NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F013371

Metagenome / Metatranscriptome Family F013371

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F013371
Family Type Metagenome / Metatranscriptome
Number of Sequences 272
Average Sequence Length 42 residues
Representative Sequence RDVDSGLASGQVLGTPTLFIDGVVHRGGYDPPALLAALAP
Number of Associated Samples 223
Number of Associated Scaffolds 272

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 6.99 %
% of genes near scaffold ends (potentially truncated) 87.50 %
% of genes from short scaffolds (< 2000 bps) 88.60 %
Associated GOLD sequencing projects 213
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.485 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(15.441 % of family members)
Environment Ontology (ENVO) Unclassified
(25.735 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.647 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.06%    β-sheet: 8.82%    Coil/Unstructured: 69.12%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 272 Family Scaffolds
PF02589LUD_dom 17.65
PF02148zf-UBP 6.62
PF00571CBS 6.25
PF07992Pyr_redox_2 3.68
PF04264YceI 2.94
PF00296Bac_luciferase 2.94
PF00730HhH-GPD 1.84
PF01734Patatin 1.84
PF00196GerE 1.47
PF13462Thioredoxin_4 1.10
PF06772LtrA 1.10
PF08240ADH_N 1.10
PF04298Zn_peptidase_2 1.10
PF04075F420H2_quin_red 1.10
PF06055ExoD 1.10
PF07859Abhydrolase_3 0.74
PF13365Trypsin_2 0.74
PF01323DSBA 0.74
PF00135COesterase 0.74
PF01243Putative_PNPOx 0.74
PF12680SnoaL_2 0.74
PF00106adh_short 0.74
PF00072Response_reg 0.74
PF00248Aldo_ket_red 0.37
PF02683DsbD 0.37
PF03706LPG_synthase_TM 0.37
PF00990GGDEF 0.37
PF13520AA_permease_2 0.37
PF00999Na_H_Exchanger 0.37
PF00753Lactamase_B 0.37
PF06197DUF998 0.37
PF12850Metallophos_2 0.37
PF07883Cupin_2 0.37
PF12697Abhydrolase_6 0.37
PF00441Acyl-CoA_dh_1 0.37
PF14339DUF4394 0.37
PF00171Aldedh 0.37
PF01047MarR 0.37
PF03109ABC1 0.37
PF08530PepX_C 0.37
PF00326Peptidase_S9 0.37
PF13434Lys_Orn_oxgnase 0.37
PF03807F420_oxidored 0.37
PF04545Sigma70_r4 0.37
PF01814Hemerythrin 0.37
PF00300His_Phos_1 0.37
PF00027cNMP_binding 0.37
PF03401TctC 0.37
PF13191AAA_16 0.37
PF10590PNP_phzG_C 0.37
PF10415FumaraseC_C 0.37
PF13561adh_short_C2 0.37
PF06736TMEM175 0.37
PF12802MarR_2 0.37
PF08281Sigma70_r4_2 0.37
PF13556HTH_30 0.37
PF00108Thiolase_N 0.37
PF13602ADH_zinc_N_2 0.37
PF00563EAL 0.37
PF04454Linocin_M18 0.37
PF00270DEAD 0.37
PF13302Acetyltransf_3 0.37
PF01494FAD_binding_3 0.37
PF00970FAD_binding_6 0.37
PF01406tRNA-synt_1e 0.37
PF13280WYL 0.37
PF00271Helicase_C 0.37
PF028262-Hacid_dh_C 0.37
PF00133tRNA-synt_1 0.37

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 272 Family Scaffolds
COG5207Uncharacterized Zn-finger protein, UBP-typeGeneral function prediction only [R] 6.62
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 2.94
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 2.94
COG22313-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamilyReplication, recombination and repair [L] 1.84
COG01223-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 1.84
COG0177Endonuclease IIIReplication, recombination and repair [L] 1.84
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 1.84
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 1.84
COG1194Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairsReplication, recombination and repair [L] 1.84
COG1059Thermostable 8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 1.84
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 1.84
COG2738Zn-dependent membrane protease YugPPosttranslational modification, protein turnover, chaperones [O] 1.10
COG3932Exopolysaccharide synthesis protein ExoDCell wall/membrane/envelope biogenesis [M] 1.10
COG4292Low temperature requirement protein LtrA (function unknown)Function unknown [S] 1.10
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 0.74
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 0.74
COG2272Carboxylesterase type BLipid transport and metabolism [I] 0.74
COG0143Methionyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.74
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.37
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 0.37
COG4943Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domainsSignal transduction mechanisms [T] 0.37
COG2936Predicted acyl esteraseGeneral function prediction only [R] 0.37
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 0.37
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 0.37
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.37
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.37
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 0.37
COG3371Uncharacterized membrane proteinFunction unknown [S] 0.37
COG3434c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domainsSignal transduction mechanisms [T] 0.37
COG3548Uncharacterized membrane proteinFunction unknown [S] 0.37
COG2200EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)Signal transduction mechanisms [T] 0.37
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.37
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.37
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.37
COG0661Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB familySignal transduction mechanisms [T] 0.37
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.37
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.37
COG0525Valyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.37
COG0495Leucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.37
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 0.37
COG0392Predicted membrane flippase AglD2/YbhN, UPF0104 familyCell wall/membrane/envelope biogenesis [M] 0.37
COG0215Cysteinyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.37
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 0.37
COG0060Isoleucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.37
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 0.37
COG0018Arginyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.37


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.49 %
UnclassifiedrootN/A5.51 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002568|C688J35102_118363795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia552Open in IMG/M
3300002908|JGI25382J43887_10246423All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300004092|Ga0062389_103260849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia608Open in IMG/M
3300004463|Ga0063356_106390222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia505Open in IMG/M
3300004479|Ga0062595_100573057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia871Open in IMG/M
3300004479|Ga0062595_101093756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria696Open in IMG/M
3300005164|Ga0066815_10041217All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300005329|Ga0070683_101407400All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300005341|Ga0070691_10655144All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300005435|Ga0070714_100040614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3921Open in IMG/M
3300005435|Ga0070714_100323645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1442Open in IMG/M
3300005435|Ga0070714_100737937All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300005439|Ga0070711_101399817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria608Open in IMG/M
3300005450|Ga0066682_10967243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300005456|Ga0070678_100148453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1885Open in IMG/M
3300005456|Ga0070678_101203576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia702Open in IMG/M
3300005457|Ga0070662_100606929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia921Open in IMG/M
3300005467|Ga0070706_102160974All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300005538|Ga0070731_10924271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia578Open in IMG/M
3300005556|Ga0066707_10312642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1028Open in IMG/M
3300005560|Ga0066670_10262188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1048Open in IMG/M
3300005563|Ga0068855_101807106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria621Open in IMG/M
3300005764|Ga0066903_100898277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1602Open in IMG/M
3300005842|Ga0068858_100161675All Organisms → cellular organisms → Bacteria2108Open in IMG/M
3300005843|Ga0068860_102252582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium565Open in IMG/M
3300005952|Ga0080026_10028392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1397Open in IMG/M
3300005994|Ga0066789_10017113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3208Open in IMG/M
3300005995|Ga0066790_10001702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia9388Open in IMG/M
3300006028|Ga0070717_11910776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae535Open in IMG/M
3300006046|Ga0066652_100946050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria820Open in IMG/M
3300006047|Ga0075024_100723821All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300006059|Ga0075017_101603794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia514Open in IMG/M
3300006163|Ga0070715_10322048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia835Open in IMG/M
3300006175|Ga0070712_100889479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia767Open in IMG/M
3300006176|Ga0070765_100388463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1301Open in IMG/M
3300006176|Ga0070765_100667377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria982Open in IMG/M
3300006574|Ga0074056_11673160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria585Open in IMG/M
3300006804|Ga0079221_11645156All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300006806|Ga0079220_10373766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia918Open in IMG/M
3300006806|Ga0079220_10558927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia801Open in IMG/M
3300006845|Ga0075421_100337898All Organisms → cellular organisms → Bacteria1822Open in IMG/M
3300006847|Ga0075431_100739410All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300006852|Ga0075433_10834713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia805Open in IMG/M
3300006854|Ga0075425_102145427All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300006854|Ga0075425_102977268All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300006893|Ga0073928_11123190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia532Open in IMG/M
3300006904|Ga0075424_100046006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4551Open in IMG/M
3300006914|Ga0075436_100457931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales929Open in IMG/M
3300006954|Ga0079219_11641776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia592Open in IMG/M
3300006954|Ga0079219_12060380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia545Open in IMG/M
3300007076|Ga0075435_101460503All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300007788|Ga0099795_10325291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria682Open in IMG/M
3300009038|Ga0099829_10294049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1331Open in IMG/M
3300009090|Ga0099827_10548889All Organisms → cellular organisms → Bacteria995Open in IMG/M
3300009137|Ga0066709_100797494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1368Open in IMG/M
3300009137|Ga0066709_102021947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi798Open in IMG/M
3300009148|Ga0105243_11518260All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300009157|Ga0105092_10411213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria770Open in IMG/M
3300009698|Ga0116216_10013903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5069Open in IMG/M
3300009698|Ga0116216_10622465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium650Open in IMG/M
3300009792|Ga0126374_10766183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii733Open in IMG/M
3300009810|Ga0105088_1020109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1041Open in IMG/M
3300009839|Ga0116223_10681293All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300009840|Ga0126313_10917549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria715Open in IMG/M
3300010040|Ga0126308_11219416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium533Open in IMG/M
3300010041|Ga0126312_11120503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria578Open in IMG/M
3300010042|Ga0126314_10307577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1132Open in IMG/M
3300010042|Ga0126314_10982426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria626Open in IMG/M
3300010045|Ga0126311_11906858Not Available505Open in IMG/M
3300010159|Ga0099796_10170959Not Available867Open in IMG/M
3300010329|Ga0134111_10095766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1134Open in IMG/M
3300010358|Ga0126370_10059404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia2474Open in IMG/M
3300010366|Ga0126379_10338684All Organisms → cellular organisms → Bacteria → Terrabacteria group1529Open in IMG/M
3300010366|Ga0126379_10536481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1247Open in IMG/M
3300010366|Ga0126379_11257443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces846Open in IMG/M
3300010366|Ga0126379_11842149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii709Open in IMG/M
3300010371|Ga0134125_10844660All Organisms → cellular organisms → Bacteria1007Open in IMG/M
3300010371|Ga0134125_11089362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria875Open in IMG/M
3300010371|Ga0134125_11411896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium759Open in IMG/M
3300010375|Ga0105239_10597290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1259Open in IMG/M
3300010396|Ga0134126_11455648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria756Open in IMG/M
3300010401|Ga0134121_13160953Not Available508Open in IMG/M
3300010403|Ga0134123_13328713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia519Open in IMG/M
3300010876|Ga0126361_10286287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria967Open in IMG/M
3300011107|Ga0151490_1358118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium587Open in IMG/M
3300011119|Ga0105246_12071776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria551Open in IMG/M
3300011270|Ga0137391_10129417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2194Open in IMG/M
3300012096|Ga0137389_11753491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300012201|Ga0137365_10073414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2580Open in IMG/M
3300012202|Ga0137363_11459705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium575Open in IMG/M
3300012203|Ga0137399_10558844All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300012203|Ga0137399_11656585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300012204|Ga0137374_10709410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria754Open in IMG/M
3300012207|Ga0137381_10713371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria871Open in IMG/M
3300012207|Ga0137381_11486375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium569Open in IMG/M
3300012209|Ga0137379_10692259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium925Open in IMG/M
3300012209|Ga0137379_11014412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii735Open in IMG/M
3300012209|Ga0137379_11736868Not Available520Open in IMG/M
3300012210|Ga0137378_10159953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp.2089Open in IMG/M
3300012211|Ga0137377_10674702All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300012211|Ga0137377_11026482All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300012212|Ga0150985_108895265All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria808Open in IMG/M
3300012212|Ga0150985_108919535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria508Open in IMG/M
3300012349|Ga0137387_10346441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1076Open in IMG/M
3300012350|Ga0137372_10010872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8737Open in IMG/M
3300012350|Ga0137372_10247151All Organisms → cellular organisms → Bacteria1405Open in IMG/M
3300012350|Ga0137372_10517490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia885Open in IMG/M
3300012354|Ga0137366_10596890Not Available792Open in IMG/M
3300012359|Ga0137385_11611702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia513Open in IMG/M
3300012360|Ga0137375_10630810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium887Open in IMG/M
3300012363|Ga0137390_10379863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1393Open in IMG/M
3300012363|Ga0137390_10527549All Organisms → cellular organisms → Bacteria1153Open in IMG/M
3300012685|Ga0137397_10500576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria905Open in IMG/M
3300012911|Ga0157301_10080571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria915Open in IMG/M
3300012911|Ga0157301_10215928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria655Open in IMG/M
3300012917|Ga0137395_11091949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii566Open in IMG/M
3300012918|Ga0137396_10494872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria906Open in IMG/M
3300012923|Ga0137359_11392012All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300012929|Ga0137404_12315763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium503Open in IMG/M
3300012951|Ga0164300_10108457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1233Open in IMG/M
3300012951|Ga0164300_10350682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria792Open in IMG/M
3300012951|Ga0164300_10589160Not Available654Open in IMG/M
3300012951|Ga0164300_10955350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium547Open in IMG/M
3300012951|Ga0164300_11036612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria531Open in IMG/M
3300012971|Ga0126369_10861623All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria990Open in IMG/M
3300012975|Ga0134110_10518433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300012985|Ga0164308_10349449All Organisms → cellular organisms → Bacteria → Terrabacteria group1193Open in IMG/M
3300012985|Ga0164308_11273819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium666Open in IMG/M
3300012985|Ga0164308_11600718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria601Open in IMG/M
3300012985|Ga0164308_12033414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria536Open in IMG/M
3300012986|Ga0164304_11039008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria651Open in IMG/M
3300012989|Ga0164305_10624386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria869Open in IMG/M
3300012989|Ga0164305_11194528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria659Open in IMG/M
3300013096|Ga0157307_1107234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria602Open in IMG/M
3300013297|Ga0157378_10410690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei1336Open in IMG/M
3300014501|Ga0182024_10236893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2460Open in IMG/M
3300014501|Ga0182024_10570014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1424Open in IMG/M
3300014745|Ga0157377_10404027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea marina931Open in IMG/M
3300015241|Ga0137418_11207643All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300015374|Ga0132255_103599378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium659Open in IMG/M
3300016294|Ga0182041_10851158All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300016319|Ga0182033_10017647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4254Open in IMG/M
3300017823|Ga0187818_10508508All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300017955|Ga0187817_10053380All Organisms → cellular organisms → Bacteria2494Open in IMG/M
3300017965|Ga0190266_10536480All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300017965|Ga0190266_10689198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium636Open in IMG/M
3300017994|Ga0187822_10229863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. WAC01280630Open in IMG/M
3300018034|Ga0187863_10005011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria9332Open in IMG/M
3300018071|Ga0184618_10070631All Organisms → cellular organisms → Bacteria1316Open in IMG/M
3300018076|Ga0184609_10352742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium686Open in IMG/M
3300018081|Ga0184625_10404898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria703Open in IMG/M
3300018422|Ga0190265_10962002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria976Open in IMG/M
3300018422|Ga0190265_12575839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria606Open in IMG/M
3300018429|Ga0190272_11720732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria650Open in IMG/M
3300018432|Ga0190275_12234691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria625Open in IMG/M
3300018466|Ga0190268_10110918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1303Open in IMG/M
3300018469|Ga0190270_12444586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium584Open in IMG/M
3300018481|Ga0190271_13026703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria564Open in IMG/M
3300018920|Ga0190273_11703895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria569Open in IMG/M
3300019259|Ga0184646_1087970Not Available581Open in IMG/M
3300019356|Ga0173481_10422874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria658Open in IMG/M
3300019377|Ga0190264_11519537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria583Open in IMG/M
3300019884|Ga0193741_1121193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria662Open in IMG/M
3300019890|Ga0193728_1198105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium845Open in IMG/M
3300020582|Ga0210395_10087016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2305Open in IMG/M
3300020582|Ga0210395_10542071All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300021073|Ga0210378_10400568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria509Open in IMG/M
3300021178|Ga0210408_10595990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium875Open in IMG/M
3300021358|Ga0213873_10277034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria537Open in IMG/M
3300021388|Ga0213875_10358200All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300021406|Ga0210386_10677878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia889Open in IMG/M
3300021407|Ga0210383_11027074Not Available698Open in IMG/M
3300021407|Ga0210383_11124526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium662Open in IMG/M
3300021407|Ga0210383_11457025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium568Open in IMG/M
3300021420|Ga0210394_11620146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium544Open in IMG/M
3300021433|Ga0210391_10983538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria657Open in IMG/M
3300021474|Ga0210390_11090932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia649Open in IMG/M
3300021559|Ga0210409_11223163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria627Open in IMG/M
3300022714|Ga0242671_1023698All Organisms → cellular organisms → Bacteria877Open in IMG/M
3300024331|Ga0247668_1123018All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300024347|Ga0179591_1050695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3354Open in IMG/M
3300025588|Ga0208586_1123797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium548Open in IMG/M
3300025604|Ga0207930_1018784All Organisms → cellular organisms → Bacteria1966Open in IMG/M
3300025900|Ga0207710_10239021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium906Open in IMG/M
3300025905|Ga0207685_10124954Not Available1135Open in IMG/M
3300025910|Ga0207684_11709045All Organisms → cellular organisms → Bacteria → Terrabacteria group507Open in IMG/M
3300025915|Ga0207693_10331944All Organisms → cellular organisms → Bacteria1190Open in IMG/M
3300025915|Ga0207693_11019414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria631Open in IMG/M
3300025922|Ga0207646_10158218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2044Open in IMG/M
3300025928|Ga0207700_10188198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1733Open in IMG/M
3300025928|Ga0207700_11655872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium565Open in IMG/M
3300025934|Ga0207686_11425355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria570Open in IMG/M
3300025934|Ga0207686_11524953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. ov407551Open in IMG/M
3300025935|Ga0207709_10253084All Organisms → cellular organisms → Bacteria1288Open in IMG/M
3300025939|Ga0207665_11008615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium662Open in IMG/M
3300025942|Ga0207689_11104902Not Available668Open in IMG/M
3300025981|Ga0207640_10216579All Organisms → cellular organisms → Bacteria1463Open in IMG/M
3300025981|Ga0207640_10378621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1146Open in IMG/M
3300026275|Ga0209901_1096710All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300026490|Ga0257153_1048534All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300026551|Ga0209648_10497290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii711Open in IMG/M
3300027056|Ga0209879_1062704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium595Open in IMG/M
3300027158|Ga0208725_1071648All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria504Open in IMG/M
3300027401|Ga0208637_1016894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria782Open in IMG/M
3300027681|Ga0208991_1024948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1806Open in IMG/M
3300027765|Ga0209073_10237693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii704Open in IMG/M
3300027775|Ga0209177_10188577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria726Open in IMG/M
3300027795|Ga0209139_10095129All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300027862|Ga0209701_10220224Not Available1123Open in IMG/M
3300027873|Ga0209814_10025352All Organisms → cellular organisms → Bacteria2425Open in IMG/M
3300027875|Ga0209283_10447552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria837Open in IMG/M
3300027889|Ga0209380_10305418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium934Open in IMG/M
3300027903|Ga0209488_10352262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1094Open in IMG/M
3300027903|Ga0209488_11008817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria575Open in IMG/M
3300027986|Ga0209168_10593589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria530Open in IMG/M
3300028047|Ga0209526_10670436All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300028379|Ga0268266_10499864All Organisms → cellular organisms → Bacteria1161Open in IMG/M
3300028380|Ga0268265_12381282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea marina536Open in IMG/M
3300028381|Ga0268264_12142052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea marina567Open in IMG/M
3300028592|Ga0247822_10366389All Organisms → cellular organisms → Bacteria1116Open in IMG/M
3300028710|Ga0307322_10211891All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria530Open in IMG/M
3300028717|Ga0307298_10179878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria620Open in IMG/M
3300028744|Ga0307318_10062821All Organisms → cellular organisms → Bacteria1236Open in IMG/M
3300028755|Ga0307316_10033805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1679Open in IMG/M
3300028790|Ga0307283_10185943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora chokoriensis589Open in IMG/M
3300028811|Ga0307292_10284542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria691Open in IMG/M
3300028819|Ga0307296_10239266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria987Open in IMG/M
3300028828|Ga0307312_10037597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales2848Open in IMG/M
3300028828|Ga0307312_10768909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium638Open in IMG/M
3300028875|Ga0307289_10275770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria692Open in IMG/M
3300028881|Ga0307277_10225770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria824Open in IMG/M
3300028906|Ga0308309_10392017Not Available1190Open in IMG/M
3300028906|Ga0308309_11893250Not Available503Open in IMG/M
3300029701|Ga0222748_1013834All Organisms → cellular organisms → Bacteria1092Open in IMG/M
3300030494|Ga0310037_10019125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3310Open in IMG/M
3300031114|Ga0308187_10477251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria508Open in IMG/M
3300031170|Ga0307498_10174936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium731Open in IMG/M
3300031543|Ga0318516_10282243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → environmental samples → uncultured Chloroflexota bacterium960Open in IMG/M
3300031543|Ga0318516_10381810All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300031545|Ga0318541_10317422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria869Open in IMG/M
3300031549|Ga0318571_10367231All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300031679|Ga0318561_10036230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2411Open in IMG/M
3300031751|Ga0318494_10042422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2378Open in IMG/M
3300031753|Ga0307477_10299987All Organisms → cellular organisms → Bacteria1109Open in IMG/M
3300031754|Ga0307475_11185806All Organisms → cellular organisms → Bacteria → Terrabacteria group595Open in IMG/M
3300031764|Ga0318535_10341788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia669Open in IMG/M
3300031771|Ga0318546_10741766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium691Open in IMG/M
3300031778|Ga0318498_10416511All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300031798|Ga0318523_10181348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1051Open in IMG/M
3300031799|Ga0318565_10484565All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300031823|Ga0307478_10767947Not Available807Open in IMG/M
3300031823|Ga0307478_11628424All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300031893|Ga0318536_10395968All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300031901|Ga0307406_11191449All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300031908|Ga0310900_10425712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1014Open in IMG/M
3300031912|Ga0306921_10171345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2542Open in IMG/M
3300031959|Ga0318530_10226780Not Available768Open in IMG/M
3300032000|Ga0310903_10641797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium569Open in IMG/M
3300032025|Ga0318507_10555069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium500Open in IMG/M
3300032039|Ga0318559_10028895All Organisms → cellular organisms → Bacteria2198Open in IMG/M
3300032041|Ga0318549_10526898All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300032064|Ga0318510_10019475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2141Open in IMG/M
3300032067|Ga0318524_10275568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria868Open in IMG/M
3300032205|Ga0307472_101955132All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300032261|Ga0306920_100260921All Organisms → cellular organisms → Bacteria2584Open in IMG/M
3300032892|Ga0335081_10083754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4813Open in IMG/M
3300032895|Ga0335074_10003308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria21956Open in IMG/M
3300033158|Ga0335077_11500315All Organisms → cellular organisms → Bacteria → Terrabacteria group645Open in IMG/M
3300033289|Ga0310914_10151707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2044Open in IMG/M
3300033550|Ga0247829_10017321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4465Open in IMG/M
3300033551|Ga0247830_11154530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium618Open in IMG/M
3300034818|Ga0373950_0118923All Organisms → cellular organisms → Bacteria → Terrabacteria group583Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil15.44%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil14.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.50%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.15%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.31%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.57%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.57%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.21%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.21%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.84%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.47%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.47%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.47%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.47%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.10%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.10%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.10%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.10%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.10%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.10%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.74%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.74%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.74%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.74%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.74%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.74%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.74%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.74%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.74%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.74%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.74%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.74%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.37%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.37%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.37%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.37%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.37%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.37%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.37%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.37%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.37%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.37%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.37%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.37%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.37%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.37%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.37%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.37%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009810Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019259Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019884Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021358Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3Host-AssociatedOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022714Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300024347Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025588Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025604Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026275Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 (SPAdes)EnvironmentalOpen in IMG/M
3300026490Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-AEnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027056Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027158Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes)EnvironmentalOpen in IMG/M
3300027401Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes)EnvironmentalOpen in IMG/M
3300027681Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027795Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028790Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029701Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034818Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
C688J35102_11836379513300002568SoilVRRDVESGIASGEVRGTPTLFIDGVVHRGGYDTDALVKALSS*
JGI25382J43887_1024642313300002908Grasslands SoilSRDVRSGEASGEVRGTPTLFIDGVVLRGGYEVPTLLEALSR*
Ga0062389_10326084923300004092Bog Forest SoilVRRDVDSGIASGKIRGTPTLFIDGVVHRGSYDPATLLRTLAR*
Ga0063356_10639022213300004463Arabidopsis Thaliana RhizosphereGRDVDSGTASGEIRGTPTLFIDGVVYRGSYDATALVEVLTR*
Ga0062595_10057305733300004479SoilLRRIRRDIESGLASGKVHGTPTLFIDGLVHLGGYDVATMLEALSE*
Ga0062595_10109375633300004479SoilRRVDRDVRSGIASGDVHGTPTLFIDGVVHLGSYDADTLADVLS*
Ga0066815_1004121723300005164SoilVADRIRRDVDSGLASDQVLGTPILFIDGLVHRGGYDPPALLAALAP*
Ga0070683_10140740023300005329Corn RhizosphereRDVESGLASGQVHGTPTLFIAGVVYRGPRDTAGLLEALAR*
Ga0070691_1065514423300005341Corn, Switchgrass And Miscanthus RhizosphereRIRRDVDSGLASDQVLGTPTLFIDGVVHRGGYDPPTLLTALAR*
Ga0070714_10004061423300005435Agricultural SoilMHELLFLRRDVDSGLASGQVLGTPTLFIDGVVYRGGYDPPALLAALAA*
Ga0070714_10032364513300005435Agricultural SoilRIQRDVDSGLASGQVLGTPTLFIDGAVHRRGYDPPTLLAALAV*
Ga0070714_10073793733300005435Agricultural SoilRRDVDSGLASDQVLGTPTLFIDGLVHRGGYDPPALLAALAP*
Ga0070711_10139981723300005439Corn, Switchgrass And Miscanthus RhizosphereRIRRDVDSGLASDQVLGTPTLFIDGLVHRGGYDPPALLAALAP*
Ga0066682_1096724313300005450SoilRDVESGIASGEVRGTPTLFIDGIVHLGGYDAATLMEALAG*
Ga0070678_10014845343300005456Miscanthus RhizosphereAVADRIRRDVDSGLASDQVLGTPTLFIDGLVHRGGYDPAALLAALAR*
Ga0070678_10120357633300005456Miscanthus RhizosphereRDVDSGLASDQVLGTPTLFIDGVVHRGGYDPPALLAALAP*
Ga0070662_10060692913300005457Corn RhizosphereVPGRIQRDVNSGLASGQVVGTPTLFIDGLVHSRGYDPPTLLAALAPA
Ga0070706_10216097423300005467Corn, Switchgrass And Miscanthus RhizosphereDVESGRASGEVRGTPTLFIDGVVHRAGYDAETLMAALPG*
Ga0070731_1092427113300005538Surface SoilALGRVRRDVESGIASGEVLGTPTLFIDGVVHRGGYDAVALLEALAR*
Ga0066707_1031264223300005556SoilSSGEASGEVRGTPTLFIDGAVHRGGYDVDSLLEVLA*
Ga0066670_1026218833300005560SoilEAVLERIGRDVRSGEASGEVLGTPTLFIDGFVHRGGYDVEMLLEALAA*
Ga0068855_10180710613300005563Corn RhizosphereEATGEVRGTPTLFIDGAVYRGAYDPRTLRGALAS*
Ga0066903_10089827743300005764Tropical Forest SoilSGLASGEVLGTPTLFINGVAHRGGYDAATLLKALAP*
Ga0068858_10016167543300005842Switchgrass RhizosphereDSGLASDQVLGTPTLFIDGVVHRGGYDPPTLLTALAR*
Ga0068860_10225258223300005843Switchgrass RhizosphereRDRASGAVPGRIQRDVNSGLASGQVVGTPPVHRRRRARRGYDPPILLAALAPAR*
Ga0080026_1002839213300005952Permafrost SoilVNVLASGQVLGTPTLFIDGVVHRAGYDPPTLLAALAR*
Ga0066789_1001711343300005994SoilDSGLASGQVLGTPTLFIDGVVHRGGYDPPTLLAALAP*
Ga0066790_1000170213300005995SoilDVDSGLASGQVLGTPTLFIDGVVHRGGYDPAALLAALAP*
Ga0070717_1191077633300006028Corn, Switchgrass And Miscanthus RhizosphereDSGLASGQVLGTPTLFIDGVVHRGGYDLPTLLAALAL*
Ga0066652_10094605013300006046SoilDVESGIASGEVRGTPTLFIDGVVHRGSYDEATLLAALAR*
Ga0075024_10072382113300006047WatershedsVLERVRRDVDSGIASGEVMGTPTLFIDGVVHRRSYDPATLIMTLAR*
Ga0075017_10160379413300006059WatershedsVLERVRRDVDSGIASGEVRGTPTLFIDGVVHRGSYDAATLLRTLAR*
Ga0070715_1032204813300006163Corn, Switchgrass And Miscanthus RhizosphereDVDSGLASGQVLGTPTLFIDGVVHRRGYDPPTLLSALAASQ*
Ga0070712_10088947913300006175Corn, Switchgrass And Miscanthus RhizosphereVDSGLASGQVLGTPTLFIDGVVYRGGYDPPALLAALAP*
Ga0070765_10038846313300006176SoilVDSGIASGEVMGTPTLFIDGVAYRRSYDPATLIMTLAR*
Ga0070765_10066737723300006176SoilRASEVVLERVRRDVDSGIASGEVLGTPTLFIDGMVHQGGYDPATLIMTLAR*
Ga0074056_1167316013300006574SoilRDVDSGLASGQVLGTPTLFIDGVVHRGGYDPPTLLAALGP*
Ga0079221_1164515623300006804Agricultural SoilMVRQILACQRDVASGLASGQVLGTPTLFIDGVVHCVGYDPPTLLAALAP*
Ga0079220_1037376633300006806Agricultural SoilGLASGQVRGTPTLFIDGIVYRGGYDPLALLAALAL*
Ga0079220_1055892723300006806Agricultural SoilIRRDINSGLASGEVLGTPTLFINGVAHRDGYDAATLLKALAP*
Ga0075421_10033789823300006845Populus RhizosphereVASGQVLGTPTLFIEGIVHRGGDDPPAPLAALAP*
Ga0075431_10073941033300006847Populus RhizosphereRIRRDVDSGLASGQVLGTPTLFIDGIVHRGGDDPPAPLAALAP*
Ga0075433_1083471313300006852Populus RhizosphereDSGLASGQVMGTPTSFIDGVVHRGGYDPPALLTALAR*
Ga0075425_10214542723300006854Populus RhizosphereRDRIDRDVASGEASGEVRGTPTLFLDGIVYRDPYDAGTLLEALAR*
Ga0075425_10297726813300006854Populus RhizosphereRVRRDVETGMASGEVRGTPTLFIDGVVHRGAYDTTALLEVLAG*
Ga0073928_1112319023300006893Iron-Sulfur Acid SpringVESGLASGQVLGTPTLFIDGAVHQGGYEAAVLLEALTR*
Ga0075424_10004600613300006904Populus RhizosphereSGLASGEVLGTPTLFIDGAVVPRPYDEATLLKALTD*
Ga0075436_10045793133300006914Populus RhizosphereRRDVDSGLASGQVLGTPTLFIASVVHRRGYDPPALLAALAASG*
Ga0079219_1164177623300006954Agricultural SoilERIQRDVDSGLASGQVLGTPTLFIDGVVHRRSYDPPTLLAALAL*
Ga0079219_1206038013300006954Agricultural SoilRGGTSTFPGRNMVRQILACQRDVASGLASGQVLGTQTLFIDGVVHCVGYDPPTLLAALAP
Ga0075435_10146050323300007076Populus RhizosphereSGEASGEVRGTPTLYIDGVVYRGGYDAATLLEALTD*
Ga0099795_1032529133300007788Vadose Zone SoilDVDSGLASGQVLGTPTLFIDGVVHRGGYDPPALLAALAP*
Ga0099829_1029404933300009038Vadose Zone SoilVLGRVRRDVESGMASGEVLGTPTLFIDGVVHRGGYDAATLLEALAR*
Ga0099827_1054888933300009090Vadose Zone SoilRRDIDSGLASGEVRGTPTLFIDGVVHLGGYDAATLLKALTA*
Ga0066709_10079749433300009137Grasslands SoilVRSGTASGEVLGTPTLFIDGVVHRAGYDLATLARAVGR*
Ga0066709_10202194743300009137Grasslands SoilVASGQASGEVSGTPTLFIDGVVYLGGYDTATLMEALAA*
Ga0105243_1151826013300009148Miscanthus RhizosphereRILRDVESGNKTGEILGTPTLFIDGVVYRGAYDADALLEVLRG*
Ga0105092_1041121323300009157Freshwater SedimentAVLERVRRDVRSGSATGQVRGTPTLFIDGVVHRGSYQAAALVEVLAPRLQPS*
Ga0116216_1001390323300009698Peatlands SoilVDSGLASGQVLGTPTLFIDGVVHCGGYDPPALLAALAR*
Ga0116216_1062246513300009698Peatlands SoilVDSGLASGQVLGTPTLFIDGVVHRGGYDPPTLLAALAP*
Ga0126374_1076618323300009792Tropical Forest SoilVESGIASGEVHGTPTLFIDGVVHRAGYDEETLFVAVGP*
Ga0105088_102010913300009810Groundwater SandIRRDVDSGLASGQVLGAPTLFIDGVVHRGGYDPPALLAALAP*
Ga0116223_1068129323300009839Peatlands SoilDSGLASGQVLGTPTLFIDGVVHRGGYDPPTLLAALAA*
Ga0126313_1091754913300009840Serpentine SoilLRRIRRAVEGGIASGDVQGTPTLFIDGVVRRRGYDAATLIDALAG*
Ga0126308_1121941613300010040Serpentine SoilMSTAATGEVLGTPTLFIDGVDHRGAYDADTLVEVMTR*
Ga0126312_1112050333300010041Serpentine SoilARIRLDVESGLATGEVLGTPTLFIDGVVHRGPDDAASLLLEVNVS*
Ga0126314_1030757723300010042Serpentine SoilMPTAATGEVLGTPTLFIDGVDHRGAYDADTLVEVMTR*
Ga0126314_1098242623300010042Serpentine SoilMGSRDVDSGMASGQVRGTPTLFIDGIVHRGGYDAATLMEALAR*
Ga0126311_1190685823300010045Serpentine SoilRRDVESGLASGEVLGTPTLFIDGVVHRGSYDAASLVEEACLA*
Ga0099796_1017095923300010159Vadose Zone SoilRRDVDSGEASGEVWGTPTLFIDGVVHRGAYDAAVLLAALAR*
Ga0134111_1009576623300010329Grasslands SoilRDVESGIASGEVQGTPTLFIDGVVHLGGYDAATLTEALAG*
Ga0126370_1005940413300010358Tropical Forest SoilDSGLASRQVLGTPTLFIDGVVHRGGYDPPTLLAALGP*
Ga0126379_1033868413300010366Tropical Forest SoilTGLASDQVLGTPTLFIDGVVHRGGYDPFTLLAALAR*
Ga0126379_1053648113300010366Tropical Forest SoilIRRDINSGLASGEVLGTPTLFINAVAHRGGYDAATLLKALAP*
Ga0126379_1125744313300010366Tropical Forest SoilRRDVDSGLASGQVLGTPTLFIDGVVHRGGYDPPTLLAALGP*
Ga0126379_1184214913300010366Tropical Forest SoilINSGLASGEVLGTPTLFINGAAHRGGYDAATLLKALAR*
Ga0134125_1084466013300010371Terrestrial SoilIRRDVDSGLASDQVLGTPTLFIDGLVHRGGYDPPALLAALAR*
Ga0134125_1108936233300010371Terrestrial SoilRIRRDVDSGVASGEVHGTPTLFIDGRIHRGDYAAATLMEALAR*
Ga0134125_1141189623300010371Terrestrial SoilIRRDVDSGLASDQVLGTPTLFIDGLVHRGGYDPPALLAALAP*
Ga0105239_1059729033300010375Corn RhizosphereEASGEVLGTPTLFIDGVVHRGAYDTAALMEALAS*
Ga0134126_1145564813300010396Terrestrial SoilRVLRRVARDMSSGIDSGEVLGTPTLFIDGAVHAGGYDAATLLAALGVA*
Ga0134121_1316095313300010401Terrestrial SoilTAVAYRIRRYVPSVLPSRQLLGTPTLFIAGVVHRGGYDPPTLLAALAP*
Ga0134123_1332871313300010403Terrestrial SoilLARIRRDVESGRASGEVRGTPTLFIDGVVHRGGYEAATLMDALGA*
Ga0126361_1028628723300010876Boreal Forest SoilERIQRDVDSGLASGQVLGTPTLFIDGIVHRGGYDPPVLLAALAP*
Ga0151490_135811823300011107SoilLASGQVLGTPTLFIDGIVHRGGYDPPALLAALAP*
Ga0105246_1207177613300011119Miscanthus RhizosphereLASDQVLGTPTLFIDGVVHRGGYDPPALLAALVIRGPG*
Ga0137391_1012941753300011270Vadose Zone SoilDVDSGLASGQVLGTPTLFIDGVVHRGGYDPPALLAALARWR*
Ga0137389_1175349113300012096Vadose Zone SoilDVVLERVRRDVDSGIASGQVRGTPTLFIDGMVHRASYDAATLLRTLGG*
Ga0137365_1007341443300012201Vadose Zone SoilMASGDVLGTPTLFVDGIVHRAGYDAATLLEALAR*
Ga0137363_1145970513300012202Vadose Zone SoilSIGVGDRIRRDVGSGLASGQVVRTPTLFIDGVVHRGGYDPPTLLAALAS*
Ga0137399_1055884413300012203Vadose Zone SoilRRDAGSGLASGQVAGTPTLFIDGVVHRGGYDPPALLAALARWR*
Ga0137399_1165658513300012203Vadose Zone SoilRIQRDVDSGLASGQVLGTPTLFIDGVVHRRGYDPPTLLAALAA*
Ga0137374_1070941023300012204Vadose Zone SoilFDQDRFSSEVLGRVGRDVASGLASGEVRGTPTLFIDGVVHAGGYDEPTLIEALAV*
Ga0137381_1071337113300012207Vadose Zone SoilRRDVDSGLASGQVLGTPTLFIDGVVHRRGYDPPTLLAALAP*
Ga0137381_1148637513300012207Vadose Zone SoilDSGLASGQVVGTPTLFIDGVVHRGGYDPPTLLAALAP*
Ga0137379_1069225933300012209Vadose Zone SoilLASGQVAGTPTLFIDGVVHRGGYDPPTLLTALAP*
Ga0137379_1101441213300012209Vadose Zone SoilRDINSGLASGEVLGTPALFINGVAHRGGYDAATLLKALAPGT*
Ga0137379_1173686813300012209Vadose Zone SoilRDVDSGLASGQVLGIPTLFVDDVVHRGGYDPPTLLAALAP*
Ga0137378_1015995313300012210Vadose Zone SoilSGRASGQVLGTPTLFIEGVVHRGGYDPPTLLAALGP*
Ga0137377_1067470213300012211Vadose Zone SoilLASGQVLGTPTLFIDGVVHRRGYDPPTLLAALAP*
Ga0137377_1102648223300012211Vadose Zone SoilVVRRGVRRDVRSGTASGEVLGTPTLFIDGVVHRAGYDLATLARAVAR*
Ga0150985_10889526513300012212Avena Fatua RhizosphereGVLARIRRDVESGIATGEILGTPTMFIDGVVHRGSYDAASLLQEVTVP*
Ga0150985_10891953523300012212Avena Fatua RhizosphereDLGQVRGTPTLFIDGVLHQGGHDPASLLEALRTRA*
Ga0137387_1034644123300012349Vadose Zone SoilARVLERVDRDVQSGIASGEVGGTPTLFIDGVVHRGSYDTAALLQALAG*
Ga0137372_10010872153300012350Vadose Zone SoilVESGMASGQVRGTPTLFIDGVVHRGGYDAAALLEALAG*
Ga0137372_1024715113300012350Vadose Zone SoilLASGQVLGTPTLFIDGVVHRGGYDPPTLLAALATSD*
Ga0137372_1051749013300012350Vadose Zone SoilVLGRVRRDVDSGIASGAVRGTPVLFIDGVVHGGGYDAAVLLAALAR*
Ga0137366_1059689023300012354Vadose Zone SoilSSLASGQVLGTPTLFINGVVHRGGYDPPTLLAALGP*
Ga0137385_1161170223300012359Vadose Zone SoilRIERDRASGEASGEVQGTPTLFIDGVVHRGGYDAATLIEELAG*
Ga0137375_1063081023300012360Vadose Zone SoilERIRRDVDSGLASGQVLGTPTLFIDGIVYRGGYDPPALLAALAP*
Ga0137390_1037986313300012363Vadose Zone SoilDVRSGEASGEVRGTPTLFIDGVVYRGGYDVPTLLEALS*
Ga0137390_1052754913300012363Vadose Zone SoilLASGQVVGTPTLFIDGVVHRGGYDPPALLAALAP*
Ga0137397_1050057633300012685Vadose Zone SoilRIRRDVGSGLASGQVVRTPTLFIDGVVHRGGYDPPTLLAALAP*
Ga0157301_1008057113300012911SoilERVRRDVESGIASGEVLGTPTLFIDGVVYRGDYDAATLLEAIGGP*
Ga0157301_1021592833300012911SoilGLASGEVLGTPTLFIDGTVHRGPYDAASLLQEVTVS*
Ga0137395_1109194913300012917Vadose Zone SoilDVESGMASGEVLGTPTLFIDGVVHRGGYDAATLLEALAR*
Ga0137396_1049487223300012918Vadose Zone SoilDSGIASGEVQGTPTLFIDGVVHRDGYDAATLLEALAR*
Ga0137359_1139201213300012923Vadose Zone SoilSGIASGDVRSTPTLFIDGVVHTGGYDAETLLEALT*
Ga0137404_1231576323300012929Vadose Zone SoilMWTAAWASGQVLGTPTLFIDGIVYRGGYDPPALLAALAP*
Ga0164300_1010845713300012951SoilRSGMESGEVRGTPTLFIDGAVHLGAYDLDTLREAMTRP*
Ga0164300_1035068223300012951SoilMQTGEVRGTPTLFTDGIVHRGGYDARTLLEALAE*
Ga0164300_1058916013300012951SoilDRTSGEATGEVQGTPTLFLDGVVHRGGYEVSTLVEALAR*
Ga0164300_1095535013300012951SoilRDMQSGAASGEVRGTPTLFIDGVVHRGDPRVAALLEALA*
Ga0164300_1103661233300012951SoilGEASGEVLGTPTPFIDGVVHRGGYDTAALMEALAS*
Ga0126369_1086162313300012971Tropical Forest SoilRDVDSGLASGQVLGTPTLFIDGVVHRGGYDPPALLAALAP*
Ga0134110_1051843333300012975Grasslands SoilVERDVASGEASGVVLGTPTLFIDGIVYRGGYDAPTLLRALGG*
Ga0164308_1034944913300012985SoilERVLDRIRRDVDSGVGSGEVLGTPTLFIDGVVYRDAYDADRLLDALR*
Ga0164308_1127381923300012985SoilVLGRVRRDVESGEASGEVRGTPTLYIDGIVYRGGYDAAALLEALTD*
Ga0164308_1160071823300012985SoilDVESGLATGAVRGTPTLFIDGVVHLGGYDAPALLEALA*
Ga0164308_1203341413300012985SoilVDSGLASGQVLGTPTLFIDGVVHRGGYDPPTLLAALGQ*
Ga0164304_1103900813300012986SoilRISDPVLNRIRRDVSSGEASGEVRGTPTLFIDGAVHRGGYDVDSLLEALA*
Ga0164305_1062438623300012989SoilRAGDVVLARIRRDVESGLETGEVLGTPTMFIDGDVHRGPYDAAALLQAIEAG*
Ga0164305_1119452823300012989SoilVNSGLSSGQVLGTPTLFIDGVVHRGGYDRPAMLAALAP*
Ga0157307_110723423300013096SoilVLGRIQRDVNSGLASGQVVGTPTLFIDGLVHSRGYDPPTLLAALAPAR*
Ga0157378_1041069033300013297Miscanthus RhizosphereVRSGVASGEVQGTPTIFIDGVVYRDGYDTETLLDVLAR*
Ga0182024_1023689313300014501PermafrostIQRDVDSGLASGQVLGTPTLFIDGVVHRGGYDPLTLLAALAP*
Ga0182024_1057001413300014501PermafrostTVLERIQRDVDSGLASGQVLGTPTLFIDGVVHRGDYNPPTLLAALAPSK*
Ga0157377_1040402733300014745Miscanthus RhizosphereDRIRRDVESGVAGGEVRGTPTLFIDGLVPRGSYDAPTLLTAPAARR*
Ga0137418_1120764323300015241Vadose Zone SoilDRTGTEVLGRIARDVESGMASGEVQGTPTLFIDGVVHLGGYDAATLLEALGR*
Ga0132255_10359937823300015374Arabidopsis RhizosphereDVDSGLASGQVLGTPTLYIDGVVHRGGYDPPTLLAALASSE*
Ga0182041_1085115813300016294SoilMSSGIASGQVLGTPTLFIDGVVHAGGYDAQSLIDALTHT
Ga0182033_1001764713300016319SoilSGLASGEVLGTPTLFINGAAHRGGYDAATLLKALAP
Ga0187818_1050850823300017823Freshwater SedimentDVDSGLASGQVLGTPTLFIDGVVHRGGYDPPALLAALAP
Ga0187817_1005338013300017955Freshwater SedimentRDVDSGLASGQVLGTPTLFIDGVVHRGGYDPPALLAALAR
Ga0190266_1053648013300017965SoilGRVRRDMESGMASGEVLGTPTLFIDGVVYRGDYDTATLLDVLARP
Ga0190266_1068919823300017965SoilAVAERIRRDVDSGLASGQVLGTPTLFIDGIVHRGGYDPRALLAALSP
Ga0187822_1022986313300017994Freshwater SedimentGLDSGQVLGTPTLFIDGVVHRGGYDPPALLAALARFR
Ga0187863_10005011133300018034PeatlandVLERIQRDVDSGLASGQVLGTPTLFIDGVVHRDGYDPLTLLAALAP
Ga0184618_1007063133300018071Groundwater SedimentQRDVNSGLASGQVVGTPTLFIDGIVHRRGYDPPTLLAALARAR
Ga0184609_1035274213300018076Groundwater SedimentRDVDSGLASGQVLGTPTLFIDGIVHRGGYDPPALLAALAP
Ga0184625_1040489823300018081Groundwater SedimentGMASREVRGTPTLFIDGIVHRGGYDAAALLEALATTGARG
Ga0190265_1096200233300018422SoilRDVQSGMATGEVLGTPTLFIDGAVHRGGYDAATLLEALAR
Ga0190265_1257583923300018422SoilVRRDVRSGSATGQVTGTPTLFIDGVVHRGSYQAAALLEVLAPRLQSS
Ga0190272_1172073213300018429SoilAVLARVRRDVLSGMTTGEVRGTPTLFIDGAVHRGGYDAATLLEALAR
Ga0190275_1223469113300018432SoilSGLATGEVLGTPTIFIDGVVHRGSYEAASLLQEVTVP
Ga0190268_1011091813300018466SoilDVLSGMTTGEVRGTPTLFIDGAVHRGGYDAATLLEALAR
Ga0190270_1244458623300018469SoilAARIRRDVDSGMASGQVLGTPTLFIDGIAHRRGYDPPTLLAALAPAR
Ga0190271_1302670333300018481SoilDSGTASGELRGTPTLFIDGVVHLGGYDAATLLEALTQ
Ga0190273_1170389513300018920SoilDMAGDEVLARIRRDVDSGLATGEVQGTPTLFIDGVVHRSAYDADALMEALAR
Ga0184646_108797023300019259Groundwater SedimentRRDVESGIASGEVRGTPTLFIDGVVHLGAYDAATLLEALVR
Ga0173481_1042287423300019356SoilVSSGESSGEVRGTPTLFIDGAVHRGGYDVDSLLEALA
Ga0190264_1151953713300019377SoilDIRSGSATGQVTGTPTLFIDGVVHRGSYTAAALLDVLAPRLKAS
Ga0193741_112119313300019884SoilRVRRDVQSGLASGEVRGTPTLFIDGVVHRGGYDAATLLEVLAG
Ga0193728_119810523300019890SoilRIRRDVDSGLASGQVLGTPTLFIDGVVHRGGYDPPTLLAVLAP
Ga0210395_1008701653300020582SoilDSGRATGEVLGTPTLFIDGAVHRGGYDPPTLLAALAS
Ga0210395_1054207113300020582SoilVGSGQASGEVRGTPTLFIDGVVPRGGFAASASLEVLAR
Ga0210378_1040056813300021073Groundwater SedimentGLARIRRDVESGTASGQVQGTPTLFIDGVVHRGAYDAGALLEALAR
Ga0210408_1059599013300021178SoilVDSGLASGQVLGTPTLFIDGVVHRGGYDPPALLAALARWR
Ga0213873_1027703413300021358RhizosphereWESDLVLERIRRDVCSGDASGEVLGTPTLFIDGVLHRNGYDPASLREALSR
Ga0213875_1035820033300021388Plant RootsRFEDERESDVVLERIRRDVRSGDASGEVLGTPTLFIDGVLHPGGHDPESLREALSR
Ga0210386_1067787823300021406SoilGMASGQVLGIPTLFIDGVVHRGGYDPPALLTALAS
Ga0210383_1102707413300021407SoilRSLASGQVLGTPTLFIDGVLHRGGYDPHTLLPALDVLAP
Ga0210383_1112452623300021407SoilIRRDVDSGLASGQVVGTPTLFIDGVVHRGGYDPPTLLAALAP
Ga0210383_1145702523300021407SoilDSGLASGQVLGTPTLFIDGVVHRGGYDPPSLLAALAQ
Ga0210394_1162014613300021420SoilASGQVLGTPTLFIDGVVHRGGYDPPALLAALARWR
Ga0210391_1098353823300021433SoilGLASGQVVDTPTLFIDGVVHRGGYDPPALLAALAP
Ga0210390_1109093213300021474SoilPLVLGRVQRDVKSGMASGEVLGTPTLFIDGVVHRGGYDTATLIEALAR
Ga0210409_1122316323300021559SoilDVDSGIASGEVWGTPTLFIDGVVHRGSYDPATLLSTLGR
Ga0242671_102369813300022714SoilLASGQVLGTPTLFIDGVVYRGGYDPAALLAALATTR
Ga0247668_112301813300024331SoilDVDSGLASDQVLGTPTLFIDGLVHRGGYDPPALLAALAP
Ga0179591_105069513300024347Vadose Zone SoilLTAIASTVDVLGRVRRDVESGIATGEVQGTPTLFIDGVVHLGSYDASSLMEALAT
Ga0208586_112379713300025588Arctic Peat SoilRRDIDSGLASGQVAGTPTLFIDGVVHRGGYDPPTLLAALAP
Ga0207930_101878413300025604Arctic Peat SoilSTAALERIQRDVDSGLASGRVLGTPTLFIDCVVHRGGYDPPALLAALAPAR
Ga0207710_1023902113300025900Switchgrass RhizosphereVDSGLASDQVLGTPTLFIDGAVHRGGYDPPTLLTALAP
Ga0207685_1012495413300025905Corn, Switchgrass And Miscanthus RhizosphereRIQRDVDSGLASGQVLGTPTLFIDGVVHRGGYDPPTLLAALAR
Ga0207684_1170904523300025910Corn, Switchgrass And Miscanthus RhizosphereDVDSGLASGQVLGTPTLFIDGVVHRGGYDPSTLLAALPR
Ga0207693_1033194413300025915Corn, Switchgrass And Miscanthus RhizosphereRRDVDSGLASGQVLGTPTLFIDGVVHRGGYDPPALLAALAP
Ga0207693_1101941423300025915Corn, Switchgrass And Miscanthus RhizosphereVNSGLSSGQVLGTPTLFIDGVVHRGGYDRPALLAALAR
Ga0207646_1015821813300025922Corn, Switchgrass And Miscanthus RhizosphereLERVRRDVRSGIASGEVLGTPTLFIDGVVHGAGYDLATLARAVAR
Ga0207700_1018819813300025928Corn, Switchgrass And Miscanthus RhizosphereMHELLFLRRDVDSGLASGQVLGTPTLFIDGVVYRGGYDPPALLAALAA
Ga0207700_1165587213300025928Corn, Switchgrass And Miscanthus RhizosphereGLASGQVAGTPTLFIDGVVHRGGYDPPALLAALDR
Ga0207686_1142535513300025934Miscanthus RhizosphereFEADRLSDPVLNRIRRDVSSGEASGEVRGTPTLFIDGAVHRGGYDVDSLLEALA
Ga0207686_1152495323300025934Miscanthus RhizosphereGSGEASGEVLGTPTLFIDGVVHRGAYDTAALMEALAS
Ga0207709_1025308413300025935Miscanthus RhizosphereVNSGLASGQVVGTPPVHRRRRARRGYDPPILLAALAPAR
Ga0207665_1100861513300025939Corn, Switchgrass And Miscanthus RhizosphereRTSERVLDRIRRDVDSGVASGEVLGTPTLFIDGVVYRDAYDADRLLDALR
Ga0207689_1110490213300025942Miscanthus RhizosphereWRGTDVLARVCRDLGSGEASGEVLGTPTLFIDGVVHRGAYDTAALMEALAS
Ga0207640_1021657933300025981Corn RhizosphereVDSGLASDQVLGTPTLFIDGVVHRGGYDPPTLLTALAR
Ga0207640_1037862133300025981Corn RhizosphereSGLATGEVRGTPTLFVDGVVHAGGYDAASLAEAVGG
Ga0209901_109671013300026275Permafrost SoilRIRRDAESGLASGAVHGTPTLFIDGLVHRGGYDPATLLEVLAK
Ga0257153_104853413300026490SoilVDSGLASGQVLGTPTLFIDGVVYRGRYDPATLLTALAP
Ga0209648_1049729033300026551Grasslands SoilASGLASGQVLGTPMLFIDGVVHRGGYDPPTLLAALTP
Ga0209879_106270423300027056Groundwater SandVDSGLASGQVLGAPTLFIDGVVHRSGYDPPALLAALAP
Ga0208725_107164813300027158Forest SoilARIRRDVHSGLASGQVLGTPTLFIDGVVYRGGYDPPALVAALATTR
Ga0208637_101689413300027401SoilVADRIRRDVDSGLASDQVLGTPILFIDGLVHRGGYDPPALLA
Ga0208991_102494843300027681Forest SoilDVRSGMATGEVRGTPTLFIDGVVHRGAYDGGTLMAALAR
Ga0209073_1023769313300027765Agricultural SoilLIRRDINSGLASGEVLGTPTLFINGVAHRDGYDAATLLKALAP
Ga0209177_1018857723300027775Agricultural SoilVNSGLSSGQVLGTPTLFIDGVVLRGGYDRPALLAALAR
Ga0209139_1009512933300027795Bog Forest SoilSGLASGQVVGTPTLFIDGVVHRGGYDPPTLLAVLAP
Ga0209701_1022022433300027862Vadose Zone SoilDSGLASGQVLGTPTLFIDGVVHRGGYDPPTLLAALGP
Ga0209814_1002535213300027873Populus RhizosphereVAERIRRDVDSGLASGQVLGAPTLFIDGVVHRGGYDPPALLAALAP
Ga0209283_1044755213300027875Vadose Zone SoilRFEQDRTSAGVLGRIRRDVESGIASGELRGTPTLFIDGVVYRGGYNAATLLVALAR
Ga0209380_1030541813300027889SoilRDVASGLASGQVLGTPTLFIDGVVHRGGYDPPALLAALAAKAVMRSRSAR
Ga0209488_1035226213300027903Vadose Zone SoilVVLERVRRDVDSGIASGKVLGTPTLFIDGVVHRGSYDPATLLSTLAR
Ga0209488_1100881733300027903Vadose Zone SoilVDSGLASGQVLGTPALFIDGVVHRGGYDPPTLLAALAA
Ga0209168_1059358913300027986Surface SoilVLERVRRDVDSGIASGEVLGTPTLFIDGVVHRGDYDPATLIMTLAR
Ga0209526_1067043613300028047Forest SoilRSGIASGEVRGTPTLFINGVVHRAGYDAPTLLGVLAR
Ga0268266_1049986433300028379Switchgrass RhizosphereRIRRDVDSGLASDQVLGTPTLFIDGLVHRGGYDPPALLAALAP
Ga0268265_1238128213300028380Switchgrass RhizosphereRIRRDVESGVARGEVRGTPTLFIDGVVHRGSYDAPTLPTAPAARR
Ga0268264_1214205213300028381Switchgrass RhizosphereVAGGEVRGTPTRFIDGVVHRGSYDAPTLLTAPSARR
Ga0247822_1036638913300028592SoilQRDVNSGLASGQVVGTPLFIDGVVHRRGYDPPILLAALAPAR
Ga0307322_1021189123300028710SoilRVQRDVDSGRASGEIQGTPTLFIDGVVHRGAYDAPGLMEALAR
Ga0307298_1017987833300028717SoilSTGVLARIRRDVDSGLATGEILGTPTLFIDGVVHRGPHDAATLLQEVTNP
Ga0307318_1006282133300028744SoilVDSGLASGQVLGTPTLFIDGIVHRGGYDPRALLAALSP
Ga0307316_1003380513300028755SoilESGMASGEVLGTPTLFIDGVVYRGGYDAATLLEAIGGP
Ga0307283_1018594313300028790SoilVLGRIQRDVYGGLASGQVVGTPTLFIDGVVHRRGYDPPTLLAALAPAR
Ga0307292_1028454223300028811SoilDMESGMASGEVLGTPTLFIDGVVYRGGYDAATLLEAIGGP
Ga0307296_1023926613300028819SoilVPGRIQRDVDSGLASGQVLGTPTLFIDGVVRRRGYDPPNLLATLAPSR
Ga0307312_1003759733300028828SoilVLGRIQRDVNGGLASGQVVGTPTLFIDGVVHRRGYDPPTLLAALAPAR
Ga0307312_1076890923300028828SoilSGLASGQVLGTPTLFIGGVVHRGGYDPPTLLAALAP
Ga0307289_1027577023300028875SoilRDVESGLASGEVLGTPTLFIDGVVHRGPYDAASLVEEVSLP
Ga0307277_1022577033300028881SoilESGIATGEVLGTPTMFIDGVVLRGSFGADSLLEELNVHERLHPR
Ga0308309_1039201733300028906SoilVRRDVDSGIASGEVMGTPTLFIDGVAHRRSYDPATLIMTLAR
Ga0308309_1189325013300028906SoilASDIVLERVRRDVDSGIASGEVMGTPTLFIDGVAYRRSYDPATLIMTLAR
Ga0222748_101383433300029701SoilRRDVHSGLASGQVLGTPTLFIDGVVYRGGYDPPALVAALATTR
Ga0310037_1001912553300030494Peatlands SoilVDSGLASGQVLGTPTLFIDGVVHCGGYDPPALLAALAR
Ga0308187_1047725113300031114SoilSGMASGELRGTPTLFIDGVVHRGGYDAATLMEALAR
Ga0307498_1017493643300031170SoilDSGLASGQVLGTPTLFIDGVVHRGGYDPPTLLSALAP
Ga0318516_1028224313300031543SoilLERVERDVRSGAASGEVFGTPTLFIDGAIHRGDYNVDSLLEIIAG
Ga0318516_1038181013300031543SoilMSSGIASGQVLGTPTLFIDGAVHTGGYDLASLIDALSSDH
Ga0318541_1031742233300031545SoilDVDSGLASGQVLGTPTLFIDGVVHRGGYDPPTVLAALAAPR
Ga0318571_1036723133300031549SoilIRRDVDSGLASGQVLGTPTLFIDDVVHRGGYDPPTLLAALAR
Ga0318561_1003623013300031679SoilAGPLVLGGIRRDVNSGLASGEVLGTPTLFINGAAHRGGYDAATLLKALAP
Ga0318494_1004242263300031751SoilDVNSGLASGEVLGTPTLFINGAAHRGGYDAATLLKALAP
Ga0307477_1029998713300031753Hardwood Forest SoilASGEVIGTPTLFIDGALHRGGYDATTLLSALARVREPTVKR
Ga0307475_1118580623300031754Hardwood Forest SoilIRRDVRSGIDSGDVLGTPTLFISGSLYVGPYDADTLTKALVT
Ga0318535_1034178843300031764SoilDVDSGLASGQVRGTPTLFIDGVVHCGGYDPPALLAALAR
Ga0318546_1074176613300031771SoilSGLASGQVLGTPTLFIDGVVHRGGYDPPALLAALA
Ga0318498_1041651113300031778SoilAVLRRVARDMSSGIASGQVLGTPTLFIDGAVHTGGYDLASLIDALSSDH
Ga0318523_1018134833300031798SoilNSGVASGEVLGTPTLFINGLAHRGGYDAATLLKALAP
Ga0318565_1048456513300031799SoilDMSSGIASGQVLGTPTLFIDGAVHTGGYDLASLIDALSSDH
Ga0307478_1076794723300031823Hardwood Forest SoilVAGRIRRDVDSGLASDQVLGTSALFIDGVFHRGGYDPPALLAALSL
Ga0307478_1162842423300031823Hardwood Forest SoilASGVASGQVLGTPTLFIDGVVYRGGYDPPTLLAALTP
Ga0318536_1039596823300031893SoilVERIRRDVDSGVASGQVLGTPTLFIDGTVHRGGYDPPTLLAELAS
Ga0307406_1119144923300031901RhizosphereVLARIRRDVDSGLATGEVQGTPTLFIDGVVHRGAYDTASLMEALDR
Ga0310900_1042571213300031908SoilDVDSGLASGQVLGTPTLFIDGVVHRRGYDPPTLLAALAPAR
Ga0306921_1017134513300031912SoilLASGEMLGTPALFINGAAHRGGYDAATLLKALAPRV
Ga0318530_1022678023300031959SoilLVLGGIRRDVNSGLASGEVLGTPTLFINGAAHRGGYDAATLLKALAP
Ga0310903_1064179723300032000SoilGRIQRDVNSGLASGQVVGTPLFIDGVVHRRGYDPPILLAALAPAR
Ga0318507_1055506913300032025SoilDVDSGLASGQVLGTPTLFIDGVVHRGGYDPPALLAALAR
Ga0318559_1002889533300032039SoilVDSGLASGQVLGTPTLFIDGVVHRGGYDPPALLAALAR
Ga0318549_1052689813300032041SoilLSSGIASGQVLGTPTLFIDGAVHTGGYDLASLIDALSSNH
Ga0318510_1001947563300032064SoilPLVLGGIRRDVNSGLASGEVLGTPTLFINGAAHRGGYDAATLLKALAP
Ga0318524_1027556813300032067SoilARDFTSGLASGQVAGTPTLFIGGAVHLGSYDAQTLLEALTRATP
Ga0307472_10195513213300032205Hardwood Forest SoilRIRRDVDSGLASDQVLGTPTLFIDGLVHRGGYDPPALLAALAR
Ga0306920_10026092153300032261SoilRRDVDSGLASGQVLGTPTLFIDGVVHRGGYDPPALLAALAR
Ga0335081_1008375413300032892SoilVVLERIERDFRSGIESGEVRGTPTLFIDGVVHLGRYDAETLLALVKR
Ga0335074_1000330893300032895SoilVAERIDRDVQSGLASGRVLGTPTLFIKGIGYRGGYDPPALVAALAP
Ga0335077_1150031523300033158SoilRSGIESGEVQGTPTLFIDGVVYLGGYDAESILGVLTR
Ga0310914_1015170713300033289SoilIRRDVNSGLASGEVLGTPALFINGAAHRGGYDAATLLKALAPRV
Ga0247829_1001732113300033550SoilVNSSLASGQVVGTPLFIDGVVHRRGYDPPILLAALAPAR
Ga0247830_1115453013300033551SoilALTVAVEPLDVESGLASGLVTGTPTLFIDGRVHRGAYDAPRLLEALGR
Ga0373950_0118923_1_1263300034818Rhizosphere SoilQRDVDSGLASGQVLGTPTLFIDGVVHRGGYDPPTLLAALAL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.