11185 | Open in IMG/M |
| 3300006025|Ga0075474_10098183 | Not Available | 948 | Open in IMG/M |
| 3300006026|Ga0075478_10043691 | Not Available | 1477 | Open in IMG/M |
| 3300006026|Ga0075478_10047392 | Not Available | 1411 | Open in IMG/M |
| 3300006030|Ga0075470_10000613 | Not Available | 11436 | Open in IMG/M |
| 3300006030|Ga0075470_10000672 | Not Available | 10905 | Open in IMG/M |
| 3300006030|Ga0075470_10000759 | Not Available | 10230 | Open in IMG/M |
| 3300006030|Ga0075470_10005886 | Not Available | 3786 | Open in IMG/M |
| 3300006030|Ga0075470_10098729 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 874 | Open in IMG/M |
| 3300006030|Ga0075470_10138896 | Not Available | 714 | Open in IMG/M |
| 3300006637|Ga0075461_10045383 | Not Available | 1431 | Open in IMG/M |
| 3300006641|Ga0075471_10438135 | Not Available | 653 | Open in IMG/M |
| 3300006734|Ga0098073_1000518 | Not Available | 12963 | Open in IMG/M |
| 3300006734|Ga0098073_1000844 | Not Available | 9457 | Open in IMG/M |
| 3300006734|Ga0098073_1001076 | Not Available | 8147 | Open in IMG/M |
| 3300006734|Ga0098073_1003284 | Not Available | 3701 | Open in IMG/M |
| 3300006734|Ga0098073_1005816 | All Organisms → Viruses → Predicted Viral | 2468 | Open in IMG/M |
| 3300006734|Ga0098073_1008130 | All Organisms → Viruses → Predicted Viral | 1909 | Open in IMG/M |
| 3300006734|Ga0098073_1015437 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1204 | Open in IMG/M |
| 3300006734|Ga0098073_1029409 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 778 | Open in IMG/M |
| 3300006734|Ga0098073_1041466 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 627 | Open in IMG/M |
| 3300006734|Ga0098073_1052477 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 543 | Open in IMG/M |
| 3300006790|Ga0098074_1094002 | Not Available | 798 | Open in IMG/M |
| 3300006802|Ga0070749_10061558 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 2264 | Open in IMG/M |
| 3300006802|Ga0070749_10067027 | All Organisms → Viruses → Predicted Viral | 2157 | Open in IMG/M |
| 3300006802|Ga0070749_10213084 | Not Available | 1103 | Open in IMG/M |
| 3300006802|Ga0070749_10269525 | Not Available | 960 | Open in IMG/M |
| 3300006802|Ga0070749_10321753 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 864 | Open in IMG/M |
| 3300006802|Ga0070749_10386197 | Not Available | 774 | Open in IMG/M |
| 3300006802|Ga0070749_10441530 | Not Available | 714 | Open in IMG/M |
| 3300006870|Ga0075479_10242792 | Not Available | 716 | Open in IMG/M |
| 3300006916|Ga0070750_10323956 | Not Available | 655 | Open in IMG/M |
| 3300006919|Ga0070746_10089411 | Not Available | 1547 | Open in IMG/M |
| 3300007169|Ga0102976_1073094 | Not Available | 2129 | Open in IMG/M |
| 3300007212|Ga0103958_1128605 | Not Available | 1514 | Open in IMG/M |
| 3300007214|Ga0103959_1187602 | All Organisms → Viruses → Predicted Viral | 1355 | Open in IMG/M |
| 3300007344|Ga0070745_1089758 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1212 | Open in IMG/M |
| 3300007344|Ga0070745_1157093 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 859 | Open in IMG/M |
| 3300007538|Ga0099851_1014898 | Not Available | 3168 | Open in IMG/M |
| 3300007538|Ga0099851_1035805 | Not Available | 1978 | Open in IMG/M |
| 3300007538|Ga0099851_1077906 | Not Available | 1278 | Open in IMG/M |
| 3300007538|Ga0099851_1095244 | All Organisms → Viruses → Predicted Viral | 1137 | Open in IMG/M |
| 3300007538|Ga0099851_1113691 | Not Available | 1025 | Open in IMG/M |
| 3300007538|Ga0099851_1218124 | Not Available | 690 | Open in IMG/M |
| 3300007538|Ga0099851_1236836 | Not Available | 656 | Open in IMG/M |
| 3300007539|Ga0099849_1003394 | Not Available | 7350 | Open in IMG/M |
| 3300007540|Ga0099847_1126549 | Not Available | 768 | Open in IMG/M |
| 3300007541|Ga0099848_1000846 | Not Available | 14267 | Open in IMG/M |
| 3300007541|Ga0099848_1003355 | Not Available | 7445 | Open in IMG/M |
| 3300007541|Ga0099848_1004264 | Not Available | 6574 | Open in IMG/M |
| 3300007541|Ga0099848_1011066 | Not Available | 3977 | Open in IMG/M |
| 3300007541|Ga0099848_1046537 | Not Available | 1760 | Open in IMG/M |
| 3300007541|Ga0099848_1047150 | Not Available | 1745 | Open in IMG/M |
| 3300007541|Ga0099848_1067941 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1407 | Open in IMG/M |
| 3300007541|Ga0099848_1133503 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 929 | Open in IMG/M |
| 3300007541|Ga0099848_1210026 | Not Available | 695 | Open in IMG/M |
| 3300007541|Ga0099848_1282245 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 574 | Open in IMG/M |
| 3300007541|Ga0099848_1331272 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 517 | Open in IMG/M |
| 3300007542|Ga0099846_1003062 | Not Available | 6861 | Open in IMG/M |
| 3300007542|Ga0099846_1040509 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1779 | Open in IMG/M |
| 3300007542|Ga0099846_1057034 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1473 | Open in IMG/M |
| 3300007542|Ga0099846_1329850 | Not Available | 519 | Open in IMG/M |
| 3300007544|Ga0102861_1000040 | Not Available | 37422 | Open in IMG/M |
| 3300007960|Ga0099850_1120508 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1071 | Open in IMG/M |
| 3300007960|Ga0099850_1228189 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 724 | Open in IMG/M |
| 3300007960|Ga0099850_1237511 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 706 | Open in IMG/M |
| 3300007960|Ga0099850_1366156 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 538 | Open in IMG/M |
| 3300007960|Ga0099850_1371856 | Not Available | 533 | Open in IMG/M |
| 3300008055|Ga0108970_10334211 | Not Available | 21344 | Open in IMG/M |
| 3300008055|Ga0108970_10887406 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 628 | Open in IMG/M |
| 3300008055|Ga0108970_11628544 | Not Available | 1752 | Open in IMG/M |
| 3300008107|Ga0114340_1107386 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1104 | Open in IMG/M |
| 3300008107|Ga0114340_1245909 | Not Available | 551 | Open in IMG/M |
| 3300008114|Ga0114347_1035793 | Not Available | 2211 | Open in IMG/M |
| 3300008117|Ga0114351_1319113 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 721 | Open in IMG/M |
| 3300008259|Ga0114841_1008591 | Not Available | 5475 | Open in IMG/M |
| 3300008266|Ga0114363_1069180 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1346 | Open in IMG/M |
| 3300008266|Ga0114363_1189267 | All Organisms → Viruses → Predicted Viral | 1092 | Open in IMG/M |
| 3300008266|Ga0114363_1231297 | Not Available | 538 | Open in IMG/M |
| 3300008448|Ga0114876_1065969 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1561 | Open in IMG/M |
| 3300008448|Ga0114876_1201372 | Not Available | 671 | Open in IMG/M |
| 3300009009|Ga0105105_10051424 | Not Available | 1864 | Open in IMG/M |
| 3300009009|Ga0105105_10378501 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 784 | Open in IMG/M |
| 3300009009|Ga0105105_10532991 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 676 | Open in IMG/M |
| 3300009009|Ga0105105_11002586 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 519 | Open in IMG/M |
| 3300009075|Ga0105090_10011371 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 5320 | Open in IMG/M |
| 3300009124|Ga0118687_10161885 | Not Available | 803 | Open in IMG/M |
| 3300009165|Ga0105102_10001576 | Not Available | 7501 | Open in IMG/M |
| 3300009165|Ga0105102_10916782 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 506 | Open in IMG/M |
| 3300009168|Ga0105104_10415929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales | 749 | Open in IMG/M |
| 3300009169|Ga0105097_10180143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales | 1163 | Open in IMG/M |
| 3300009170|Ga0105096_10024648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales | 2932 | Open in IMG/M |
| 3300009239|Ga0103858_10104799 | Not Available | 708 | Open in IMG/M |
| 3300009450|Ga0127391_1000012 | Not Available | 31829 | Open in IMG/M |
| 3300009470|Ga0126447_1183921 | Not Available | 501 | Open in IMG/M |
| 3300009474|Ga0127390_1005308 | All Organisms → cellular organisms → Bacteria | 4016 | Open in IMG/M |
| 3300009492|Ga0127412_10046773 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 534 | Open in IMG/M |
| 3300010296|Ga0129348_1049058 | Not Available | 1523 | Open in IMG/M |
| 3300010297|Ga0129345_1162967 | Not Available | 802 | Open in IMG/M |
| 3300010299|Ga0129342_1014386 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 3297 | Open in IMG/M |
| 3300010354|Ga0129333_10003944 | Not Available | 13908 | Open in IMG/M |
| 3300010354|Ga0129333_10009693 | Not Available | 9099 | Open in IMG/M |
| 3300010354|Ga0129333_10014552 | Not Available | 7475 | Open in IMG/M |
| 3300010354|Ga0129333_10020327 | Not Available | 6310 | Open in IMG/M |
| 3300010354|Ga0129333_10023855 | Not Available | 5802 | Open in IMG/M |
| 3300010354|Ga0129333_10048191 | Not Available | 3999 | Open in IMG/M |
| 3300010354|Ga0129333_10127397 | Not Available | 2343 | Open in IMG/M |
| 3300010354|Ga0129333_10128536 | Not Available | 2331 | Open in IMG/M |
| 3300010354|Ga0129333_10193004 | Not Available | 1854 | Open in IMG/M |
| 3300010354|Ga0129333_10227895 | Not Available | 1688 | Open in IMG/M |
| 3300010354|Ga0129333_10242953 | Not Available | 1626 | Open in IMG/M |
| 3300010354|Ga0129333_10262680 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1553 | Open in IMG/M |
| 3300010354|Ga0129333_10357977 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1297 | Open in IMG/M |
| 3300010354|Ga0129333_10564295 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 992 | Open in IMG/M |
| 3300010354|Ga0129333_10833133 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 784 | Open in IMG/M |
| 3300010370|Ga0129336_10340423 | Not Available | 827 | Open in IMG/M |
| 3300010389|Ga0136549_10291068 | Not Available | 681 | Open in IMG/M |
| 3300014801|Ga0119946_1023016 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 642 | Open in IMG/M |
| 3300017747|Ga0181352_1001528 | Not Available | 8976 | Open in IMG/M |
| 3300017747|Ga0181352_1058726 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1105 | Open in IMG/M |
| 3300017785|Ga0181355_1286065 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 623 | Open in IMG/M |
| 3300017963|Ga0180437_10109173 | Not Available | 2319 | Open in IMG/M |
| 3300017967|Ga0181590_10031446 | Not Available | 4272 | Open in IMG/M |
| 3300017969|Ga0181585_10127811 | Not Available | 1879 | Open in IMG/M |
| 3300018421|Ga0181592_10452537 | Not Available | 896 | Open in IMG/M |
| 3300019765|Ga0194024_1007390 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 2270 | Open in IMG/M |
| 3300019784|Ga0181359_1097798 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1080 | Open in IMG/M |
| 3300020074|Ga0194113_10119100 | All Organisms → Viruses → Predicted Viral | 2261 | Open in IMG/M |
| 3300020074|Ga0194113_10457677 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 925 | Open in IMG/M |
| 3300020151|Ga0211736_10198408 | Not Available | 1328 | Open in IMG/M |
| 3300020159|Ga0211734_11280883 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 833 | Open in IMG/M |
| 3300020160|Ga0211733_10372490 | All Organisms → Viruses → Predicted Viral | 1927 | Open in IMG/M |
| 3300020161|Ga0211726_10980175 | All Organisms → Viruses → Predicted Viral | 1737 | Open in IMG/M |
| 3300020161|Ga0211726_11051043 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 589 | Open in IMG/M |
| 3300020204|Ga0194116_10586972 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 504 | Open in IMG/M |
| 3300020551|Ga0208360_1020167 | Not Available | 894 | Open in IMG/M |
| 3300020566|Ga0208222_1004162 | Not Available | 3610 | Open in IMG/M |
| 3300021376|Ga0194130_10408112 | Not Available | 719 | Open in IMG/M |
| 3300021958|Ga0222718_10000116 | Not Available | 77995 | Open in IMG/M |
| 3300021961|Ga0222714_10003397 | Not Available | 16254 | Open in IMG/M |
| 3300021961|Ga0222714_10009470 | Not Available | 8554 | Open in IMG/M |
| 3300021961|Ga0222714_10025343 | Not Available | 4529 | Open in IMG/M |
| 3300021964|Ga0222719_10112835 | Not Available | 1970 | Open in IMG/M |
| 3300021964|Ga0222719_10119171 | Not Available | 1903 | Open in IMG/M |
| 3300021964|Ga0222719_10260355 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1147 | Open in IMG/M |
| 3300022065|Ga0212024_1049187 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 739 | Open in IMG/M |
| 3300022176|Ga0212031_1078167 | Not Available | 564 | Open in IMG/M |
| 3300022176|Ga0212031_1097901 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 502 | Open in IMG/M |
| 3300022179|Ga0181353_1001247 | Not Available | 5100 | Open in IMG/M |
| 3300022179|Ga0181353_1074068 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 866 | Open in IMG/M |
| 3300022179|Ga0181353_1144431 | Not Available | 552 | Open in IMG/M |
| 3300022187|Ga0196899_1011496 | Not Available | 3476 | Open in IMG/M |
| 3300022187|Ga0196899_1084780 | Not Available | 963 | Open in IMG/M |
| 3300022190|Ga0181354_1039050 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1571 | Open in IMG/M |
| 3300022190|Ga0181354_1230053 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 538 | Open in IMG/M |
| 3300022198|Ga0196905_1003613 | Not Available | 5642 | Open in IMG/M |
| 3300022198|Ga0196905_1009533 | All Organisms → Viruses → Predicted Viral | 3253 | Open in IMG/M |
| 3300022198|Ga0196905_1026481 | Not Available | 1773 | Open in IMG/M |
| 3300022198|Ga0196905_1030654 | Not Available | 1617 | Open in IMG/M |
| 3300022198|Ga0196905_1059357 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1072 | Open in IMG/M |
| 3300022198|Ga0196905_1079774 | Not Available | 893 | Open in IMG/M |
| 3300022198|Ga0196905_1127777 | Not Available | 663 | Open in IMG/M |
| 3300022200|Ga0196901_1000018 | Not Available | 72944 | Open in IMG/M |
| 3300022200|Ga0196901_1000036 | Not Available | 56480 | Open in IMG/M |
| 3300022200|Ga0196901_1013131 | Not Available | 3460 | Open in IMG/M |
| 3300022200|Ga0196901_1028750 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 2182 | Open in IMG/M |
| 3300022200|Ga0196901_1037087 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1875 | Open in IMG/M |
| 3300022200|Ga0196901_1043758 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1697 | Open in IMG/M |
| 3300022200|Ga0196901_1069998 | All Organisms → Viruses → Predicted Viral | 1270 | Open in IMG/M |
| 3300022200|Ga0196901_1129733 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 855 | Open in IMG/M |
| 3300022200|Ga0196901_1177172 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 696 | Open in IMG/M |
| 3300022200|Ga0196901_1205979 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 629 | Open in IMG/M |
| 3300022407|Ga0181351_1011012 | All Organisms → cellular organisms → Bacteria | 3673 | Open in IMG/M |
| 3300022407|Ga0181351_1029713 | Not Available | 2324 | Open in IMG/M |
| 3300024358|Ga0255173_1010845 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1656 | Open in IMG/M |
| 3300025057|Ga0208018_100034 | Not Available | 75991 | Open in IMG/M |
| 3300025057|Ga0208018_100111 | Not Available | 30357 | Open in IMG/M |
| 3300025057|Ga0208018_100655 | Not Available | 8128 | Open in IMG/M |
| 3300025057|Ga0208018_108202 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1543 | Open in IMG/M |
| 3300025057|Ga0208018_110512 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1293 | Open in IMG/M |
| 3300025057|Ga0208018_126784 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 633 | Open in IMG/M |
| 3300025585|Ga0208546_1000836 | Not Available | 10281 | Open in IMG/M |
| 3300025585|Ga0208546_1001390 | Not Available | 7572 | Open in IMG/M |
| 3300025585|Ga0208546_1001719 | Not Available | 6737 | Open in IMG/M |
| 3300025585|Ga0208546_1046220 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1042 | Open in IMG/M |
| 3300025646|Ga0208161_1000516 | Not Available | 22011 | Open in IMG/M |
| 3300025646|Ga0208161_1000669 | Not Available | 19175 | Open in IMG/M |
| 3300025646|Ga0208161_1004632 | Not Available | 6418 | Open in IMG/M |
| 3300025646|Ga0208161_1075425 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 991 | Open in IMG/M |
| 3300025646|Ga0208161_1100213 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 799 | Open in IMG/M |
| 3300025646|Ga0208161_1132811 | Not Available | 643 | Open in IMG/M |
| 3300025646|Ga0208161_1149107 | Not Available | 586 | Open in IMG/M |
| 3300025647|Ga0208160_1105527 | Not Available | 726 | Open in IMG/M |
| 3300025653|Ga0208428_1142408 | Not Available | 647 | Open in IMG/M |
| 3300025653|Ga0208428_1157794 | Not Available | 604 | Open in IMG/M |
| 3300025655|Ga0208795_1091569 | Not Available | 827 | Open in IMG/M |
| 3300025655|Ga0208795_1134019 | Not Available | 633 | Open in IMG/M |
| 3300025671|Ga0208898_1008990 | Not Available | 5126 | Open in IMG/M |
| 3300025671|Ga0208898_1014851 | Not Available | 3683 | Open in IMG/M |
| 3300025671|Ga0208898_1150955 | Not Available | 628 | Open in IMG/M |
| 3300025674|Ga0208162_1006343 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 5360 | Open in IMG/M |
| 3300025674|Ga0208162_1013716 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 3297 | Open in IMG/M |
| 3300025687|Ga0208019_1204557 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 514 | Open in IMG/M |
| 3300025759|Ga0208899_1138803 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 848 | Open in IMG/M |
| 3300025889|Ga0208644_1260400 | Not Available | 712 | Open in IMG/M |
| 3300026187|Ga0209929_1051311 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1169 | Open in IMG/M |
| 3300027205|Ga0208926_1000007 | Not Available | 41764 | Open in IMG/M |
| 3300027578|Ga0255075_1080126 | Not Available | 571 | Open in IMG/M |
| 3300027683|Ga0209392_1012710 | All Organisms → Viruses → Predicted Viral | 2598 | Open in IMG/M |
| 3300027683|Ga0209392_1013086 | Not Available | 2567 | Open in IMG/M |
| 3300027693|Ga0209704_1022113 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1628 | Open in IMG/M |
| 3300027743|Ga0209593_10209450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales | 685 | Open in IMG/M |
| 3300027743|Ga0209593_10307567 | Not Available | 544 | Open in IMG/M |
| 3300027762|Ga0209288_10020407 | All Organisms → Viruses → Predicted Viral | 1899 | Open in IMG/M |
| 3300027762|Ga0209288_10121309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales | 829 | Open in IMG/M |
| 3300027762|Ga0209288_10289842 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 544 | Open in IMG/M |
| 3300027793|Ga0209972_10183745 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 980 | Open in IMG/M |
| 3300027899|Ga0209668_10000169 | Not Available | 27277 | Open in IMG/M |
| 3300027899|Ga0209668_10103151 | Not Available | 1661 | Open in IMG/M |
| 3300027917|Ga0209536_100367826 | All Organisms → Viruses → Predicted Viral | 1798 | Open in IMG/M |
| 3300027917|Ga0209536_101572056 | Not Available | 799 | Open in IMG/M |
| 3300027917|Ga0209536_101629288 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 782 | Open in IMG/M |
| 3300027975|Ga0209391_10078859 | All Organisms → Viruses → Predicted Viral | 1495 | Open in IMG/M |
| 3300029930|Ga0119944_1038800 | Not Available | 594 | Open in IMG/M |
| 3300031539|Ga0307380_10051983 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 4504 | Open in IMG/M |
| 3300031566|Ga0307378_10983313 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 689 | Open in IMG/M |
| 3300031784|Ga0315899_10041949 | Not Available | 4811 | Open in IMG/M |
| 3300031784|Ga0315899_10042355 | All Organisms → Viruses → Predicted Viral | 4789 | Open in IMG/M |
| 3300031787|Ga0315900_10195549 | Not Available | 1799 | Open in IMG/M |
| 3300031857|Ga0315909_10002381 | Not Available | 24083 | Open in IMG/M |
| 3300031857|Ga0315909_10003656 | Not Available | 18612 | Open in IMG/M |
| 3300031857|Ga0315909_10213924 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1514 | Open in IMG/M |
| 3300031857|Ga0315909_10290462 | Not Available | 1229 | Open in IMG/M |
| 3300031951|Ga0315904_10162887 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 2241 | Open in IMG/M |
| 3300031951|Ga0315904_10177148 | Not Available | 2123 | Open in IMG/M |
| 3300031951|Ga0315904_10424875 | Not Available | 1196 | Open in IMG/M |
| 3300031951|Ga0315904_10646438 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 900 | Open in IMG/M |
| 3300031951|Ga0315904_10783606 | Not Available | 787 | Open in IMG/M |
| 3300031951|Ga0315904_11382756 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 526 | Open in IMG/M |
| 3300031963|Ga0315901_10014192 | Not Available | 8745 | Open in IMG/M |
| 3300031963|Ga0315901_10709671 | Not Available | 744 | Open in IMG/M |
| 3300032050|Ga0315906_10624960 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 881 | Open in IMG/M |
| 3300032093|Ga0315902_11118325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| 3300034012|Ga0334986_0444310 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 649 | Open in IMG/M |
| 3300034066|Ga0335019_0182194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales | 1367 | Open in IMG/M |
| 3300034072|Ga0310127_014567 | Not Available | 5237 | Open in IMG/M |
| 3300034072|Ga0310127_112611 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1145 | Open in IMG/M |
| 3300034073|Ga0310130_0002214 | Not Available | 9369 | Open in IMG/M |
| 3300034073|Ga0310130_0045492 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1320 | Open in IMG/M |
| 3300034104|Ga0335031_0545836 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 695 | Open in IMG/M |
| 3300034106|Ga0335036_0000173 | Not Available | 58384 | Open in IMG/M |
| 3300034109|Ga0335051_0127359 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300034109|Ga0335051_0566322 | Not Available | 522 | Open in IMG/M |
| 3300034374|Ga0348335_006147 | Not Available | 7287 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 37.04% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 7.04% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 7.04% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 6.30% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.30% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 6.30% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.33% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.22% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.85% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.85% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.48% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.11% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.11% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 1.11% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.11% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 1.11% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 1.11% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.74% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.74% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.74% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.74% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.37% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.37% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.37% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.37% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.37% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.37% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.37% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.37% |
| Methane Seep | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Methane Seep | 0.37% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003860 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006734 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006790 | Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007169 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007212 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projects | Environmental | Open in IMG/M |
| 3300007214 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009239 | Microbial communities of water from Amazon river, Brazil - RCM11 | Environmental | Open in IMG/M |
| 3300009450 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 4m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009470 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009474 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 3m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009492 | Marine sediment microbial communities from Chincoteague Deepwater methane seep, US Atlantic Margin - Chincoteague Seep MUC-5 6-8 cmbsf | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300014801 | Aquatic microbial communities from drinking water treatment system in Nanjing, China - Filtered water - FW | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
| 3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020566 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024358 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d | Environmental | Open in IMG/M |
| 3300025057 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027205 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027578 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h | Environmental | Open in IMG/M |
| 3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027975 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_100041326 | 3300000116 | Marine | MFESLFSAVLPVMKDLLWAAAGMLLTYALNKIQSSFQGIPS* |
| DelMOSpr2010_100134428 | 3300000116 | Marine | MFESLFATVLPVMKDLLWAAAGMLLTYVLNKVQSQFTYEA* |
| DelMOSpr2010_100364592 | 3300000116 | Marine | MFESLFSAVLPVMKDLLWAAAGMLLTYVLNKVQSQFN* |
| DelMOSpr2010_100824444 | 3300000116 | Marine | QSMFESLFATVLPVMKDLLWAAAGMLLTYVLNKVQSQFN* |
| DelMOSpr2010_101723732 | 3300000116 | Marine | MFESLFATVLPVIKDLLWAAAGMLLTYVLNKVQSQFN* |
| JGIcombinedJ13530_1081780402 | 3300001213 | Wetland | MFESLCATVLPVLKDFLWAAAGMLLTYMINKIQAQFNTI* |
| B570J29032_1098446381 | 3300002408 | Freshwater | HTMFESLFAAVLPVIKDLLWAAAGALLTYALNKFQFQFN* |
| Ga0031658_10047307 | 3300003860 | Freshwater Lake Sediment | PSQHHTMFESLFAAVLPVMKDLLWAAAGIALTYLFNQFQTQFN* |
| Ga0007787_101101582 | 3300004240 | Freshwater Lake | MFESILGAVLPVLKDLLWAAAGMALTYLINKFQSNFQHI* |
| Ga0068877_106461102 | 3300005525 | Freshwater Lake | MFESLFAAVLPVMKDLLWAAAGIALTYLFNKFQTQFN* |
| Ga0068876_1000019021 | 3300005527 | Freshwater Lake | MFESLFAAVLPVVKDLLWAAAGMALTYLLNKIQTQFNTI* |
| Ga0068876_100504986 | 3300005527 | Freshwater Lake | MFESLFTAVLPVIKDLLWAAAGALLTYALNKFQFQFN* |
| Ga0068876_107013922 | 3300005527 | Freshwater Lake | MFESLFAAVLPVMKDLLWAAAGMLLTYALNKIQSYCS* |
| Ga0079957_10184981 | 3300005805 | Lake | MFESLFAAVLPVMKDLLWAAAGMLLSYALNKIQTQFN* |
| Ga0079957_10734082 | 3300005805 | Lake | MFESILGAIVPVLKDLLWAAAGMLLSYCINKVQSHFHTI* |
| Ga0079957_12697442 | 3300005805 | Lake | MFESLFAAVLPVMKDLLWAAAGMLLTYAINKIQTQFN* |
| Ga0075474_1000108010 | 3300006025 | Aqueous | MFESFISFCVPVIKDLLWAAAGMLLTYALNKFQTQFN* |
| Ga0075474_100981831 | 3300006025 | Aqueous | MFESLLATVLPVMKDLLWAAAGMLLTYMLNKIQSNFQTISS* |
| Ga0075478_100436913 | 3300006026 | Aqueous | MFESFISLCVPVIKDLLWAAAGMLLTYALNKFQTQFN* |
| Ga0075478_100473922 | 3300006026 | Aqueous | MFESLFATVLPVMKDLLWAAAGMLLTYVLNKVQSQFN* |
| Ga0075470_1000061313 | 3300006030 | Aqueous | MFESLFAAVLPVIKDLLWAAAGMLLSYALNKIQTQFN* |
| Ga0075470_1000067216 | 3300006030 | Aqueous | MFESIFGAVVPVFKNLLWAAAGMLLTYCINKLQTHFNHAI* |
| Ga0075470_100007598 | 3300006030 | Aqueous | MFESLFAAVLPVMKELLWAAAGMALTFVMTKLSHGWT* |
| Ga0075470_100058862 | 3300006030 | Aqueous | MFESLFAAVLPVMKDLLWAAAGMLLTYAINKFQSQFI* |
| Ga0075470_100987293 | 3300006030 | Aqueous | MFESLFAAVLPVMKDLLWAAAGMLLTYAINKFQTQFN* |
| Ga0075470_101388961 | 3300006030 | Aqueous | MFESLFAAVLPVLKDILWAAAGALLTYALNKFQSQFN* |
| Ga0075461_100453832 | 3300006637 | Aqueous | MFESFISLCVPVIKDLLWAAAGMLLTYAFNKFQTQFN* |
| Ga0075471_104381352 | 3300006641 | Aqueous | TPHQLSSVMFESLFAAVLPVVKDLLWAAAGMLLTYVLNKIQSQFNAI* |
| Ga0098073_100051812 | 3300006734 | Marine | MFETLLATVLPVMKDLLWAAAGMLLTYMLNKIQSQFN* |
| Ga0098073_100084413 | 3300006734 | Marine | MFESLLAAVLPVMKDLLWAAAGIAVTYLLNKFQGFYVQTN* |
| Ga0098073_100107616 | 3300006734 | Marine | MFESLFATLLPVMKDLLWAAAGVLLTYALNKFQAHFN* |
| Ga0098073_10032849 | 3300006734 | Marine | MFESLFAAVLPVMKDLLWAAAGMLLTYALNKYQAHFN* |
| Ga0098073_10058165 | 3300006734 | Marine | MFETLLDTVLPVMKDLLWAAAGMLLTYMLNKIQSQFN* |
| Ga0098073_10081304 | 3300006734 | Marine | MFETLLATVLPVMKDLLWAAAGMLLTYMLNKIQSNFQTISS* |
| Ga0098073_10154371 | 3300006734 | Marine | MFETLLATVLPVMKDLLWAAAGMLLTYTLNKIQSQFN* |
| Ga0098073_10294092 | 3300006734 | Marine | MFETLFATVLPVFKDLLWAAAGMLLTYTLNKIQSHFNTI* |
| Ga0098073_10414661 | 3300006734 | Marine | MFETLLATLLPVMKDLLWAAAGMLLTYMLNKIQSNFQTISS* |
| Ga0098073_10524771 | 3300006734 | Marine | MFETLLATVLPVMKDLLWAAAGMLLTYMLNKIQSN |
| Ga0098074_10940022 | 3300006790 | Marine | MFETLLATVLPVMKDLLWAAAGMLLTYALNKIQSSFQGIPS* |
| Ga0070749_100615586 | 3300006802 | Aqueous | MFESLIAAVIPVMKDLLWAAAGMLLTYMINKVQSQFI* |
| Ga0070749_100670274 | 3300006802 | Aqueous | MFESLLATVLPVMKDLLWAAAGILLTYMLNKIQSNFQTISS* |
| Ga0070749_102130843 | 3300006802 | Aqueous | MFESWFATVLPVMKDLLWAAAGMLLTYVLNKVQSQFN* |
| Ga0070749_102695252 | 3300006802 | Aqueous | MFESLLATVLPVLKDILWAAAGALLTYALNKFQSQFN* |
| Ga0070749_103217532 | 3300006802 | Aqueous | MFESLFTAVLPVMKDLLWAAAGMLLTYAFNKFQTQFN* |
| Ga0070749_103861972 | 3300006802 | Aqueous | MFESLFATVIPVMKDLLWAAAGMLLTYCVNKLQSQFNF* |
| Ga0070749_104415301 | 3300006802 | Aqueous | MFESFISLCAPVIKDLLWAAAGMLLTYALNKFQTQFN* |
| Ga0075479_102427921 | 3300006870 | Aqueous | SRHSMFESLFATVLPVMKDLLWAAAGMLLTYVLNKVQSQFTYEA* |
| Ga0070750_103239562 | 3300006916 | Aqueous | MFESLFSAVLPVMKDLLWAAAGMLMTYLLNKVQSQFN* |
| Ga0070746_100894111 | 3300006919 | Aqueous | MFETLLATVLPVMKDLLWAAAGILLTYMLNKIQSNFQTISS* |
| Ga0102976_10730947 | 3300007169 | Freshwater Lake | MFESILGAIVPVLKDLLWVAAGMLLSYCINKVQSHFHTI* |
| Ga0103958_11286055 | 3300007212 | Freshwater Lake | MFESLFAAVLPVMKDLLWAAAGMALTYLINKIQTQFN* |
| Ga0103959_11876025 | 3300007214 | Freshwater Lake | MFESLLAAVLPVMKDLLWAAAGMLLTYCINKIQTQFN* |
| Ga0070745_10897582 | 3300007344 | Aqueous | MFESLFSAVLPVMKNLLWAAAGVALSYLLNKLQGFYGSIN* |
| Ga0070745_11570931 | 3300007344 | Aqueous | MFESLFAAVFPVMKDLLWAAAGMLLTYVLNKVQSQFN* |
| Ga0099851_10148985 | 3300007538 | Aqueous | MFESLLASVLPVFKDLLWAAAGMLLTYCINKLQSQFN* |
| Ga0099851_10358054 | 3300007538 | Aqueous | MFESLFAAVLPVMKDLLWAAAGMALTYVLNKLQMQFN* |
| Ga0099851_10779063 | 3300007538 | Aqueous | MFESLLASVLPVLKDLLWAAAGMLLTYCINKLQTQFN* |
| Ga0099851_10952442 | 3300007538 | Aqueous | MFESLCAAVLPVLKDLLWAAAGMLLTYVLNKVQFQFN* |
| Ga0099851_11136912 | 3300007538 | Aqueous | MFESLFAAVLPVMKDFLWAAAGMLLTYCINKFQSQFNF* |
| Ga0099851_12181243 | 3300007538 | Aqueous | MFESLFASIIPFAKDLLWAAAGMLLTYAINKIQSQFNIA* |
| Ga0099851_12368361 | 3300007538 | Aqueous | TDHHFNSLHPMFESLLSAVLPVLKDILWAAAGALLTYALNKFQSQFN* |
| Ga0099849_10033949 | 3300007539 | Aqueous | MFETLFVTVLPVFKDLLWAAAGMLLTYVLNKFQSQFN* |
| Ga0099847_11265491 | 3300007540 | Aqueous | HFNSLHPMFESLFSAVLPVMKDFLWAAAGMLLTYALNKIQSSFQGIPS* |
| Ga0099848_10008469 | 3300007541 | Aqueous | MFESLFVAVAPVLKDLLWAAAGMALTYLLNKIQSQYS* |
| Ga0099848_10033553 | 3300007541 | Aqueous | MFESLFAAVLPVMKDLLWAAAGVALTFCLNKLQKVFQ* |
| Ga0099848_10042648 | 3300007541 | Aqueous | MFESLFSAVFPVMKDLLWAAAGMLLTYVLNKVQSQFN* |
| Ga0099848_10110664 | 3300007541 | Aqueous | MFEALFATVLPVMKDLLWAAAGMLLTYALNKFQSQFN* |
| Ga0099848_10465374 | 3300007541 | Aqueous | MFESLFAAVLPVMKDLLWAAAGMLLTYAINKLQSQFN* |
| Ga0099848_10471502 | 3300007541 | Aqueous | MFESILGIVLPVLKDLLWAAAGMLLTYVINKVQHSWT* |
| Ga0099848_10679412 | 3300007541 | Aqueous | MFESLLATVLPVMKDLLWAAAGMLLTYMLNKIQSSFQTISS* |
| Ga0099848_11335031 | 3300007541 | Aqueous | MFETLLATVLPVMKDLLWAAAGMLLTYTLNKIQSHFNTI* |
| Ga0099848_12100262 | 3300007541 | Aqueous | MFESLFAAVLPVIKDLLWAAAGALLTYALNKFQFQFN* |
| Ga0099848_12822452 | 3300007541 | Aqueous | MCESLFAAVLPVMKDLLWAAAGMLLTYALNKFQSQF |
| Ga0099848_13312722 | 3300007541 | Aqueous | MFESLFATVIPVMKDLLWAAAGMLLTYCINKFQSQFNF* |
| Ga0099846_10030628 | 3300007542 | Aqueous | MFESLLAAVLPVMKDLLWAAAGMALTYMFNKIQSYCS* |
| Ga0099846_10405093 | 3300007542 | Aqueous | MFESFFVSILPVFKDLLWAAAGMLLTYVLNKVQSQFN* |
| Ga0099846_10570345 | 3300007542 | Aqueous | MFESLLATVLPVLKDILWAAAGALLTYALNKFQSQFIYET* |
| Ga0099846_13298501 | 3300007542 | Aqueous | DHLPQLNTMFESLFDTVLPVMKDLLWAAAGMLLTYILNKIQSYCS* |
| Ga0102861_100004038 | 3300007544 | Estuarine | MFESLFTAVLPVMKDILWAAAGMLLSYAINKFQSNFN* |
| Ga0099850_11205082 | 3300007960 | Aqueous | MFEALFATVLPVIKDLLWAAAGMLLTYVLNKFQSQFN* |
| Ga0099850_12281892 | 3300007960 | Aqueous | MFETLLATVFPVMKDLLWAAAGMLLTYTLNKIQSQFN* |
| Ga0099850_12375112 | 3300007960 | Aqueous | MFESLFATVLPVMKDLFWAAAGMLLTYMLNKIQSSFQMISS* |
| Ga0099850_13661561 | 3300007960 | Aqueous | MFETLFTTVLPVMKDLLWAAAGMLLTYMLNKIQSQFN |
| Ga0099850_13718561 | 3300007960 | Aqueous | LQIMFESFFVSILPVFKDLLWAAAGMLLTYVLNKVQSQFN* |
| Ga0108970_103342115 | 3300008055 | Estuary | MFESLLAAVLPVMKDLLWAAAGIALTYLFNKFQTQFN* |
| Ga0108970_108874062 | 3300008055 | Estuary | MFESLFAAVLPVMKDLLWAAAGMLLTYAINKIQMQFN* |
| Ga0108970_116285441 | 3300008055 | Estuary | AISLQLMFESLFATVVPVLKDLLWAAAGMLLTYVLNKFQSQFN* |
| Ga0114340_11073862 | 3300008107 | Freshwater, Plankton | MFESLFAIVFPVVKDLLWAAAGMLLTYAINKIQTQFNPI* |
| Ga0114340_12459093 | 3300008107 | Freshwater, Plankton | SQHHTMFESLFAAVLPVMKDLLWAAAGIALTYLFNKFQTQFN* |
| Ga0114347_10357935 | 3300008114 | Freshwater, Plankton | MFESILGAIVLVIKDLLWAAAGMLLTYCINKLQTHFNTI* |
| Ga0114351_13191131 | 3300008117 | Freshwater, Plankton | MFETFLGALIPVVKDLLWAAAGMLLTYTINKIQSHFQHI* |
| Ga0114841_10085913 | 3300008259 | Freshwater, Plankton | MFESLFAAVLPVMKDLLWAAAGILLTYAFNKIQSYCL* |
| Ga0114363_10691804 | 3300008266 | Freshwater, Plankton | MFESLFVAVLPVMKDLLWAAAGIALTYLFNKFQTQFN* |
| Ga0114363_11892672 | 3300008266 | Freshwater, Plankton | MFESLFAAVFPVMKDLLWAAAGMLLTYAINKIQTQFN* |
| Ga0114363_12312971 | 3300008266 | Freshwater, Plankton | SLLAAVLPVMKDLLWAAAGIALTYLFNKFQTQFN* |
| Ga0114876_10659691 | 3300008448 | Freshwater Lake | MFESLFAAVLPVMKDLLWAAAGILLTFALNKFQSQFN* |
| Ga0114876_12013721 | 3300008448 | Freshwater Lake | SLFAAVLPVMKDLLWAAAGIALTYLFNKFQTQFN* |
| Ga0105105_100514242 | 3300009009 | Freshwater Sediment | MFESLFAAVLPVMKDLLWAAAGMLLTYCINKLQSQFNF* |
| Ga0105105_103785013 | 3300009009 | Freshwater Sediment | MFESLFTAVLPVMKDLLWAAAGALLTYVLNKFQSQFIYET* |
| Ga0105105_105329911 | 3300009009 | Freshwater Sediment | MFESFFAAVLPVMKDLLWAAAGMLLTYCINKLQSQFNF* |
| Ga0105105_110025861 | 3300009009 | Freshwater Sediment | MFESLFAAVLPVMKDLLWAAAGALLTYVLNKFQSQFIYET* |
| Ga0105090_1001137111 | 3300009075 | Freshwater Sediment | MFESLFAIVLPVVKDLLWAAAGMLLTYALNKIQTQFNTI* |
| Ga0118687_101618853 | 3300009124 | Sediment | MFESLFATVLPVMKDLLWAAAGMLLTYMLNKIQTYTS* |
| Ga0105102_100015762 | 3300009165 | Freshwater Sediment | MFESLFATVLPVLKDILWAAAGALLTYALNKFQSQFN* |
| Ga0105102_109167822 | 3300009165 | Freshwater Sediment | MFESLFAAVLPVMKDLLWAAAGIALTYFFNKFQTQFN* |
| Ga0105104_104159293 | 3300009168 | Freshwater Sediment | FESLFAAVLPVIKDLLWAAAGALLTYVLNKFQSQFIYET* |
| Ga0105097_101801433 | 3300009169 | Freshwater Sediment | MFESLFAAVLPVIKDLLWAAAGALLTYALNKFQFQFIYET* |
| Ga0105096_100246483 | 3300009170 | Freshwater Sediment | MFESLFTAVLPVIKDLLWAAAGALLTYALNKFQFQFIYET* |
| Ga0103858_101047992 | 3300009239 | River Water | MFESILGAIAPVLKDLLWAAAGMLLSYCINKLQAHFNFN* |
| Ga0127391_10000128 | 3300009450 | Meromictic Pond | MFETLLAAVLPVMKDLLWATAGILLTYILNKIQSQFN* |
| Ga0126447_11839213 | 3300009470 | Meromictic Pond | SQLQLMFETLLATVLPVMKDLLWAAAGILLTYILNKIQLQFNW* |
| Ga0127390_10053089 | 3300009474 | Meromictic Pond | MFETLLAAVLPVMKDLLWAAAGILLTYMFNKIQSQFN* |
| Ga0127412_100467731 | 3300009492 | Methane Seep | MFESLFATVLPVMKDLLWAAAGMLLTYILNKFQSQFN* |
| Ga0129348_10490584 | 3300010296 | Freshwater To Marine Saline Gradient | MFESLLSAVLPVMKDLLWAAAGMLLTYVLNKVQSQFN* |
| Ga0129345_11629673 | 3300010297 | Freshwater To Marine Saline Gradient | HPMFESLFSAVLPVMKDLLWAAAGMLLTYALNKIQSSFQGIPS* |
| Ga0129342_10143863 | 3300010299 | Freshwater To Marine Saline Gradient | MFESLFSAVLPVMKDLLWAAAGILLTYALNKIQSSFQGIPS* |
| Ga0129333_1000394416 | 3300010354 | Freshwater To Marine Saline Gradient | MFESLFAAVLPVMKDLLWAAAGMLLTYVLNKFQTQFI* |
| Ga0129333_1000969311 | 3300010354 | Freshwater To Marine Saline Gradient | MFESLFAAVLPIVKNFLWAAAGIALTYLFNKLQSKFN* |
| Ga0129333_100145524 | 3300010354 | Freshwater To Marine Saline Gradient | MFESLLAAVLSVMKDLLWAAAGIALTYLFNKFQTQFN* |
| Ga0129333_100203278 | 3300010354 | Freshwater To Marine Saline Gradient | MFESLFAAVIPVMKDLLWAAAGMLLTYLINKVQSQFS* |
| Ga0129333_100238554 | 3300010354 | Freshwater To Marine Saline Gradient | MFESLLATVLPVIKDLLWAVAGMLLTYMLNKIQSQFT* |
| Ga0129333_100481919 | 3300010354 | Freshwater To Marine Saline Gradient | MFESLFATVVPVLKDLLWAAAGMLLTYVLNKIQTQFN* |
| Ga0129333_101273976 | 3300010354 | Freshwater To Marine Saline Gradient | MFESLFAAVLPVMKELLWAVAGMALTFVMTKLSHGWT* |
| Ga0129333_101285363 | 3300010354 | Freshwater To Marine Saline Gradient | MFESLFAAVLPVMKDLLWAAAGMLLTYCINKIQKVFQ* |
| Ga0129333_101930045 | 3300010354 | Freshwater To Marine Saline Gradient | MFESLFAAVLPVVKDLLWAAAGMLLTYCINKLQTQFNTI* |
| Ga0129333_102278952 | 3300010354 | Freshwater To Marine Saline Gradient | MFESLFAAVLPVMKDLLWAAAGMLPTYAINKFQTQFN* |
| Ga0129333_102429532 | 3300010354 | Freshwater To Marine Saline Gradient | MFESLFAAVIPVMKDLLWAAAGMLLTYLINKVQSQFN* |
| Ga0129333_102626806 | 3300010354 | Freshwater To Marine Saline Gradient | MFESLLATVLPVLKDILWAAAGALLTYTLNKFQSQFN* |
| Ga0129333_103579775 | 3300010354 | Freshwater To Marine Saline Gradient | MFESLFTAVLPVMKDLLWAAAGALLTYALNKFQSQFIYET* |
| Ga0129333_105642951 | 3300010354 | Freshwater To Marine Saline Gradient | MFESLIAAVIPVMKDILWAAAGMLLTYMINKVQSQFI* |
| Ga0129333_108331333 | 3300010354 | Freshwater To Marine Saline Gradient | MFESLFAAVLPMMKDLLWAAAGMLLTYAINKIQTQFN* |
| Ga0129336_103404232 | 3300010370 | Freshwater To Marine Saline Gradient | MFESILGIVLPVLKDLLWAAAGMLLTYVLNKIQTQFN* |
| Ga0136549_102910682 | 3300010389 | Marine Methane Seep Sediment | LFATVLPVMKDLLWAAAGVAVTYLLNKLQSFYGSLN* |
| Ga0119946_10230162 | 3300014801 | Aquatic | MFESLFAAVLPVMKDLLWAAAGMLLTYMLNKIQSQFN* |
| Ga0181352_10015282 | 3300017747 | Freshwater Lake | MFESLFAAVLPVMKDLLWAAAGMLLTYVLNKFQTQFN |
| Ga0181352_10587262 | 3300017747 | Freshwater Lake | MFESLFAAVLPVMKDLLWAAAGMLLTYVLNKFQSQFN |
| Ga0181355_12860652 | 3300017785 | Freshwater Lake | MFESLFTAVLPVMKDLLWAAAGALLTYALNKFQFQFN |
| Ga0180437_101091733 | 3300017963 | Hypersaline Lake Sediment | MFETLLATVLPVMKDLLWAAAGVALSYLLNKLQGFYGSIN |
| Ga0181590_100314463 | 3300017967 | Salt Marsh | MFESFISLCAPVIKDLLWAAAGMLLTYALNKFQTQFN |
| Ga0181585_101278116 | 3300017969 | Salt Marsh | MFESFISLCVPVIKDLLWAAAGMLLTYAFNKFQTQFN |
| Ga0181592_104525371 | 3300018421 | Salt Marsh | MFEIFLNAIIPVVKDLLWAAAGALLTYALNKLQTQFHII |
| Ga0194024_10073901 | 3300019765 | Freshwater | MFESLFTAVLPVMKDLLWAAAGMLLTYAFNKFQTQ |
| Ga0181359_10977982 | 3300019784 | Freshwater Lake | MFESLLAAVLPVMKDLLWAAAGIALTYLFNKFQTQFN |
| Ga0194113_101191002 | 3300020074 | Freshwater Lake | MFESLFAAVLPVVKDLVWAAAGMLLSYVLNKIQTQFNTI |
| Ga0194113_104576772 | 3300020074 | Freshwater Lake | MFESLFAAVLPVIKDLLWAAAGMLMTYLINKVQTQFN |
| Ga0211736_101984082 | 3300020151 | Freshwater | MVESLFAIVLPVVKDLLWAAAGMLLTYALNKIQTQFNTI |
| Ga0211734_112808834 | 3300020159 | Freshwater | MFEAFVSAVLPVVKDLLWAAAGMLLTYALNKLQSHFQNI |
| Ga0211733_103724905 | 3300020160 | Freshwater | MLESLLSAVLPVLKDILWAAAGMLLSYALNKLQSKFQTI |
| Ga0211726_109801754 | 3300020161 | Freshwater | MFESLFAAVLPVMKDLLWAAAGMLLTYALNKFQTQFN |
| Ga0211726_110510432 | 3300020161 | Freshwater | MFESLFAIVLPVVKDLLWAAAGMLLTYALNKVQTQFNTI |
| Ga0194116_105869721 | 3300020204 | Freshwater Lake | MFESLFAAVLPVVKDLLWAAAGMLLTYVINKIQSQFNTI |
| Ga0208360_10201672 | 3300020551 | Freshwater | QHHTMFEFLFAAVLPVMKDLLWAAAGIALTYLFNKFQTQFN |
| Ga0208222_100416210 | 3300020566 | Freshwater | MFESLFAAVLPVMKDLLWAAAGALLTYALNKFQFQFN |
| Ga0194130_104081122 | 3300021376 | Freshwater Lake | MFESLFAAVLPVMKDLLWAAAGMLMTYLINKVQTQFN |
| Ga0222718_10000116112 | 3300021958 | Estuarine Water | MFESFISFCVPVIKDLLWAAAGMLLTYALNKFQTQFN |
| Ga0222714_100033978 | 3300021961 | Estuarine Water | MFESLCATVLPVLKDFLWAAAGMLLTYMINKIQAQFNTI |
| Ga0222714_100094707 | 3300021961 | Estuarine Water | MFESLFAAVLPVMKDLLWAAAGMLVTYLINKVQTQFN |
| Ga0222714_100253435 | 3300021961 | Estuarine Water | MFESLFATVLPVLKDLLWAAAGMLLTYVLNKVQSQFN |
| Ga0222719_101128354 | 3300021964 | Estuarine Water | MFESLFATVLPVMKDLLWAAAGMLLTYMLNKIQTYTS |
| Ga0222719_101191713 | 3300021964 | Estuarine Water | MFESLFFAVLPVMKDLLWAAAGMLLTYALNKIQSSFQGIPS |
| Ga0222719_102603554 | 3300021964 | Estuarine Water | MFESLFATVLPVMKDLLWAAAGMLLTYVLNKVQSQLN |
| Ga0212024_10491872 | 3300022065 | Aqueous | MFESLFSAVLPVMKDLLWAAAGMLLTYVLNKVQSQFN |
| Ga0212031_10781672 | 3300022176 | Aqueous | MFESLFVAVAPVLKDLLWAAAGMALTYLLNKIQSQYS |
| Ga0212031_10979012 | 3300022176 | Aqueous | MFESLIAAVIPVMKDLLWAAAGMLLTYMINKVQSQFIXAM |
| Ga0181353_100124710 | 3300022179 | Freshwater Lake | MFESILGIVLPVIKDLLWAAAGMALTYLINKVQHSWA |
| Ga0181353_10740681 | 3300022179 | Freshwater Lake | MFESLFAAVLPVMKDLLWAAAGMLLTYVLNKFQTQF |
| Ga0181353_11444312 | 3300022179 | Freshwater Lake | MFESIFGAVLPVLKDLLWAAAGMALTYLINKFQSNF |
| Ga0196899_10114963 | 3300022187 | Aqueous | MFESLFATVLPVIKDLLWAAAGMLLTYVLNKVQSQFN |
| Ga0196899_10847803 | 3300022187 | Aqueous | MFESLFATVLPVMKDLLWAAAGMLLTYVLNKVQSQFTYEA |
| Ga0181354_10390502 | 3300022190 | Freshwater Lake | MFESLLATVLPVIKDLLWAVAGMLLTYMLNKIQSQFN |
| Ga0181354_12300531 | 3300022190 | Freshwater Lake | MFESLFTAVLPVIKDLLWAAAGALLTYALNKFQFQ |
| Ga0196905_100361312 | 3300022198 | Aqueous | MFESLFAAVLPVMKDLLWAAAGMALTYVLNKLQMQFN |
| Ga0196905_10095335 | 3300022198 | Aqueous | MFETLFATVLPVMKDLLWAAAGMLLTYVLNKVQSQFN |
| Ga0196905_10264812 | 3300022198 | Aqueous | MFESLFSAVFPVMKDLLWAAAGMLLTYVLNKVQSQFN |
| Ga0196905_10306544 | 3300022198 | Aqueous | MFESLIAAVIPVMKDLLWAAAGMLLTYMINKVQSQFI |
| Ga0196905_10593573 | 3300022198 | Aqueous | MFESLLATVLPVMKDLLWAAAGMLLTYMLNKIQSSFQGIPS |
| Ga0196905_10797742 | 3300022198 | Aqueous | LQLQLMFETLFATVLPVMKDLLWAAAGMLLTYMLNKIQSNFQTISS |
| Ga0196905_11277772 | 3300022198 | Aqueous | MFESLFSAVLPVMKDLLWAAAGMLLTYALNKIQSSFQGIPS |
| Ga0196901_100001825 | 3300022200 | Aqueous | MFESLFAAVLPVMKDLLWAAAGMLLTYALNKYQAHFN |
| Ga0196901_100003679 | 3300022200 | Aqueous | VFESLFAAVLPVMKDLLWAAAGILLTYAFNKYQAHFN |
| Ga0196901_101313110 | 3300022200 | Aqueous | MFETLFATVLPVMKDLLWAAAGILLTYVLNKVQSQFN |
| Ga0196901_10287502 | 3300022200 | Aqueous | MFESLCAAVLPVLKDLLWAAAGMLLTYVLNKVQFQFN |
| Ga0196901_10370871 | 3300022200 | Aqueous | MFESFFVSILPVFKDLLWAAAGMLLTYVLNKVQSQFN |
| Ga0196901_10437584 | 3300022200 | Aqueous | MFESLFAAVLPVMKDLLWAAAGVALTFCLNKLQKVFQ |
| Ga0196901_10699983 | 3300022200 | Aqueous | MFETLFATVLPVMKDLLWAAAGMLLTYMLNKIQSNFQTISS |
| Ga0196901_11297332 | 3300022200 | Aqueous | MFESLCAAVLPVLKDLLWAAAGALLTYLLNKVQFQFN |
| Ga0196901_11771721 | 3300022200 | Aqueous | MFETLFATVLPVFKDLLWAAAGMLLTYTLNKIQSHFNTI |
| Ga0196901_12059792 | 3300022200 | Aqueous | MFESLLATVLPVLKDILWAAAGALLTYALNKFQSQFN |
| Ga0181351_10110123 | 3300022407 | Freshwater Lake | MFEALFAAVLPIVKDLLWAAAGMALTYLINKIQTQFNTI |
| Ga0181351_10297132 | 3300022407 | Freshwater Lake | MFESLFAAVIPVMKDLLWAAAGMLLTYLINKVQSQFN |
| Ga0255173_10108455 | 3300024358 | Freshwater | SLQLMFESLFAAVLPVMKDLLWAAAGMLVTYLINKVQTQFN |
| Ga0208018_100034109 | 3300025057 | Marine | MFETLLATVLPVMKDLLWAAAGMLLTYMLNKIQSQFN |
| Ga0208018_10011152 | 3300025057 | Marine | MFESLFATLLPVMKDLLWAAAGVLLTYALNKFQAHFN |
| Ga0208018_1006557 | 3300025057 | Marine | MFESLLAAVLPVMKDLLWAAAGIAVTYLLNKFQGFYVQTN |
| Ga0208018_1082023 | 3300025057 | Marine | MFETLLATVLPMMKDLLWAAAGMLLTYTLNKIQSQFN |
| Ga0208018_1105124 | 3300025057 | Marine | MFETLLATLLPVMKDLLWAAAGMLLTYMLNKIQSNFQTISS |
| Ga0208018_1267842 | 3300025057 | Marine | MFETLLDTVLPVMKDLLWAAAGMLLTYMLNKIQSQFN |
| Ga0208546_100083617 | 3300025585 | Aqueous | MFESLFAAVLPVMKDLLWAAAGMLLTYAINKFQSQFI |
| Ga0208546_100139011 | 3300025585 | Aqueous | MFESLFAAVLPVMKELLWAAAGMALTFVMTKLSHGWT |
| Ga0208546_10017198 | 3300025585 | Aqueous | MFESIFGAVVPVFKNLLWAAAGMLLTYCINKLQTHFNHAI |
| Ga0208546_10462202 | 3300025585 | Aqueous | MFESLFAAVLPVMKDLLWAAAGMLLTYAINKFQTQFN |
| Ga0208161_100051617 | 3300025646 | Aqueous | MFESLLAAVLPVMKDLLWAAAGMALTYMFNKIQSYCS |
| Ga0208161_100066942 | 3300025646 | Aqueous | MFETLFATVFPVMKDLLWAAAGMLLTYVLNKVQSQFN |
| Ga0208161_10046322 | 3300025646 | Aqueous | MFESLLASVLPVFKDLLWAAAGMLLTYCINKLQSQFN |
| Ga0208161_10754252 | 3300025646 | Aqueous | MFESLLASVLPVLKDLLWAAAGMLLTYCINKLQTQFN |
| Ga0208161_11002132 | 3300025646 | Aqueous | MFESLFAPVLPVLKDLLWAAAGMLLTYCINKLQIQFN |
| Ga0208161_11328112 | 3300025646 | Aqueous | MFESLLATVLPVMKDLLWAAAGMLLTYMLNKIQSSFQTISS |
| Ga0208161_11491072 | 3300025646 | Aqueous | MFESLFATVIPVMKDLLWAAAGMLLTYCINKFQSQFNF |
| Ga0208160_11055271 | 3300025647 | Aqueous | QLMFESLFASVLPVLKDLLWAAAGMLLTYCINKLQIQFN |
| Ga0208428_11424083 | 3300025653 | Aqueous | MFESFISLCVPVIKDLLWAAAGMLLTYALNKFQTQFN |
| Ga0208428_11577942 | 3300025653 | Aqueous | MFESWFATVLPVMKDLLWAAAGMLLTYVLNKVQSQFN |
| Ga0208795_10915692 | 3300025655 | Aqueous | SFNSMFESLIAAVIPVMKDLLWAAAGMLLTYMINKVQSQFI |
| Ga0208795_11340191 | 3300025655 | Aqueous | QLMFETLLATVLPVMKDLLWAAAGMLLTYMLNKIQSNFQTISS |
| Ga0208898_100899010 | 3300025671 | Aqueous | ESLFATVLPVMKDLLWAAAGMLLTYVLNKVQSQFN |
| Ga0208898_10148515 | 3300025671 | Aqueous | MFESLLATVLPVMKDLLWAAAGILLTYMLNKIQSNFQTISS |
| Ga0208898_11509552 | 3300025671 | Aqueous | MFESLFSAVLPVMKNLLWAAAGVALSYLLNKLQGFYGSIN |
| Ga0208162_10063434 | 3300025674 | Aqueous | MFESLLSAVLPVMKDLLWAAAGMLLTYVLNKVQSQFN |
| Ga0208162_10137164 | 3300025674 | Aqueous | MFETLFVTVLPVFKDLLWAAAGMLLTYVLNKFQSQFN |
| Ga0208019_12045572 | 3300025687 | Aqueous | MFETLLATALPVMKDLLWAAAGILLTYMLNKIQSNFQTISS |
| Ga0208899_11388031 | 3300025759 | Aqueous | MFESLFTAVLPVMKDLLWAAAGMLLTYAFNKFQTQFN |
| Ga0208644_12604002 | 3300025889 | Aqueous | MFESILGAIVPVLKDLLWAAAGMLLSYCINKVQSHFHTI |
| Ga0209929_10513113 | 3300026187 | Pond Water | MFESLFATVLPVMKDLLWAAAGMLLTYVLNKVQSQFN |
| Ga0208926_100000770 | 3300027205 | Estuarine | MFESLFTAVLPVMKDILWAAAGMLLSYAINKFQSNFN |
| Ga0255075_10801261 | 3300027578 | Freshwater | TMFESLFAAVLPVMKELLWAAAGMALTFVMTKLSHGWT |
| Ga0209392_10127105 | 3300027683 | Freshwater Sediment | MFESLFAIVLPVVKDLLWAAAGMLLTYALNKIQTQFNTI |
| Ga0209392_10130864 | 3300027683 | Freshwater Sediment | MFESLFAAVLPVIKDLLWAAAGALLTYALNKFQFQFN |
| Ga0209704_10221134 | 3300027693 | Freshwater Sediment | MFESLFATVLPVLKDILWAAAGALLTYALNKFQSQFN |
| Ga0209593_102094502 | 3300027743 | Freshwater Sediment | FESLFAAVLPVIKDLLWAAAGALLTYVLNKFQSQFIYET |
| Ga0209593_103075671 | 3300027743 | Freshwater Sediment | ESLFAAVLPVIKDLLWAAAGALLTYALNKFQFQFN |
| Ga0209288_100204072 | 3300027762 | Freshwater Sediment | MFESFFAAVLPVMKDLLWAAAGMLLTYCINKLQSQFNF |
| Ga0209288_101213091 | 3300027762 | Freshwater Sediment | FESLFAAVLPVMKDLLWAAAGALLTYVLNKFQSQFIYET |
| Ga0209288_102898421 | 3300027762 | Freshwater Sediment | MFESLFTAVLPVMKDLLWAAAGALLTYVLNKFQSQFIYET |
| Ga0209972_101837452 | 3300027793 | Freshwater Lake | MFESLFAAVLPVVKDLLWAAAGMALTYLLNKIQTQFNTI |
| Ga0209668_100001693 | 3300027899 | Freshwater Lake Sediment | MFESLFAAVLPVMKDLLWAAAGIALTYLFNQFQTQFN |
| Ga0209668_101031511 | 3300027899 | Freshwater Lake Sediment | MFESLFAAVLPMMKDLFWAAAGMLLTYCINKFQSQFIYET |
| Ga0209536_1003678262 | 3300027917 | Marine Sediment | MFETLLATVLPVMKDLLWAAAGMLLTYTLNKIQSHFNTI |
| Ga0209536_1015720562 | 3300027917 | Marine Sediment | MFESLFASIIPFAKDLLWAAAGMLLTYAINKIQTQFSFA |
| Ga0209536_1016292881 | 3300027917 | Marine Sediment | MFESLFASIIPVFKDLLWAAAGMLLTYCINKLQTQFN |
| Ga0209391_100788595 | 3300027975 | Freshwater Sediment | MFESLFTAVLPVIKDLLWAAAGALLTYALNKFQFQFIYET |
| Ga0119944_10388002 | 3300029930 | Aquatic | MFESILNAIVPMLKDLLWAAAVMLLTYALNKFQSKVV |
| Ga0307380_1005198310 | 3300031539 | Soil | MFESLLSAVLPVMKDLLWAAAGMLLTYMLNKFQSQFN |
| Ga0307378_109833132 | 3300031566 | Soil | MFESLFAAVLPVMKDLLWAAAGMLLTYMLNKIQSYCS |
| Ga0315899_100419495 | 3300031784 | Freshwater | MFESLFAAVLPVMKDLLWAAAGMLLTYALNKIQSYCS |
| Ga0315899_100423553 | 3300031784 | Freshwater | MFESLFAIVFPVVKDLLWAAAGMLLTYAINKIQTQFNPI |
| Ga0315900_101955496 | 3300031787 | Freshwater | TNLSQLQLMFESLFAAVLPVVKDLLWAAAGMALTYLLNKIQTQFNTI |
| Ga0315909_1000238113 | 3300031857 | Freshwater | MFETFLGALIPVVKDLLWAAAGMLLTYTINKIQSHFQHI |
| Ga0315909_1000365629 | 3300031857 | Freshwater | MFESLFAAVLPVMKDLLWAAAGILLTYAFNKIQSYCL |
| Ga0315909_102139241 | 3300031857 | Freshwater | MFESLFVAVLPVMKDLLWAAAGIALTYLFNKFQTQFN |
| Ga0315909_102904622 | 3300031857 | Freshwater | MFESLFAAVLPVMKDLFWAAAGMLLTFALNKFQSQFN |
| Ga0315904_101628875 | 3300031951 | Freshwater | MFESLFAAVLPVMKELLWAAAGALLTYALNKFQSQFIYET |
| Ga0315904_101771485 | 3300031951 | Freshwater | SQHHTMFESLFAAVLPVMKDLLWAAAGIALTYLFNKFQTQFN |
| Ga0315904_104248752 | 3300031951 | Freshwater | MFESLLTAVLPVMKDLLWTAAGMLLTYVLNKFQTQFI |
| Ga0315904_106464383 | 3300031951 | Freshwater | MFESLFAAVFPVMKDLLWAAAGMLLTYAINKFQTQFN |
| Ga0315904_107836062 | 3300031951 | Freshwater | MFESLLATVLPVLKDILWAAAGALLTYALNKFQSHFN |
| Ga0315904_113827562 | 3300031951 | Freshwater | MFESLFAAVLPVMKDLLWAAAGILLTYAINKIQTQFN |
| Ga0315901_1001419216 | 3300031963 | Freshwater | MFESIFGAVLPVLKDLLWAAAGMALTYLINKFQSNFQHI |
| Ga0315901_107096712 | 3300031963 | Freshwater | MFESLFAAVLPVMKDLLWAAAGMLLTFALNKFQSQFN |
| Ga0315906_106249603 | 3300032050 | Freshwater | MFESLLAAVLPVMKDLLWAAAGIALTYFFNKFQTQFN |
| Ga0315902_111183252 | 3300032093 | Freshwater | MFESILGIVLPVVKDLLWAAAGMALTYLINKVQHSWA |
| Ga0334986_0444310_355_468 | 3300034012 | Freshwater | MFESLFATVLPVLKDILWAAAGALLTYALNKFQSHFN |
| Ga0335019_0182194_1117_1239 | 3300034066 | Freshwater | MFESLFTAVLPVIKDLLWAAAGALLTYALNKFQSQFIYET |
| Ga0310127_014567_861_983 | 3300034072 | Fracking Water | MFESLLATVLPVLKDILWAASGALLTYALNKFQSQFIYET |
| Ga0310127_112611_639_752 | 3300034072 | Fracking Water | MFESLFAAVLPVLKDILWAAAGALLTYALNKFQSQFN |
| Ga0310130_0002214_1469_1591 | 3300034073 | Fracking Water | MFESLLATVLPVLKDILWAAAGALLTYALNKFQSQFIYET |
| Ga0310130_0045492_548_661 | 3300034073 | Fracking Water | MFESLLATVLPVIKDFLWAAAGMLLTYMLNKVQSQFN |
| Ga0335031_0545836_395_508 | 3300034104 | Freshwater | MFESLFAAVLPVMKDILWAAAGALLTYVLNKFQSQFN |
| Ga0335036_0000173_11708_11821 | 3300034106 | Freshwater | MFESLFAAVLPVMKELLWAAAGMALTFVMTKLTHSWS |
| Ga0335051_0127359_813_935 | 3300034109 | Freshwater | MFESLLAAVLPVMKDLLWAAAGALLTYVLNKFQSQFIYET |
| Ga0335051_0566322_21_140 | 3300034109 | Freshwater | MFESLFAAVLPVVKDLLWAAAGMLLTYAINKIQSQFNTI |
| Ga0348335_006147_2189_2314 | 3300034374 | Aqueous | MFESLLATVLPVMKDLLWAAAGMLLTYMLNKIQSNFQTISS |
| ⦗Top⦘ |