| Basic Information | |
|---|---|
| Family ID | F013454 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 271 |
| Average Sequence Length | 41 residues |
| Representative Sequence | RSFRVVQLDGSQYTDVAEPGGSDYTNVVQLDRSEYTEVR |
| Number of Associated Samples | 213 |
| Number of Associated Scaffolds | 271 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.75 % |
| % of genes near scaffold ends (potentially truncated) | 97.05 % |
| % of genes from short scaffolds (< 2000 bps) | 88.93 % |
| Associated GOLD sequencing projects | 206 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.277 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.413 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.044 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.970 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.45% β-sheet: 0.00% Coil/Unstructured: 89.55% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 271 Family Scaffolds |
|---|---|---|
| PF01872 | RibD_C | 1.85 |
| PF13344 | Hydrolase_6 | 1.85 |
| PF12680 | SnoaL_2 | 1.85 |
| PF00005 | ABC_tran | 1.48 |
| PF00583 | Acetyltransf_1 | 1.48 |
| PF07045 | DUF1330 | 1.11 |
| PF00132 | Hexapep | 1.11 |
| PF08240 | ADH_N | 1.11 |
| PF13676 | TIR_2 | 1.11 |
| PF07859 | Abhydrolase_3 | 1.11 |
| PF11774 | Lsr2 | 1.11 |
| PF01927 | Mut7-C | 1.11 |
| PF04542 | Sigma70_r2 | 1.11 |
| PF13847 | Methyltransf_31 | 1.11 |
| PF13193 | AMP-binding_C | 1.11 |
| PF01243 | Putative_PNPOx | 0.74 |
| PF12002 | MgsA_C | 0.74 |
| PF13376 | OmdA | 0.74 |
| PF01734 | Patatin | 0.74 |
| PF07929 | PRiA4_ORF3 | 0.74 |
| PF00293 | NUDIX | 0.74 |
| PF02909 | TetR_C_1 | 0.74 |
| PF08281 | Sigma70_r4_2 | 0.74 |
| PF02567 | PhzC-PhzF | 0.74 |
| PF16640 | Big_3_5 | 0.74 |
| PF00144 | Beta-lactamase | 0.74 |
| PF01850 | PIN | 0.74 |
| PF01230 | HIT | 0.74 |
| PF01145 | Band_7 | 0.74 |
| PF01494 | FAD_binding_3 | 0.74 |
| PF01979 | Amidohydro_1 | 0.74 |
| PF01381 | HTH_3 | 0.37 |
| PF01148 | CTP_transf_1 | 0.37 |
| PF11239 | DUF3040 | 0.37 |
| PF00355 | Rieske | 0.37 |
| PF00903 | Glyoxalase | 0.37 |
| PF05977 | MFS_3 | 0.37 |
| PF07228 | SpoIIE | 0.37 |
| PF13489 | Methyltransf_23 | 0.37 |
| PF13191 | AAA_16 | 0.37 |
| PF12867 | DinB_2 | 0.37 |
| PF08530 | PepX_C | 0.37 |
| PF06863 | DUF1254 | 0.37 |
| PF12697 | Abhydrolase_6 | 0.37 |
| PF12840 | HTH_20 | 0.37 |
| PF01022 | HTH_5 | 0.37 |
| PF11716 | MDMPI_N | 0.37 |
| PF12833 | HTH_18 | 0.37 |
| PF05016 | ParE_toxin | 0.37 |
| PF04493 | Endonuclease_5 | 0.37 |
| PF01431 | Peptidase_M13 | 0.37 |
| PF00296 | Bac_luciferase | 0.37 |
| PF14024 | DUF4240 | 0.37 |
| PF00069 | Pkinase | 0.37 |
| PF06197 | DUF998 | 0.37 |
| PF03636 | Glyco_hydro_65N | 0.37 |
| PF03466 | LysR_substrate | 0.37 |
| PF13419 | HAD_2 | 0.37 |
| PF07885 | Ion_trans_2 | 0.37 |
| PF13977 | TetR_C_6 | 0.37 |
| PF13561 | adh_short_C2 | 0.37 |
| PF03795 | YCII | 0.37 |
| PF13298 | LigD_N | 0.37 |
| PF02771 | Acyl-CoA_dh_N | 0.37 |
| PF13565 | HTH_32 | 0.37 |
| PF08327 | AHSA1 | 0.37 |
| PF03435 | Sacchrp_dh_NADP | 0.37 |
| PF12900 | Pyridox_ox_2 | 0.37 |
| PF12681 | Glyoxalase_2 | 0.37 |
| PF02518 | HATPase_c | 0.37 |
| PF08241 | Methyltransf_11 | 0.37 |
| PF12893 | Lumazine_bd_2 | 0.37 |
| PF00291 | PALP | 0.37 |
| PF13231 | PMT_2 | 0.37 |
| PF02594 | DUF167 | 0.37 |
| PF00171 | Aldedh | 0.37 |
| PF02577 | BFN_dom | 0.37 |
| PF01425 | Amidase | 0.37 |
| PF16874 | Glyco_hydro_36C | 0.37 |
| PF13411 | MerR_1 | 0.37 |
| PF04960 | Glutaminase | 0.37 |
| PF02852 | Pyr_redox_dim | 0.37 |
| PF00596 | Aldolase_II | 0.37 |
| PF13302 | Acetyltransf_3 | 0.37 |
| PF13594 | Obsolete Pfam Family | 0.37 |
| PF13377 | Peripla_BP_3 | 0.37 |
| PF12706 | Lactamase_B_2 | 0.37 |
| PF14312 | FG-GAP_2 | 0.37 |
| COG ID | Name | Functional Category | % Frequency in 271 Family Scaffolds |
|---|---|---|---|
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.85 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.85 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.48 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.48 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.11 |
| COG1656 | Uncharacterized conserved protein, contains PIN-related Mut7-C RNAse domain | General function prediction only [R] | 1.11 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.11 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 1.11 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.11 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.11 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 1.11 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.74 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.74 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.74 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.74 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.74 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.74 |
| COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 0.74 |
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 0.74 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.74 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.74 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.74 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.37 |
| COG1554 | Phosphatase/phosphodiesterase/kojibiose phosphorylase YcjT/PafA/Npp1, AlkP superfamily | Carbohydrate transport and metabolism [G] | 0.37 |
| COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.37 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.37 |
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 0.37 |
| COG3371 | Uncharacterized membrane protein | Function unknown [S] | 0.37 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.37 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.37 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.37 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.37 |
| COG2066 | Glutaminase | Amino acid transport and metabolism [E] | 0.37 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.37 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.37 |
| COG1872 | Uncharacterized conserved protein YggU, UPF0235/DUF167 family | Function unknown [S] | 0.37 |
| COG1259 | Bifunctional DNase/RNase | General function prediction only [R] | 0.37 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.37 |
| COG1515 | Deoxyinosine 3'-endonuclease (endonuclease V) | Replication, recombination and repair [L] | 0.37 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.01 % |
| Unclassified | root | N/A | 23.99 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q02GFDW8 | Not Available | 501 | Open in IMG/M |
| 3300000567|JGI12270J11330_10198441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 688 | Open in IMG/M |
| 3300000956|JGI10216J12902_119188191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Dietziaceae → Dietzia → Dietzia alimentaria | 662 | Open in IMG/M |
| 3300001403|JGI20205J14842_1030902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101636891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 542 | Open in IMG/M |
| 3300003368|JGI26340J50214_10107443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 712 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10470449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
| 3300004091|Ga0062387_101581642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
| 3300004152|Ga0062386_100217596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1506 | Open in IMG/M |
| 3300004152|Ga0062386_100482873 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300005166|Ga0066674_10414560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 622 | Open in IMG/M |
| 3300005332|Ga0066388_102506841 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300005440|Ga0070705_100435330 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300005445|Ga0070708_100644337 | Not Available | 998 | Open in IMG/M |
| 3300005529|Ga0070741_10278357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1580 | Open in IMG/M |
| 3300005537|Ga0070730_10426125 | Not Available | 856 | Open in IMG/M |
| 3300005616|Ga0068852_102139035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 581 | Open in IMG/M |
| 3300005712|Ga0070764_10203735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 1110 | Open in IMG/M |
| 3300005764|Ga0066903_103774140 | Not Available | 814 | Open in IMG/M |
| 3300005764|Ga0066903_105548132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 665 | Open in IMG/M |
| 3300005921|Ga0070766_10378458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 923 | Open in IMG/M |
| 3300005994|Ga0066789_10063941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1599 | Open in IMG/M |
| 3300005995|Ga0066790_10007141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. ATCC PTA-5024 | 4954 | Open in IMG/M |
| 3300006028|Ga0070717_11465423 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300006028|Ga0070717_11834579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 548 | Open in IMG/M |
| 3300006058|Ga0075432_10424220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Longimycelium → Longimycelium tulufanense | 579 | Open in IMG/M |
| 3300006173|Ga0070716_101143986 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300006173|Ga0070716_101199102 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300006176|Ga0070765_100519373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1120 | Open in IMG/M |
| 3300006755|Ga0079222_10817381 | Not Available | 764 | Open in IMG/M |
| 3300006934|Ga0080680_1221964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 571 | Open in IMG/M |
| 3300009089|Ga0099828_10172691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1920 | Open in IMG/M |
| 3300009098|Ga0105245_10742910 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300009520|Ga0116214_1065359 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300009521|Ga0116222_1336713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 654 | Open in IMG/M |
| 3300009521|Ga0116222_1366126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 626 | Open in IMG/M |
| 3300009551|Ga0105238_10501989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1214 | Open in IMG/M |
| 3300009624|Ga0116105_1190184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
| 3300009672|Ga0116215_1111973 | Not Available | 1222 | Open in IMG/M |
| 3300009683|Ga0116224_10592599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 529 | Open in IMG/M |
| 3300009792|Ga0126374_11381784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 573 | Open in IMG/M |
| 3300009824|Ga0116219_10026543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia dioxanivorans | 3513 | Open in IMG/M |
| 3300010043|Ga0126380_11131195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 670 | Open in IMG/M |
| 3300010043|Ga0126380_11978969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
| 3300010046|Ga0126384_10203832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1568 | Open in IMG/M |
| 3300010047|Ga0126382_10292363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1219 | Open in IMG/M |
| 3300010048|Ga0126373_10462570 | Not Available | 1305 | Open in IMG/M |
| 3300010048|Ga0126373_11182296 | Not Available | 831 | Open in IMG/M |
| 3300010048|Ga0126373_11192059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 828 | Open in IMG/M |
| 3300010048|Ga0126373_12507071 | Not Available | 575 | Open in IMG/M |
| 3300010048|Ga0126373_12997254 | Not Available | 526 | Open in IMG/M |
| 3300010341|Ga0074045_10984656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
| 3300010358|Ga0126370_10221675 | Not Available | 1445 | Open in IMG/M |
| 3300010359|Ga0126376_10988261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 840 | Open in IMG/M |
| 3300010359|Ga0126376_12183880 | Not Available | 598 | Open in IMG/M |
| 3300010360|Ga0126372_11485550 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300010361|Ga0126378_10033310 | Not Available | 4637 | Open in IMG/M |
| 3300010361|Ga0126378_11560998 | Not Available | 749 | Open in IMG/M |
| 3300010362|Ga0126377_12024960 | Not Available | 652 | Open in IMG/M |
| 3300010373|Ga0134128_12184188 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300010376|Ga0126381_100049803 | All Organisms → cellular organisms → Bacteria | 5122 | Open in IMG/M |
| 3300010376|Ga0126381_101237756 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300010376|Ga0126381_102849278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 689 | Open in IMG/M |
| 3300010376|Ga0126381_103165677 | Not Available | 651 | Open in IMG/M |
| 3300010376|Ga0126381_103980058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 575 | Open in IMG/M |
| 3300010376|Ga0126381_105117367 | Not Available | 502 | Open in IMG/M |
| 3300010397|Ga0134124_12706514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
| 3300010398|Ga0126383_11815768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 698 | Open in IMG/M |
| 3300010398|Ga0126383_12500717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
| 3300010854|Ga0126360_1053500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 707 | Open in IMG/M |
| 3300010854|Ga0126360_1105247 | Not Available | 508 | Open in IMG/M |
| 3300010859|Ga0126352_1113357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineosporia → Kineosporia babensis | 773 | Open in IMG/M |
| 3300010865|Ga0126346_1119029 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300011087|Ga0138570_1217081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 685 | Open in IMG/M |
| 3300011269|Ga0137392_11547058 | Not Available | 522 | Open in IMG/M |
| 3300011270|Ga0137391_11030374 | Not Available | 669 | Open in IMG/M |
| 3300012181|Ga0153922_1087589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 703 | Open in IMG/M |
| 3300012202|Ga0137363_11499708 | Not Available | 565 | Open in IMG/M |
| 3300012206|Ga0137380_10348178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1322 | Open in IMG/M |
| 3300012208|Ga0137376_10076891 | Not Available | 2790 | Open in IMG/M |
| 3300012209|Ga0137379_10189806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1967 | Open in IMG/M |
| 3300012285|Ga0137370_10475018 | Not Available | 764 | Open in IMG/M |
| 3300012354|Ga0137366_10425859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Dactylosporangium | 964 | Open in IMG/M |
| 3300012917|Ga0137395_11142021 | Not Available | 549 | Open in IMG/M |
| 3300012917|Ga0137395_11160732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
| 3300012930|Ga0137407_10066431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2988 | Open in IMG/M |
| 3300012960|Ga0164301_10443460 | Not Available | 921 | Open in IMG/M |
| 3300012971|Ga0126369_11311101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 814 | Open in IMG/M |
| 3300014155|Ga0181524_10345306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 664 | Open in IMG/M |
| 3300014495|Ga0182015_10450765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. | 826 | Open in IMG/M |
| 3300014501|Ga0182024_12934722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
| 3300014745|Ga0157377_10487099 | Not Available | 859 | Open in IMG/M |
| 3300014838|Ga0182030_10304230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1753 | Open in IMG/M |
| 3300014968|Ga0157379_12397145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 526 | Open in IMG/M |
| 3300015264|Ga0137403_11074781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 651 | Open in IMG/M |
| 3300016341|Ga0182035_11904099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Streptomonospora → unclassified Streptomonospora → Streptomonospora sp. PA3 | 539 | Open in IMG/M |
| 3300016422|Ga0182039_11380789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 640 | Open in IMG/M |
| 3300016422|Ga0182039_11819820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 558 | Open in IMG/M |
| 3300016445|Ga0182038_10773524 | Not Available | 840 | Open in IMG/M |
| 3300017821|Ga0187812_1020358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2289 | Open in IMG/M |
| 3300017821|Ga0187812_1100629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 945 | Open in IMG/M |
| 3300017924|Ga0187820_1143147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 715 | Open in IMG/M |
| 3300017926|Ga0187807_1116564 | Not Available | 845 | Open in IMG/M |
| 3300017928|Ga0187806_1186980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 697 | Open in IMG/M |
| 3300017932|Ga0187814_10365329 | Not Available | 558 | Open in IMG/M |
| 3300017942|Ga0187808_10092094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1313 | Open in IMG/M |
| 3300017942|Ga0187808_10263269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 773 | Open in IMG/M |
| 3300017943|Ga0187819_10489018 | Not Available | 702 | Open in IMG/M |
| 3300017946|Ga0187879_10023692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3770 | Open in IMG/M |
| 3300017948|Ga0187847_10246037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 974 | Open in IMG/M |
| 3300017959|Ga0187779_11108544 | Not Available | 553 | Open in IMG/M |
| 3300017959|Ga0187779_11121785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 550 | Open in IMG/M |
| 3300017970|Ga0187783_10331564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1108 | Open in IMG/M |
| 3300017970|Ga0187783_10660322 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300017974|Ga0187777_10702461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 717 | Open in IMG/M |
| 3300018012|Ga0187810_10525442 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300018038|Ga0187855_10308306 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300018038|Ga0187855_10584859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 650 | Open in IMG/M |
| 3300018040|Ga0187862_10736580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 574 | Open in IMG/M |
| 3300018085|Ga0187772_10474332 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300018085|Ga0187772_11266805 | Not Available | 545 | Open in IMG/M |
| 3300019888|Ga0193751_1240209 | Not Available | 568 | Open in IMG/M |
| 3300020580|Ga0210403_11225446 | Not Available | 577 | Open in IMG/M |
| 3300020583|Ga0210401_10122281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2441 | Open in IMG/M |
| 3300021171|Ga0210405_11377747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 515 | Open in IMG/M |
| 3300021388|Ga0213875_10587996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → unclassified Micromonospora → Micromonospora sp. Llam0 | 537 | Open in IMG/M |
| 3300021402|Ga0210385_11463860 | Not Available | 522 | Open in IMG/M |
| 3300021405|Ga0210387_11279162 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300021477|Ga0210398_10697186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 822 | Open in IMG/M |
| 3300021478|Ga0210402_10491596 | Not Available | 1140 | Open in IMG/M |
| 3300021478|Ga0210402_11448119 | Not Available | 614 | Open in IMG/M |
| 3300021559|Ga0210409_11243991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
| 3300021858|Ga0213852_1136927 | Not Available | 555 | Open in IMG/M |
| 3300021858|Ga0213852_1457617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 812 | Open in IMG/M |
| 3300021861|Ga0213853_10312300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1066 | Open in IMG/M |
| 3300022722|Ga0242657_1093560 | Not Available | 731 | Open in IMG/M |
| 3300024227|Ga0228598_1059022 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300024271|Ga0224564_1032620 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300025627|Ga0208220_1176166 | Not Available | 532 | Open in IMG/M |
| 3300025634|Ga0208589_1006458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 3787 | Open in IMG/M |
| 3300025916|Ga0207663_11024412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 663 | Open in IMG/M |
| 3300025928|Ga0207700_11754408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
| 3300026088|Ga0207641_10280946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1566 | Open in IMG/M |
| 3300026116|Ga0207674_10979292 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300026557|Ga0179587_10337226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 976 | Open in IMG/M |
| 3300027029|Ga0208731_1012219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 889 | Open in IMG/M |
| 3300027089|Ga0207943_113324 | Not Available | 526 | Open in IMG/M |
| 3300027583|Ga0209527_1027342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1273 | Open in IMG/M |
| 3300027662|Ga0208565_1047489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1390 | Open in IMG/M |
| 3300027857|Ga0209166_10362496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 756 | Open in IMG/M |
| 3300027862|Ga0209701_10572022 | Not Available | 604 | Open in IMG/M |
| 3300027895|Ga0209624_10065994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2331 | Open in IMG/M |
| 3300027895|Ga0209624_10322984 | Not Available | 1028 | Open in IMG/M |
| 3300027895|Ga0209624_10459133 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300027905|Ga0209415_10178750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2055 | Open in IMG/M |
| 3300027905|Ga0209415_10618228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 798 | Open in IMG/M |
| 3300028718|Ga0307307_10135555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Longimycelium → Longimycelium tulufanense | 764 | Open in IMG/M |
| 3300028742|Ga0302220_10009349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5482 | Open in IMG/M |
| 3300028808|Ga0302228_10291364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 732 | Open in IMG/M |
| 3300028877|Ga0302235_10192990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 899 | Open in IMG/M |
| 3300028877|Ga0302235_10289531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 709 | Open in IMG/M |
| 3300028906|Ga0308309_11903592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 502 | Open in IMG/M |
| 3300029911|Ga0311361_10702777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 926 | Open in IMG/M |
| 3300029953|Ga0311343_10647754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 895 | Open in IMG/M |
| 3300029955|Ga0311342_11342810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 506 | Open in IMG/M |
| 3300029999|Ga0311339_10497088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1242 | Open in IMG/M |
| 3300030053|Ga0302177_10328682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 810 | Open in IMG/M |
| 3300030053|Ga0302177_10613664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 555 | Open in IMG/M |
| 3300030056|Ga0302181_10283891 | Not Available | 739 | Open in IMG/M |
| 3300030494|Ga0310037_10153200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1044 | Open in IMG/M |
| 3300030494|Ga0310037_10191267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 911 | Open in IMG/M |
| 3300030509|Ga0302183_10075149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1333 | Open in IMG/M |
| 3300030580|Ga0311355_10880532 | Not Available | 815 | Open in IMG/M |
| 3300030617|Ga0311356_11451378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 622 | Open in IMG/M |
| 3300030618|Ga0311354_11105102 | Not Available | 723 | Open in IMG/M |
| 3300030618|Ga0311354_11223937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Planotetraspora → Planotetraspora kaengkrachanensis | 678 | Open in IMG/M |
| 3300030677|Ga0302317_10486993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae | 537 | Open in IMG/M |
| 3300030688|Ga0311345_11238356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 540 | Open in IMG/M |
| 3300030730|Ga0307482_1187715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 622 | Open in IMG/M |
| 3300030740|Ga0265460_12094294 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300030743|Ga0265461_12243982 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300031027|Ga0302308_10003946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11739 | Open in IMG/M |
| 3300031057|Ga0170834_105253669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 967 | Open in IMG/M |
| 3300031122|Ga0170822_13573202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 781 | Open in IMG/M |
| 3300031231|Ga0170824_102871373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 1175 | Open in IMG/M |
| 3300031446|Ga0170820_15215408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 972 | Open in IMG/M |
| 3300031546|Ga0318538_10317284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 840 | Open in IMG/M |
| 3300031549|Ga0318571_10210573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 700 | Open in IMG/M |
| 3300031564|Ga0318573_10588762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 599 | Open in IMG/M |
| 3300031573|Ga0310915_10617486 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300031640|Ga0318555_10800946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
| 3300031668|Ga0318542_10692757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
| 3300031679|Ga0318561_10135713 | Not Available | 1315 | Open in IMG/M |
| 3300031679|Ga0318561_10771714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. SYSU D00514 | 528 | Open in IMG/M |
| 3300031680|Ga0318574_10350427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium kansasii | 861 | Open in IMG/M |
| 3300031680|Ga0318574_10389813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 813 | Open in IMG/M |
| 3300031681|Ga0318572_10348865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 878 | Open in IMG/M |
| 3300031682|Ga0318560_10287438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 885 | Open in IMG/M |
| 3300031682|Ga0318560_10697535 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300031682|Ga0318560_10791984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 3300031708|Ga0310686_102231870 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300031719|Ga0306917_11245370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 577 | Open in IMG/M |
| 3300031736|Ga0318501_10464634 | Not Available | 688 | Open in IMG/M |
| 3300031744|Ga0306918_10964589 | Not Available | 663 | Open in IMG/M |
| 3300031763|Ga0318537_10254105 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300031769|Ga0318526_10359889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 595 | Open in IMG/M |
| 3300031771|Ga0318546_11143099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
| 3300031781|Ga0318547_10240059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1090 | Open in IMG/M |
| 3300031781|Ga0318547_10275635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1018 | Open in IMG/M |
| 3300031781|Ga0318547_10336743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 920 | Open in IMG/M |
| 3300031792|Ga0318529_10074318 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
| 3300031793|Ga0318548_10519745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 581 | Open in IMG/M |
| 3300031797|Ga0318550_10182124 | Not Available | 1014 | Open in IMG/M |
| 3300031798|Ga0318523_10395996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 686 | Open in IMG/M |
| 3300031798|Ga0318523_10474290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 620 | Open in IMG/M |
| 3300031798|Ga0318523_10614070 | Not Available | 535 | Open in IMG/M |
| 3300031831|Ga0318564_10005058 | All Organisms → cellular organisms → Bacteria | 4867 | Open in IMG/M |
| 3300031833|Ga0310917_10435035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 892 | Open in IMG/M |
| 3300031833|Ga0310917_10472647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 853 | Open in IMG/M |
| 3300031835|Ga0318517_10177102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 958 | Open in IMG/M |
| 3300031860|Ga0318495_10024326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2616 | Open in IMG/M |
| 3300031879|Ga0306919_10271503 | Not Available | 1281 | Open in IMG/M |
| 3300031890|Ga0306925_10895361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 913 | Open in IMG/M |
| 3300031890|Ga0306925_12179181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. SYSU D00514 | 516 | Open in IMG/M |
| 3300031893|Ga0318536_10101636 | Not Available | 1442 | Open in IMG/M |
| 3300031893|Ga0318536_10123353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1309 | Open in IMG/M |
| 3300031893|Ga0318536_10557361 | Not Available | 574 | Open in IMG/M |
| 3300031894|Ga0318522_10107301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1037 | Open in IMG/M |
| 3300031896|Ga0318551_10129445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1366 | Open in IMG/M |
| 3300031896|Ga0318551_10138577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1322 | Open in IMG/M |
| 3300031910|Ga0306923_12328075 | Not Available | 533 | Open in IMG/M |
| 3300031941|Ga0310912_10497639 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300031942|Ga0310916_10411580 | Not Available | 1151 | Open in IMG/M |
| 3300031946|Ga0310910_10874665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 706 | Open in IMG/M |
| 3300031947|Ga0310909_11266430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 594 | Open in IMG/M |
| 3300031954|Ga0306926_12528751 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8 | 562 | Open in IMG/M |
| 3300031981|Ga0318531_10426406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 600 | Open in IMG/M |
| 3300032001|Ga0306922_10066352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3763 | Open in IMG/M |
| 3300032008|Ga0318562_10072955 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1916 | Open in IMG/M |
| 3300032009|Ga0318563_10453104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 694 | Open in IMG/M |
| 3300032010|Ga0318569_10031797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2202 | Open in IMG/M |
| 3300032010|Ga0318569_10328539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 712 | Open in IMG/M |
| 3300032039|Ga0318559_10403498 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300032044|Ga0318558_10310104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 780 | Open in IMG/M |
| 3300032051|Ga0318532_10011636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2713 | Open in IMG/M |
| 3300032054|Ga0318570_10294216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. L2C089B000 | 738 | Open in IMG/M |
| 3300032055|Ga0318575_10173737 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8 | 1077 | Open in IMG/M |
| 3300032059|Ga0318533_10425716 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300032059|Ga0318533_10448879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 944 | Open in IMG/M |
| 3300032065|Ga0318513_10125394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1214 | Open in IMG/M |
| 3300032065|Ga0318513_10142904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1139 | Open in IMG/M |
| 3300032067|Ga0318524_10029314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2529 | Open in IMG/M |
| 3300032067|Ga0318524_10329770 | Not Available | 791 | Open in IMG/M |
| 3300032067|Ga0318524_10795212 | Not Available | 500 | Open in IMG/M |
| 3300032089|Ga0318525_10204828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1014 | Open in IMG/M |
| 3300032180|Ga0307471_100817391 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300032261|Ga0306920_100293270 | All Organisms → cellular organisms → Bacteria | 2423 | Open in IMG/M |
| 3300032261|Ga0306920_100923551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1275 | Open in IMG/M |
| 3300032770|Ga0335085_10336975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1773 | Open in IMG/M |
| 3300032892|Ga0335081_10051144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6471 | Open in IMG/M |
| 3300032896|Ga0335075_10221807 | All Organisms → cellular organisms → Bacteria | 2224 | Open in IMG/M |
| 3300033134|Ga0335073_10261493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2101 | Open in IMG/M |
| 3300033134|Ga0335073_12129427 | Not Available | 507 | Open in IMG/M |
| 3300033289|Ga0310914_10765113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 863 | Open in IMG/M |
| 3300033289|Ga0310914_11049022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 716 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.41% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.59% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.54% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.17% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.80% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.95% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.58% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.85% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.48% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.48% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.48% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.48% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.11% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.11% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.11% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.11% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.74% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.37% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.37% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.37% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.37% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.37% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.37% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.37% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.37% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.37% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.37% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.37% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.37% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.37% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001403 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006934 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A1 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010854 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010865 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011087 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012181 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaG | Host-Associated | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025634 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027029 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF045 (SPAdes) | Environmental | Open in IMG/M |
| 3300027089 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_07515830 | 2170459005 | Grass Soil | EGSFRVVRLNGGQDADVAEPQGGDYANLVQLDRSQYTEVP |
| JGI12270J11330_101984412 | 3300000567 | Peatlands Soil | RVVQLDGSQYTDVAEPXGSXYANVVQLDRSEYTEVR* |
| JGI10216J12902_1191881911 | 3300000956 | Soil | LLSGGSLGVVRLDGSQDSDVAEPGGGGYANLVQLDRSEYTEVR* |
| JGI20205J14842_10309021 | 3300001403 | Arctic Peat Soil | LRKLLSGGSFRVVRLDGSQYTDVAEPEGRHYTNLVQLDRSEYTEVR* |
| JGIcombinedJ26739_1016368912 | 3300002245 | Forest Soil | VVRLDGSQDTDVAEPEGRHYTNLVQLDRSEYTEVR* |
| JGI26340J50214_101074432 | 3300003368 | Bog Forest Soil | LRKLVAGRSFRVVQLDGSQYTDVAEPEGSDYTDVVQLDRSQYTEVR* |
| JGIcombinedJ51221_104704491 | 3300003505 | Forest Soil | KLLSGGSFRVLRLDGSQYTDLSEPEGSDYANVVELDPSEYTEIR* |
| Ga0062387_1015816421 | 3300004091 | Bog Forest Soil | LRKLLSGRSFRVGQLDGSQYTDVAEPAGSDYANVVRLDRSEYTEVR* |
| Ga0062386_1002175964 | 3300004152 | Bog Forest Soil | LRKLVAGRSFRVVQLDGSQYADVAEPEGSDYIDVVQLDPSEYTEVR* |
| Ga0062386_1004828731 | 3300004152 | Bog Forest Soil | GRSFRVVQLDGSQYTDVAEPGESDYANVVQLDRSEYTEVR* |
| Ga0066674_104145601 | 3300005166 | Soil | LRKLLSGDSFRVVRLDSSQYTDVVEPEGGDYTNLVQLDRSEYTEVR* |
| Ga0066388_1025068412 | 3300005332 | Tropical Forest Soil | KLLSGSSFRLVQLDGSQYTDVAEPGGGDYTNVVQLDRSEYTEVR* |
| Ga0070705_1004353301 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LLSGDSFRVIRLDGSRYTDVAEPEGGDYTNLVQLDRSEYTEVR* |
| Ga0070708_1006443371 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LLSGGSFRVMRLNGSQYTDVAEQQGSDYANLVQLDRSEYTAVR* |
| Ga0070741_102783573 | 3300005529 | Surface Soil | SFRAVRLNGSDYTDAAEPEGSDYTNLVQLDRSDYTEVR* |
| Ga0070730_104261253 | 3300005537 | Surface Soil | GGGFRVVRLNGSQFTDVAEPAGSDYANLVQLDPSEYTELR* |
| Ga0068852_1021390351 | 3300005616 | Corn Rhizosphere | SSFPVVRLDGSQYTDAAEPEGSHYPNLVQLDRSEYTEVR* |
| Ga0070764_102037353 | 3300005712 | Soil | FRVVQLDGSQYGDAAEPDGSDYPDVVQLGSSEYTEVR* |
| Ga0066903_1037741402 | 3300005764 | Tropical Forest Soil | LDGSQYTDVAEPVAEPEGSDYPNLVQLDRSEYTEVR* |
| Ga0066903_1055481322 | 3300005764 | Tropical Forest Soil | KLVSGSSFRVVPLDDSRYVDVAEPQGSDYTNVVQLDRSQYTEVH* |
| Ga0070766_103784581 | 3300005921 | Soil | GSFRVLRLDGSQYTDVAEPEGSDYANVVELDRSEYTEVR* |
| Ga0066789_100639413 | 3300005994 | Soil | SFRVVRLDGSQYTDVAEPEGRHYTNLLQLDRSEYTEVR* |
| Ga0066790_100071419 | 3300005995 | Soil | SFRVVQLDGSQYTGVAEPEGSDYTNVVQLDRSQYTEVR* |
| Ga0070717_114654231 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DSFRVVRLDGSQYTDVAEPEGSDYTNLVQLDRSEYTEVR* |
| Ga0070717_118345792 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LLSGGSFRVVPLDGSQYTDVAEPEGRPYTNLVQLDRSEYTEVR* |
| Ga0075432_104242202 | 3300006058 | Populus Rhizosphere | GSFRVVRLDGSQYTDVAEPAGSDYTNLVQLDRSQYTEVR* |
| Ga0070716_1011439861 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VVRLDGSQYTDVADPQGSDHANVVQLDPSEYTEVR* |
| Ga0070716_1011991021 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | RVVRLDGSQYTDVAEPEGSDYTNLVQLDRSEYTEVR* |
| Ga0070765_1005193731 | 3300006176 | Soil | RASFSVVQPDHRQHADDSAEPNGSDYADVVQLDRSEYTEVR* |
| Ga0079222_108173812 | 3300006755 | Agricultural Soil | GSFRVVQLDGSQDTDVAEPEGSDYTNLVQLDRSEYTEVR* |
| Ga0080680_12219641 | 3300006934 | Tropical Rainforest Soil | SFRIVQLNGSQYTDVAEPEGSDYTNLVQLDRSEYTEVR* |
| Ga0099828_101726912 | 3300009089 | Vadose Zone Soil | SVGSFRVVRLNGSQYTDVAEPEGSDYTSLVPLDRSEYTEVR* |
| Ga0105245_107429103 | 3300009098 | Miscanthus Rhizosphere | DSFRVIRLDGSQYTDVAEPEGGDYTNLVQLDRSEYTEVR* |
| Ga0116214_10653591 | 3300009520 | Peatlands Soil | SFRVVQLDGSQYTDVAEPEGSDYTDVVQLDRSEYTEVR* |
| Ga0116222_13367132 | 3300009521 | Peatlands Soil | AGRSFRVVQLDGSQYTDVAEPEGSDYTDVVRLDRSEYTEVR* |
| Ga0116222_13661262 | 3300009521 | Peatlands Soil | FRVVQLDGSQYTDVAEPEGSDYTDVVQLDRSEYTEVR* |
| Ga0105238_105019891 | 3300009551 | Corn Rhizosphere | GGSFRVVRLDGSQYADVAEPEGSDHASLVQLDRREYTEVR* |
| Ga0116105_11901842 | 3300009624 | Peatland | RVVQLDDSQYTDIAEPKDSGYTNVVQLDRSEYTEVR* |
| Ga0116215_11119731 | 3300009672 | Peatlands Soil | HLRKLVAGRSFRVVQLDGSQYTDVAEPEGSDYTDVVQLDRSEYTEVR* |
| Ga0116224_105925991 | 3300009683 | Peatlands Soil | FRIVQLDGSQYTDVAEPQGSGYANVVQLDRSEYTEVR* |
| Ga0126374_113817841 | 3300009792 | Tropical Forest Soil | SGRSFGVVQLDGSQYTDVAEPGGSDYTNVVQLDRSQYTEVR* |
| Ga0116219_100265435 | 3300009824 | Peatlands Soil | RHLRKLVAGRSFRVVQLDGSQYTDVAEPQGSDYANVVQLDRSEYTEVR* |
| Ga0126380_111311952 | 3300010043 | Tropical Forest Soil | SAEGWRVVRLDASQYTDVAEPEDSGYTNLVQLDRSEYTEVR* |
| Ga0126380_119789692 | 3300010043 | Tropical Forest Soil | SGTSLRVVQLDGSQYTGVAEPAGSDYTNVVQLDRSQYTEVR* |
| Ga0126384_102038323 | 3300010046 | Tropical Forest Soil | RQLRKLVSGGSFRVVRLDGSQYTDVAEPEGSGYPNLVQLDRSEYTEVR* |
| Ga0126382_102923631 | 3300010047 | Tropical Forest Soil | GSFRVVRLDGSQYTDVAEPPGSDHANLVQLDRSEYTEIR* |
| Ga0126373_104625701 | 3300010048 | Tropical Forest Soil | LVSGLSFRVVQPDGSQHTEVAEPWGSDYTNVVQLDPSEYTEVR* |
| Ga0126373_111822962 | 3300010048 | Tropical Forest Soil | LRVVQLDGSHSTDIAEPGASDYTNVVQLDRSEYTEVR* |
| Ga0126373_111920591 | 3300010048 | Tropical Forest Soil | GFHVVPLDDSQYTGAAEPEGTHHAHVVQLDRSEYTEIR* |
| Ga0126373_125070711 | 3300010048 | Tropical Forest Soil | SFRVVPLDGGQYTDVTQPAGSGYTDVVQLDRSEYTEVG* |
| Ga0126373_129972541 | 3300010048 | Tropical Forest Soil | LVQLDGSQYTDVAEPGGGDYTNVVQLDRSEYTEVR* |
| Ga0074045_109846562 | 3300010341 | Bog Forest Soil | RHLRKLVAGRSFRVVQLDGSQYTDVAEPEGNDYTHVVQLDRSEYTEVR* |
| Ga0126370_102216751 | 3300010358 | Tropical Forest Soil | FRVVRLDGSQYTDVAEPVAEPERSDYPNLVQLDRSEYTEVR* |
| Ga0126376_109882612 | 3300010359 | Tropical Forest Soil | LLSGGSFRVVRLDGSQYTDVAEPEGSDYTNLVQLDRGEYTEVR* |
| Ga0126376_121838801 | 3300010359 | Tropical Forest Soil | RQLRKLLSGDSFRVVPLDVSQYTDLAEPQGTGYTNVVQLERSEYTEVR* |
| Ga0126372_114855501 | 3300010360 | Tropical Forest Soil | NVVQMDPRQFTDDIAEPDGSDYDDVVKLDRSEYTEVR* |
| Ga0126378_100333101 | 3300010361 | Tropical Forest Soil | SFRLVQLDGSQYTDVAEPGGGDYTNVVQLDRSEYTEVR* |
| Ga0126378_115609983 | 3300010361 | Tropical Forest Soil | RKLVSGDSFRIVPMDGCQSPDGSEPGGRDYANVVPLDRSEYTEVR* |
| Ga0126377_120249601 | 3300010362 | Tropical Forest Soil | RVVQLDGSQYTDVAQPGGSDYTNVVQLDRSEYTEVR* |
| Ga0134128_121841881 | 3300010373 | Terrestrial Soil | LRKLLSGDSFRAVRLDGSQYTDVAEPEGSDYTNLVQLDRSEYTEVR* |
| Ga0126381_10004980310 | 3300010376 | Tropical Forest Soil | VPLDDSPYTDVAEPGGSDYANVVQLDRSEYTEVR* |
| Ga0126381_1012377562 | 3300010376 | Tropical Forest Soil | VVQLDGSHSTDIAEPGASDYTNVVQLDRSEYTEVR* |
| Ga0126381_1028492781 | 3300010376 | Tropical Forest Soil | SERSFRVVQVDGSQYTDVEEPEGSDYTNVVQLDHSQYTDVR* |
| Ga0126381_1031656772 | 3300010376 | Tropical Forest Soil | GRSIRVVQLDGSQYTDVAEPGASDYTDVVQLDGS* |
| Ga0126381_1039800581 | 3300010376 | Tropical Forest Soil | SGRSFDVAPLDGSQYTDVAEPQGSDYTNVVRLDRSEYTEVR* |
| Ga0126381_1051173671 | 3300010376 | Tropical Forest Soil | IRVAQPDGSQHTEAAEPWGSDYTNVVQLDPSEYTEVR* |
| Ga0134124_127065142 | 3300010397 | Terrestrial Soil | SRSSFPVVRLDGSQYTDAAEPEGSHYPNLVQLDRSEYTEVR* |
| Ga0126383_118157683 | 3300010398 | Tropical Forest Soil | GSFRVVRLDGSQYTDVAEPEASDYPNLLQLDRSEYTEVR* |
| Ga0126383_125007171 | 3300010398 | Tropical Forest Soil | SGDSFRVVRLDGSQYTDVAEPQSSDYTNLLQLDRSEYTEVR* |
| Ga0126360_10535002 | 3300010854 | Boreal Forest Soil | HLRKLFSGSGIRVVPLDGSRYTDVAAPVAEPQDSGYANVVRLERSEYNEVR* |
| Ga0126360_11052471 | 3300010854 | Boreal Forest Soil | RSFGVVPLDGRQYADAAEPEGGTYADVVQLDRSEYTEVR* |
| Ga0126352_11133571 | 3300010859 | Boreal Forest Soil | VRKLLSGGSFGVFRLDGTQYSDVAEPAGRDVANVLELDPSEYTEVR* |
| Ga0126346_11190292 | 3300010865 | Boreal Forest Soil | SGSGFRLVQPDGSQYTDAAEPDGSDDTNVVHLDRSEYTEIR* |
| Ga0138570_12170811 | 3300011087 | Peatlands Soil | LRKLLSGGSFRVVRLDGGQYTDVAEPEGRDYANVVELDRSEYTEVR* |
| Ga0137392_115470581 | 3300011269 | Vadose Zone Soil | SAGSFRVVRLGGSEYTDAAEPEDSQYANLVQLDRSEYTELH* |
| Ga0137391_110303742 | 3300011270 | Vadose Zone Soil | VRLGGSEYTDAAEPEDSQHANLVQLDRSEYAELH* |
| Ga0153922_10875891 | 3300012181 | Attine Ant Fungus Gardens | RKVLSGGGFGVLRLDGSQYTDVAEPAGSDYANVVELDRSEYTEVR* |
| Ga0137363_114997081 | 3300012202 | Vadose Zone Soil | KMVLGRGFGVVQLDGSQHPDVAEPKGSDYADVVHLDRSEYTEVR* |
| Ga0137380_103481782 | 3300012206 | Vadose Zone Soil | FRVVRLNGSQYTDVAEPAGSDYASLVQLDRSQYTDVR* |
| Ga0137376_100768912 | 3300012208 | Vadose Zone Soil | GSFRVVRLDGSQYTDVAEPEGSDYTNLVQLDRSEYTEVR* |
| Ga0137379_101898064 | 3300012209 | Vadose Zone Soil | RSFRVVQLDGSQYADVAEPQGSDYTDVVRLNRSEYTEVR* |
| Ga0137370_104750182 | 3300012285 | Vadose Zone Soil | VPGGSFGVGQLDGSRYTGVAEPEGSAYTDVVQLDRSQYTEVR* |
| Ga0137366_104258591 | 3300012354 | Vadose Zone Soil | HLRKLLSGGSFRVVQLNGSQYTDVAEPAGSDYTNLVQLDRSEYTEVR* |
| Ga0137395_111420211 | 3300012917 | Vadose Zone Soil | KLLSGRSFRVVHLDGSQSTDVAEPQGSDYANVVQLDRSQYTEVR* |
| Ga0137395_111607322 | 3300012917 | Vadose Zone Soil | LRNLISAGSFRVVRLGGSEYTDSAEPEDSQYANLVQLDRREYTELH* |
| Ga0137407_100664314 | 3300012930 | Vadose Zone Soil | KLLSGGSFRVVRLDGSQYTDVAEPEGSDYTNLVQLDRSDYTEVR* |
| Ga0164301_104434601 | 3300012960 | Soil | FGVVRLDGSQYADVAEPEGRDHASLVQLDRGEYTEVR* |
| Ga0126369_113111011 | 3300012971 | Tropical Forest Soil | KLIAGHAFRVEPLDGSEYPDIAEPGDNDHPSVVRLDRSQYTELR* |
| Ga0181524_103453062 | 3300014155 | Bog | FRAVRLDGSQYTDVAEPEDSDYTNLVQLDHSEYTEVR* |
| Ga0182015_104507653 | 3300014495 | Palsa | FRVVQLDGSQYTDVAEPEGSHHTNLVLDRSEYTEVR* |
| Ga0182024_129347221 | 3300014501 | Permafrost | GRSFGVVRLDGTQDADVAEPAGSDYANVVQLDRSEYTEVR* |
| Ga0157377_104870992 | 3300014745 | Miscanthus Rhizosphere | LLSGGSFRVVRLDGSQYADVAEPEGSDHASLVQLDRREYTEVR* |
| Ga0182030_103042301 | 3300014838 | Bog | VQLDGIQYADVAEAEGDGCADVVQLDRSEYSEVR* |
| Ga0157379_123971451 | 3300014968 | Switchgrass Rhizosphere | FRVIRLDGSQYTDVAEPEGGDYTNLVQLDRSEYTEVR* |
| Ga0137403_110747811 | 3300015264 | Vadose Zone Soil | HLRKLLSGGSFRVVRLDGSQYTDVAEPEGSDYTNLVQLDRSEYTEVR* |
| Ga0182035_119040992 | 3300016341 | Soil | VVQLDGSQYADVAEPPGSDYANVVQLDRSEYTEVR |
| Ga0182039_113807893 | 3300016422 | Soil | LSGHSFRVVQLDSSQYTDVAEPEGSDYTNVLQLDRSQYTEVR |
| Ga0182039_118198201 | 3300016422 | Soil | SFSLVQLDDSQYTDAEEPGGGDYTDVVQLDRSEYTEVR |
| Ga0182038_107735242 | 3300016445 | Soil | SESSFSFMRLDGSQYTDVAEPGSGDYTNVVQLDRSEYTEVR |
| Ga0187812_10203581 | 3300017821 | Freshwater Sediment | RSFRVVQLDSSQYTDVAEPEGSDHTNVVQLDRSEYTEVR |
| Ga0187812_11006292 | 3300017821 | Freshwater Sediment | LASFNVVQLDHRQYTDDIAEPNSSDYTDVVQLDSSEYTEVR |
| Ga0187820_11431472 | 3300017924 | Freshwater Sediment | RKLLSGSGLRIVRLDDSQYTDVAEPERSDYDNVLELDRSEYTEVR |
| Ga0187807_11165641 | 3300017926 | Freshwater Sediment | HLRKLLSRASFNVVQLDRRQYTDDMAEPNGSGYSDVVQLDRSQYTEVR |
| Ga0187806_11869802 | 3300017928 | Freshwater Sediment | RKLLSGRSFRVVQLDGSQYTGVAEPDGSDYTNVVQLDRSQYTEVR |
| Ga0187814_103653291 | 3300017932 | Freshwater Sediment | QHLRKLVSRASFHVVQLDGRQYTDVAEPNGSDYTDVVQLDRSEYTEVR |
| Ga0187808_100920943 | 3300017942 | Freshwater Sediment | FRVVQLDGSQYSGVAEPRGGEHANVVHLDRSEYTEVR |
| Ga0187808_102632693 | 3300017942 | Freshwater Sediment | HLRKLLSGRSFRVVQLDGSQYTGVAEPQGSDYTNVVQLDRSDYTEVR |
| Ga0187819_104890181 | 3300017943 | Freshwater Sediment | LRKLVSGRSLRVVQLDRSQYIDVAEPAGSNYTNVVQLDRSEYTEVR |
| Ga0187879_100236921 | 3300017946 | Peatland | FRAVRLDGSQYTDVAEPEDSDYTNLVQLDHSEYTEVR |
| Ga0187847_102460371 | 3300017948 | Peatland | GSQYTDVAEPVAEPVAEPEGSDYTNVVQLDRSQYTEVR |
| Ga0187779_111085442 | 3300017959 | Tropical Peatland | VVQLDGSQYTDAAEPEGGDYTNVVQLDHSQYTEVR |
| Ga0187779_111217851 | 3300017959 | Tropical Peatland | FRVVQLDGSQYTDVAEPGGSDYTNLVQLDRSQYTDVR |
| Ga0187783_103315642 | 3300017970 | Tropical Peatland | SGRTVRVVQLDGTQYTDVAEPEGSHHASVVRLDRTQYTEVR |
| Ga0187783_106603221 | 3300017970 | Tropical Peatland | TTRVVRLNGSQYTDVAEPEDSHYANLVQLDRSEYTEVR |
| Ga0187777_107024611 | 3300017974 | Tropical Peatland | RVVRLDGSQYTDVAEPAGSGYPNLVQLDPSEYTEVR |
| Ga0187810_105254422 | 3300018012 | Freshwater Sediment | SGDSFRVVRLDGSQYADVVEPQGSDYANVVRLDRSEYTEVR |
| Ga0187855_103083063 | 3300018038 | Peatland | LSGRSFRVVQLDGSQYTGVAEPGGSGYANVVQLDRSQYTEVR |
| Ga0187855_105848592 | 3300018038 | Peatland | GFRVVPLDGSQDADLAESPASDYADVVRLDRSEYTEIR |
| Ga0187862_107365801 | 3300018040 | Peatland | VVQLDGSQYTDVAEPEGSDYTHVVQLDRSQYTEVR |
| Ga0187772_104743322 | 3300018085 | Tropical Peatland | GRSFRVVQLDGSQYTDVAEPDSSDYTNVVQLDRSQYTEVR |
| Ga0187772_112668051 | 3300018085 | Tropical Peatland | LRKMLSSAGGFRVVRLDGSQYADAAEPADGGYTNLVQLDRSEYTELD |
| Ga0193751_12402092 | 3300019888 | Soil | KLVSEHSFRVVQLDGSQYTDVAEPESSDYTDVVQLDRSEYTEVR |
| Ga0210403_112254462 | 3300020580 | Soil | RVVQLDGSQYTDTVAPQDSDYANVVRLDRSEYTEVR |
| Ga0210401_101222814 | 3300020583 | Soil | SLSFPVVQPDDSQYAGVPEPRDSNHTNVVQLDRSDYTEVR |
| Ga0210405_113777472 | 3300021171 | Soil | GRTVRVVQVDGSQYTDVAEPQGSDYTNVLQLDRGEYSEVR |
| Ga0210396_103858131 | 3300021180 | Soil | VRKLVSGLSFPVAQPDGGQYTGVPEQRDSDHVNVVHLDRSEYTEIR |
| Ga0213875_105879961 | 3300021388 | Plant Roots | ERVVQLDGSQYADVADPQGGDCSDVLQLDRSEYTEVR |
| Ga0210385_114638602 | 3300021402 | Soil | FRVVQLDGRQDADVAEPQDGDYANVVRLDRSQYTEVR |
| Ga0210387_112791621 | 3300021405 | Soil | DSFRVVRLDGSQYTDVAEPAGSHYPNLVQLDSSEYTEVR |
| Ga0210386_107443071 | 3300021406 | Soil | GLSFPVAQPDGGQYTGVPEQRDSDHVNVVHLDRSEYTEIR |
| Ga0210391_113079821 | 3300021433 | Soil | VVQPDDTQYTVVPEPRDSDHVNVVQLDRSEYTEIR |
| Ga0210398_106971862 | 3300021477 | Soil | TVRVVQVDGSQYTDVAEPQGSDYTNVLQLDRGEYSEVR |
| Ga0210402_104915963 | 3300021478 | Soil | KLVSGRSFRVVQLDVSQYADIAEPEGSIYTDAVQLDRSEYTEVR |
| Ga0210402_114481191 | 3300021478 | Soil | RVVQLDGSQYADVAEPQGGGYADVVRLDRSQYTEVG |
| Ga0210409_112439912 | 3300021559 | Soil | RLRKLVSGGSFRVVPLDGSQYTDVAEPQGSDYANVVRLDRSEYTEVR |
| Ga0213852_11369272 | 3300021858 | Watersheds | RHLRKLLSGRSFRVVQLDGSQYTDTAAPHDSDRTNVVRLDRIEYTEVR |
| Ga0213852_14576173 | 3300021858 | Watersheds | SFRVVQLDGSQYTDVAEPEGSDYTDVVQLDRSQYTEVR |
| Ga0213853_103123001 | 3300021861 | Watersheds | FRVVQLDSSQYTDVAEREGSDYTNVVQLDRSEYTEVR |
| Ga0242657_10935602 | 3300022722 | Soil | LRIVPLDPSQYTDAAEPPDRGYADAVQLDRSEYTDVR |
| Ga0228598_10590222 | 3300024227 | Rhizosphere | RHSVRVVQLDGSQYTDVAEPKGSDYANVVQLDRSEYTEVR |
| Ga0224564_10326202 | 3300024271 | Soil | LSRHSVRVVQLDGSQYTDVAEPKGSDYANVVQLDRSEYTEVR |
| Ga0208220_11761661 | 3300025627 | Arctic Peat Soil | VVRLDGTQDTDAAEPAGGQYTNLVQLDRSEYTEVR |
| Ga0208589_10064584 | 3300025634 | Arctic Peat Soil | LRKLLSGDSFRVVRLDGSQYTDVAEPEGRHYTNLVQLDRSEYTEVR |
| Ga0207663_110244121 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQLRKLLSGGGFPVVRLDGSQYTDAAEPDGSDYTNLVQLDRSEYTEVR |
| Ga0207700_117544082 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | RKLLSVGSFRVVRLDGSQYTDVAEPEGSDHTNLVQLDRSEYTEVR |
| Ga0207641_102809461 | 3300026088 | Switchgrass Rhizosphere | LSGGSFRVVRLDGSQYVDVTEPEGSDHASLVQLDRREYTEVR |
| Ga0207674_109792921 | 3300026116 | Corn Rhizosphere | VMRLDGSQYTDVAEPRGSDHANVVQLDPSEYTEVR |
| Ga0179587_103372263 | 3300026557 | Vadose Zone Soil | RKLVSGRSFRVVQLDGSQYTDVAEPGGSDYTNVVQLDSNDYAEVR |
| Ga0208731_10122191 | 3300027029 | Forest Soil | DTAIGTTCYGSQYTNVAEPAGSDYTNVVQLDRSEYTEVR |
| Ga0207943_1133241 | 3300027089 | Forest Soil | HLRKMVAGRSIRVVRVERSQYTDVAEPQSSDHNGVLQLDRSEYTDVR |
| Ga0209527_10273422 | 3300027583 | Forest Soil | GVFRLDGTQYSDVAEPARRDVPNVLELDPSEYTEVR |
| Ga0208565_10474893 | 3300027662 | Peatlands Soil | RIVQLDSSQYTDVAEPQGSDYANVVRLDRGEYTEGR |
| Ga0209166_103624962 | 3300027857 | Surface Soil | LRKLMSGGGFRVVRLNGSQFTDVAEPEGSHDTNLVQLDRSEYTELR |
| Ga0209701_105720221 | 3300027862 | Vadose Zone Soil | DSFRVVRLGGSEYTDAAEPEDSQHANLVQLDRSEYTELH |
| Ga0209624_100659943 | 3300027895 | Forest Soil | LRKLLSGGSFRVVRLDGSQYTDVAEPQGSDYTNVVELDRSEYTEVR |
| Ga0209624_103229843 | 3300027895 | Forest Soil | SGSGFGVVRLDGTQYADVEEPKSSDYADVVQLDRSDYTEVR |
| Ga0209624_104591331 | 3300027895 | Forest Soil | RKLLSGGGFHVVRLDDSQYTDVAEPGRRDYANVLELDRSEYTEVR |
| Ga0209415_101787506 | 3300027905 | Peatlands Soil | LRKLVAGRSFRVVQLDGSQYTDVAEPEGSDYTDVVQLDRSEYTEVR |
| Ga0209415_106182281 | 3300027905 | Peatlands Soil | LRKLVAGRSFRVVQLDGSQYTDVAEPQGSDYANVVRLDRGEYTEGR |
| Ga0307307_101355551 | 3300028718 | Soil | KLVSGGSLRVVRLNGSQDTDVAEPAGSDYTNLVQLDRSQYTEVR |
| Ga0302220_100093499 | 3300028742 | Palsa | LRKLLSGRSLRVVQLDGSQYTGVAEPVAEPEGSDYTNVVQLDRSQYTQVR |
| Ga0302228_102913641 | 3300028808 | Palsa | LLSRRGFRVVQLDGIQYADVAEPEGDGRSDVVQLDRSEYSEVR |
| Ga0302235_101929901 | 3300028877 | Palsa | LDGSQYTGVAEPVAEPEGSDYTNVVQLDRSQYTEVR |
| Ga0302235_102895311 | 3300028877 | Palsa | VTGGGLRVGPLDGSPYADVTKPAASDYTDVVQLDRSEYTEVR |
| Ga0308309_119035921 | 3300028906 | Soil | VVQPDHRQHADDSAEPNGSDYADVVQLDRSEYTEVR |
| Ga0311361_107027773 | 3300029911 | Bog | HLRKLLSGRSLRVVQLDGSQYTGVAEPVAEPEGSDYTNVVQLDRSQYTQVR |
| Ga0311343_106477541 | 3300029953 | Bog | GRSFRVVQLDGSQYTDVAEPVAEPVAEPEGSDYTNVVQLDRSQYTEVR |
| Ga0311342_113428101 | 3300029955 | Bog | RVVQLDGSQYTDVAEPVAEPVAEPEGSDYTNVVQLDRSQYTEVR |
| Ga0311339_104970884 | 3300029999 | Palsa | RKLLSGGSFRVVRLNGSQYTDVAEPEGSDYTRLVQLDRGEYTEVR |
| Ga0302177_103286821 | 3300030053 | Palsa | RSLRVVQLDGSQYTGVAEPVAEPEGSDYTNVVQLDRSQYTQVR |
| Ga0302177_106136642 | 3300030053 | Palsa | LSGRSFRVVQLDGSQYTGVAEPVAEPEGSDYTNVVQLDRSQYTEVR |
| Ga0302181_102838911 | 3300030056 | Palsa | RHLRKLLSGGSLRVVRLNSSQYTDTAEPEGSDYPNVVQLDRSEYTALT |
| Ga0310037_101532001 | 3300030494 | Peatlands Soil | RSFRVVQLDGSQYTDVAEPEGSDYTDVVQLDRSEYTEVR |
| Ga0310037_101912672 | 3300030494 | Peatlands Soil | GRSFRVVRLDGSQYTDVAEPEGSDYTDVVRLDRSQYTEVR |
| Ga0302183_100751494 | 3300030509 | Palsa | GHSFRVVPLDGSQYTDVAEPEASDHTNIVQLDRGEYTEVR |
| Ga0311355_108805321 | 3300030580 | Palsa | RGFGVLPLDGSQYIDITEPGDSDYTNVVPLDRSEYTEVR |
| Ga0311356_114513782 | 3300030617 | Palsa | LRKLLSRSSFRVVPLDGSQYTNVAEPAGSEHTDVVQLDPSQYTELH |
| Ga0311354_111051021 | 3300030618 | Palsa | ASFNVVQPDQRQYTDDIAGPNSSDYTDVVQLDHSEYTVGR |
| Ga0311354_112239372 | 3300030618 | Palsa | FLVHLDGSPHVGVAEPQGSDPANVVQLDRRQYTEVR |
| Ga0302317_104869932 | 3300030677 | Palsa | VSGRSFRVVPLDGSQYTDVAEPEGGDYTNVVQLDRSEYTEVR |
| Ga0311345_112383561 | 3300030688 | Bog | SQYTDVAEPVAEPVAEPEGSDYTNVVQLDRSQYTEVR |
| Ga0307482_10639022 | 3300030730 | Hardwood Forest Soil | FPVAQPDGGQYTGVPEQRDSDHVNVVHLDRSEYTEIR |
| Ga0307482_11877152 | 3300030730 | Hardwood Forest Soil | VLRVDGSQYTDVAEPAGSDYANVLELDPSQYTEVR |
| Ga0265460_120942942 | 3300030740 | Soil | GHGFGVVHMDGSQYTDVAEPQGGDYADVVQLDHSDYTEVR |
| Ga0265461_122439821 | 3300030743 | Soil | GDSFRVFRLDGSQYTDVAEPKSSYYAEVVELDPSEYTEVR |
| Ga0302308_100039461 | 3300031027 | Palsa | RSFRVVQLDGSQYTDVAEPEGIDDTGVVQLDRSEYTEVR |
| Ga0170834_1052536692 | 3300031057 | Forest Soil | ARFNVVQPDHRPYTEDIAEPKSSDYTDVVRLDRSEYTEVR |
| Ga0170822_135732022 | 3300031122 | Forest Soil | LLSGGSFRVLRLDGSQYTDVAEPKGSDYANVVELDPSEYTEVR |
| Ga0170824_1028713731 | 3300031231 | Forest Soil | LFRGTFHVMQLNPRQYIDVAEPKGSSDYTDVVQLDRSDYTEVR |
| Ga0170820_152154081 | 3300031446 | Forest Soil | MRHLRKLLSGGSFRVVRLDGSQYTDVAEQEGSDYTNLVQLDRSEYTELR |
| Ga0318538_103172843 | 3300031546 | Soil | FRVVQLDGSQYTDIAEPQGSDYANVVRLDRSEYTEVR |
| Ga0318571_102105731 | 3300031549 | Soil | KLVSESSFGFVQLDDSQYTDVAEPGGGGYTNVVQLDRSEYTEVR |
| Ga0318573_105887621 | 3300031564 | Soil | LRKLVSGRSFRVVQLDGSQYTDVAEPQGSDYTNVVRLDRSAYTEVR |
| Ga0310915_106174862 | 3300031573 | Soil | ESSFSFVRLDGSQYTDVAEPGSGDYTNVVQLDRSEYTEVR |
| Ga0318555_108009461 | 3300031640 | Soil | RSFRVVQLDGSQYTDVAEPGGSDYTNVVQLDRSEYTEVR |
| Ga0318542_106927572 | 3300031668 | Soil | LVQLDDSQYTDAEEPGGGDYTDVVQLDRSEYTEVR |
| Ga0318561_101357131 | 3300031679 | Soil | SGLRHLRKLAAGPSFPLVALDDSQYTDAEEPGGGYTNVVPLDRSEYTEVR |
| Ga0318561_107717141 | 3300031679 | Soil | SGSSFRVVQLDGSQYTDVAEPAGSDYAHVVQLDRSEYTEVR |
| Ga0318574_103504272 | 3300031680 | Soil | LVSGGSFRVVRLDGSQYTDVAEPAGGDYTSVVQLDRSEYTEVR |
| Ga0318574_103898131 | 3300031680 | Soil | RKLVSGHSFRVVQLDGSQYTDVAQPQDSDYTNVVRLDRSEYTEVR |
| Ga0318572_103488651 | 3300031681 | Soil | LRKLVSESSFSFVRLDGSQDTDVAAPGSGDYTNVVQLDRSEYTEVR |
| Ga0318560_102874381 | 3300031682 | Soil | RHLRKLVSESSFSFVRLDGSQDTDVEAPGSGDYTNVVQLDRSEYTEVR |
| Ga0318560_106975352 | 3300031682 | Soil | LSASSFRVVQLDGSQYTDVAEPAGSDYTNVLQLDRSEYSEVR |
| Ga0318560_107919841 | 3300031682 | Soil | DNFRVVRLDGSQYTDVAEPEGSDHTNLLQLDRSEYTEVR |
| Ga0310686_1022318702 | 3300031708 | Soil | VSGRSFHVVQLDRPQYTDAAEPEGSDYANVMQLDRSEYTEVR |
| Ga0307474_105653771 | 3300031718 | Hardwood Forest Soil | PVAQPDGGQYTGVPEQRDSDHVNVVHLDRSEYTEIR |
| Ga0306917_112453702 | 3300031719 | Soil | SRGSFGVAQLDGSQDVGLAEPQGSEYANVVRLDRSEYTEVR |
| Ga0318501_104646342 | 3300031736 | Soil | SFRVVPLDGSQYADVAEPGGSEYANVVSLDRSEYTEVR |
| Ga0306918_109645891 | 3300031744 | Soil | ASGLRHLRKLAAGPSFPLVALDDSQYTDAEEPGGGYTNVVPLDRSEYTEVR |
| Ga0318537_102541052 | 3300031763 | Soil | SGDSFRIVQLDGSQYTNVAEPAGSDYANVIQLDRSEYTEVR |
| Ga0318526_103598891 | 3300031769 | Soil | RTLVSGGSFRVVQLDGSQYTDIAEPGGGDYTNVVQLDRSEYTEVR |
| Ga0318546_111430992 | 3300031771 | Soil | RKQFSGPGFRVVQLDGSQYTDVAEPESSNYTNVVQLDRSEYTEVR |
| Ga0318547_102400592 | 3300031781 | Soil | LSRGSFGVAQLDGSQDVGLAEPQGSEYANVVRLDRSEYTEVR |
| Ga0318547_102756352 | 3300031781 | Soil | SSFSLVQLDDSQYTHVEEPGGGDYTNVVQLDRSEYTEVR |
| Ga0318547_103367431 | 3300031781 | Soil | LSGDAFRVVRLDSSQYTDVAEPEGRDYPNLVQLDRSQYTEVR |
| Ga0318529_100743181 | 3300031792 | Soil | FRIVQLDGSQYTNVAEPAGSDYANVIQLDRSEYTEVR |
| Ga0318548_105197451 | 3300031793 | Soil | RVVQLDGSQYTDIAEPQGSDYANVVQLDRSEYTEIR |
| Ga0318550_101821241 | 3300031797 | Soil | LRKLAAGPSFPLVALDDSQYTDAEEPGGGYTNVVPLDRSEYTEVR |
| Ga0318523_103959961 | 3300031798 | Soil | SETSFSFVRLDGSQDTDVAAPGSGDYTNVVQLDRSEYTEVR |
| Ga0318523_104742901 | 3300031798 | Soil | LVSGTSFSLVQLDDSQYTDAEEPGGGDYTDVVQLDRSEYTEVR |
| Ga0318523_106140701 | 3300031798 | Soil | LRKLVSESSFGLVQLDGSQYTDVTEPGGGGYTNVVQLDRSEYTEVR |
| Ga0318564_100050581 | 3300031831 | Soil | VSESSFRLVPLDGSQYTDVEEPGAGDYTNVVQLDRSEYTEVH |
| Ga0310917_104350351 | 3300031833 | Soil | SFPLVRLDGSQPTDAEEPGGGDYTNVVQLDRSEYTEVR |
| Ga0310917_104726473 | 3300031833 | Soil | RVVQLDDSQYSDVAEPEGSDYTNVLQLDRSQYTEVR |
| Ga0318517_101771021 | 3300031835 | Soil | LVSESSFSFVRLDGSQDTDVAAPGSGDYTNVVQLDRSEYTEVR |
| Ga0318495_100243264 | 3300031860 | Soil | VVPLDDGQYTDVAEPGGSDYTNVVQLDRSEYTEVR |
| Ga0306919_102715032 | 3300031879 | Soil | GVAQLDGSQDVGLAEPQGSEYANVVRLDRSEYTEVR |
| Ga0306925_108953611 | 3300031890 | Soil | DSIRIVRLDPSQYTDTAEPQASDYPNLVMLDRSEYTEVR |
| Ga0306925_121791811 | 3300031890 | Soil | VVQLDGSQYTDVAEPAGSDYAHVVQLDRSEYTEVR |
| Ga0318536_101016363 | 3300031893 | Soil | HLRKLVSESSIRLVPLDGSQYTDVEEPGAGDYTNVVQLDRSEYTEVH |
| Ga0318536_101233533 | 3300031893 | Soil | VSGRSFRLVQLDGSQYTDVAEPGGSDYTNVVQLDRSEYTEVR |
| Ga0318536_105573611 | 3300031893 | Soil | SFPLVRLGDSLYTDAEEPGGGGYTNVVQLDRSEYTEVR |
| Ga0318522_101073011 | 3300031894 | Soil | HLRKLVSESSFSFVRLDGSQDTDVEAPGSGDYTNVVQLDRSEYTEVR |
| Ga0318551_101294453 | 3300031896 | Soil | KLLSGDAFRVVRLDSSQYTDVAEPEGRDYPNLVQLDRSQYTEVR |
| Ga0318551_101385772 | 3300031896 | Soil | RVVQLDGSQYTDVAEPQGSDHANVVQLDRSEYTEIR |
| Ga0306923_123280751 | 3300031910 | Soil | FDVVPLDGNRYTDIAEPQGSDYANVVLLDRSEYTEVH |
| Ga0310912_104976391 | 3300031941 | Soil | SSFSFVRLDGNQYTDVAEPGSGDYTNVVQLDRSEYTEVR |
| Ga0310916_104115802 | 3300031942 | Soil | HLRKLAAGPSFPLVALDDSQYTDAEEPGGGYTNVVPLDRSEYTEVR |
| Ga0310910_108746651 | 3300031946 | Soil | LVQLDGSQYTDVTEPGGGGYTNVVQLDRSEYTEVR |
| Ga0310909_112664301 | 3300031947 | Soil | RVVQLDGSQYADVAEPPGSDYANVVQLDRSEYTEVR |
| Ga0306926_125287511 | 3300031954 | Soil | FQVVPLDGSQYSDVAEPQGSDYTNVVRLDRSEYTEVR |
| Ga0307479_106142132 | 3300031962 | Hardwood Forest Soil | GFGLVQPDGGQYTDAAEPGGSDYTNVVHLDRSEYTEIR |
| Ga0318531_104264062 | 3300031981 | Soil | RKLLSGDSIRIVRLDPSQYTDTAEPQASDYPNLVMLDRSEYTEVR |
| Ga0306922_100663521 | 3300032001 | Soil | LRKLLSGGGFPVVRLDSSQYSDVAQPPGSGHTNLLQLDRSEYTEIR |
| Ga0318562_100729553 | 3300032008 | Soil | HLRKLVSGRSFQVVPLDGSQYSDVAEPQSSDYPNVLRLDRSEYTEVR |
| Ga0318563_104531041 | 3300032009 | Soil | VVQLDGSQYTDVAEPEGSDYTDVVQLDRSEYTEVR |
| Ga0318569_100317974 | 3300032010 | Soil | GDNFRVVPLDDGQYTDVAEPGGSDYTNVVQLDRSEYTEVR |
| Ga0318569_103285391 | 3300032010 | Soil | GSLRVVQLDSSQYADVAEPPGSDYANVVRLDRSEYTEVR |
| Ga0318559_104034981 | 3300032039 | Soil | HLRKVVSGRSFRVVQLDGSQYADVAEPQGSDSTNVVRLDRSQYTEVR |
| Ga0318558_103101042 | 3300032044 | Soil | SGDNFRVVPLDDGQYTDVAEPGGSDYTNVVQLDRSEYTEVR |
| Ga0318532_100116365 | 3300032051 | Soil | RKLVSGSTFSLVQLDDSQYTHVEEPGGGDYTNVVQLDRSEYTEVR |
| Ga0318570_102942163 | 3300032054 | Soil | GLVQLDGSQYTDAAEPEGGDYTNVVQLDRSEYTEVR |
| Ga0318575_101737372 | 3300032055 | Soil | SGPSFQVVPLDGSQYSDVAEPQGSDYTNVVRLDRSEYTEVR |
| Ga0318533_104257162 | 3300032059 | Soil | IVQLDGSQYTNVAEPAGSDYANVIQLDRSEYTEVR |
| Ga0318533_104488791 | 3300032059 | Soil | VSESSFSFVRLDGSQDTDVEAPGSGDYTNVVQLDRSEYTEVR |
| Ga0318513_101253941 | 3300032065 | Soil | FRVVPLDDGQYTDVAEPGGSDYTNVVQLDRSEYTEVR |
| Ga0318513_101429042 | 3300032065 | Soil | FRVVQLDGSQYTDIAEPQGSDYANVVQLDRSEYTEIR |
| Ga0318524_100293143 | 3300032067 | Soil | VSGSSFRVVPLDGSQYADVAEPGGSEYANVVSLDRSEYTEVR |
| Ga0318524_103297701 | 3300032067 | Soil | IRLVPLDGSQYTDVEEPGAGDYTNVVQLDRSEYTEVH |
| Ga0318524_107952122 | 3300032067 | Soil | AIRHLRKLVSGSSFSLVQLDDSQYTHVEEPGGGDYTNVVQLDRSEYTEVR |
| Ga0318525_102048281 | 3300032089 | Soil | FVRLDGSQDTDVAAPGSGDYTNVVQLDRSEYTEVR |
| Ga0307471_1008173911 | 3300032180 | Hardwood Forest Soil | SFRVVRLDGSQYTDVAEPEGSDYTNLVQLDRSEYTEVR |
| Ga0306920_1002932701 | 3300032261 | Soil | RSFRVVPLDGSLYTDIAEPQGSDHANVVRLDRSQYTDVR |
| Ga0306920_1009235511 | 3300032261 | Soil | FRVVQLDGSQYTDVAEPQGSDYANVVRLDRSEYTEVR |
| Ga0335085_103369754 | 3300032770 | Soil | IVRLDGSQYTDVAEPQGSDYTNLVQLDRSEYTELR |
| Ga0335081_1005114410 | 3300032892 | Soil | RVVPLDGGQYTEVAEPQGSEYTNVVRLDRSEYTEVR |
| Ga0335075_102218071 | 3300032896 | Soil | KLLSPGNFRVVRLDGSQYTDVAEPEGSDCTNFVQLDRGDYTDVR |
| Ga0335073_102614931 | 3300033134 | Soil | GGGFRVVRLGGSEYSDVAEPAGSDATNLVQLDRSEYTDVR |
| Ga0335073_121294271 | 3300033134 | Soil | VVQLDRTQYSDVAEPKSNDYTDVLQLDRSEYTEVR |
| Ga0310914_107651131 | 3300033289 | Soil | SFRVVQLDDSRYMDVAEPQGSDYTNVVQLDRSQYTEVH |
| Ga0310914_110490221 | 3300033289 | Soil | GHSFRVVQLDDSQYSDVAEPEGSDYTNVLQLDRSQYTEVR |
| ⦗Top⦘ |