| Basic Information | |
|---|---|
| Family ID | F013371 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 272 |
| Average Sequence Length | 42 residues |
| Representative Sequence | RDVDSGLASGQVLGTPTLFIDGVVHRGGYDPPALLAALAP |
| Number of Associated Samples | 223 |
| Number of Associated Scaffolds | 272 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 6.99 % |
| % of genes near scaffold ends (potentially truncated) | 87.50 % |
| % of genes from short scaffolds (< 2000 bps) | 88.60 % |
| Associated GOLD sequencing projects | 213 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.485 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.441 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.735 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.647 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.06% β-sheet: 8.82% Coil/Unstructured: 69.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 272 Family Scaffolds |
|---|---|---|
| PF02589 | LUD_dom | 17.65 |
| PF02148 | zf-UBP | 6.62 |
| PF00571 | CBS | 6.25 |
| PF07992 | Pyr_redox_2 | 3.68 |
| PF04264 | YceI | 2.94 |
| PF00296 | Bac_luciferase | 2.94 |
| PF00730 | HhH-GPD | 1.84 |
| PF01734 | Patatin | 1.84 |
| PF00196 | GerE | 1.47 |
| PF13462 | Thioredoxin_4 | 1.10 |
| PF06772 | LtrA | 1.10 |
| PF08240 | ADH_N | 1.10 |
| PF04298 | Zn_peptidase_2 | 1.10 |
| PF04075 | F420H2_quin_red | 1.10 |
| PF06055 | ExoD | 1.10 |
| PF07859 | Abhydrolase_3 | 0.74 |
| PF13365 | Trypsin_2 | 0.74 |
| PF01323 | DSBA | 0.74 |
| PF00135 | COesterase | 0.74 |
| PF01243 | Putative_PNPOx | 0.74 |
| PF12680 | SnoaL_2 | 0.74 |
| PF00106 | adh_short | 0.74 |
| PF00072 | Response_reg | 0.74 |
| PF00248 | Aldo_ket_red | 0.37 |
| PF02683 | DsbD | 0.37 |
| PF03706 | LPG_synthase_TM | 0.37 |
| PF00990 | GGDEF | 0.37 |
| PF13520 | AA_permease_2 | 0.37 |
| PF00999 | Na_H_Exchanger | 0.37 |
| PF00753 | Lactamase_B | 0.37 |
| PF06197 | DUF998 | 0.37 |
| PF12850 | Metallophos_2 | 0.37 |
| PF07883 | Cupin_2 | 0.37 |
| PF12697 | Abhydrolase_6 | 0.37 |
| PF00441 | Acyl-CoA_dh_1 | 0.37 |
| PF14339 | DUF4394 | 0.37 |
| PF00171 | Aldedh | 0.37 |
| PF01047 | MarR | 0.37 |
| PF03109 | ABC1 | 0.37 |
| PF08530 | PepX_C | 0.37 |
| PF00326 | Peptidase_S9 | 0.37 |
| PF13434 | Lys_Orn_oxgnase | 0.37 |
| PF03807 | F420_oxidored | 0.37 |
| PF04545 | Sigma70_r4 | 0.37 |
| PF01814 | Hemerythrin | 0.37 |
| PF00300 | His_Phos_1 | 0.37 |
| PF00027 | cNMP_binding | 0.37 |
| PF03401 | TctC | 0.37 |
| PF13191 | AAA_16 | 0.37 |
| PF10590 | PNP_phzG_C | 0.37 |
| PF10415 | FumaraseC_C | 0.37 |
| PF13561 | adh_short_C2 | 0.37 |
| PF06736 | TMEM175 | 0.37 |
| PF12802 | MarR_2 | 0.37 |
| PF08281 | Sigma70_r4_2 | 0.37 |
| PF13556 | HTH_30 | 0.37 |
| PF00108 | Thiolase_N | 0.37 |
| PF13602 | ADH_zinc_N_2 | 0.37 |
| PF00563 | EAL | 0.37 |
| PF04454 | Linocin_M18 | 0.37 |
| PF00270 | DEAD | 0.37 |
| PF13302 | Acetyltransf_3 | 0.37 |
| PF01494 | FAD_binding_3 | 0.37 |
| PF00970 | FAD_binding_6 | 0.37 |
| PF01406 | tRNA-synt_1e | 0.37 |
| PF13280 | WYL | 0.37 |
| PF00271 | Helicase_C | 0.37 |
| PF02826 | 2-Hacid_dh_C | 0.37 |
| PF00133 | tRNA-synt_1 | 0.37 |
| COG ID | Name | Functional Category | % Frequency in 272 Family Scaffolds |
|---|---|---|---|
| COG5207 | Uncharacterized Zn-finger protein, UBP-type | General function prediction only [R] | 6.62 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 2.94 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 2.94 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 1.84 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 1.84 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 1.84 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 1.84 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 1.84 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 1.84 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 1.84 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 1.84 |
| COG2738 | Zn-dependent membrane protease YugP | Posttranslational modification, protein turnover, chaperones [O] | 1.10 |
| COG3932 | Exopolysaccharide synthesis protein ExoD | Cell wall/membrane/envelope biogenesis [M] | 1.10 |
| COG4292 | Low temperature requirement protein LtrA (function unknown) | Function unknown [S] | 1.10 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.74 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.74 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.74 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.74 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.37 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.37 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.37 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.37 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.37 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.37 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.37 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.37 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.37 |
| COG3371 | Uncharacterized membrane protein | Function unknown [S] | 0.37 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.37 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.37 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.37 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.37 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.37 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.37 |
| COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 0.37 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.37 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.37 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.37 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.37 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.37 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.37 |
| COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.37 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.37 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.37 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.37 |
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.37 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.49 % |
| Unclassified | root | N/A | 5.51 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002568|C688J35102_118363795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 552 | Open in IMG/M |
| 3300002908|JGI25382J43887_10246423 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300004092|Ga0062389_103260849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 608 | Open in IMG/M |
| 3300004463|Ga0063356_106390222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 505 | Open in IMG/M |
| 3300004479|Ga0062595_100573057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 871 | Open in IMG/M |
| 3300004479|Ga0062595_101093756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 696 | Open in IMG/M |
| 3300005164|Ga0066815_10041217 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300005329|Ga0070683_101407400 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300005341|Ga0070691_10655144 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300005435|Ga0070714_100040614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3921 | Open in IMG/M |
| 3300005435|Ga0070714_100323645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1442 | Open in IMG/M |
| 3300005435|Ga0070714_100737937 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300005439|Ga0070711_101399817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 608 | Open in IMG/M |
| 3300005450|Ga0066682_10967243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
| 3300005456|Ga0070678_100148453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1885 | Open in IMG/M |
| 3300005456|Ga0070678_101203576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 702 | Open in IMG/M |
| 3300005457|Ga0070662_100606929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 921 | Open in IMG/M |
| 3300005467|Ga0070706_102160974 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005538|Ga0070731_10924271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 578 | Open in IMG/M |
| 3300005556|Ga0066707_10312642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1028 | Open in IMG/M |
| 3300005560|Ga0066670_10262188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1048 | Open in IMG/M |
| 3300005563|Ga0068855_101807106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
| 3300005764|Ga0066903_100898277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1602 | Open in IMG/M |
| 3300005842|Ga0068858_100161675 | All Organisms → cellular organisms → Bacteria | 2108 | Open in IMG/M |
| 3300005843|Ga0068860_102252582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 565 | Open in IMG/M |
| 3300005952|Ga0080026_10028392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1397 | Open in IMG/M |
| 3300005994|Ga0066789_10017113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3208 | Open in IMG/M |
| 3300005995|Ga0066790_10001702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 9388 | Open in IMG/M |
| 3300006028|Ga0070717_11910776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 535 | Open in IMG/M |
| 3300006046|Ga0066652_100946050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 820 | Open in IMG/M |
| 3300006047|Ga0075024_100723821 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300006059|Ga0075017_101603794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 514 | Open in IMG/M |
| 3300006163|Ga0070715_10322048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 835 | Open in IMG/M |
| 3300006175|Ga0070712_100889479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 767 | Open in IMG/M |
| 3300006176|Ga0070765_100388463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1301 | Open in IMG/M |
| 3300006176|Ga0070765_100667377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 982 | Open in IMG/M |
| 3300006574|Ga0074056_11673160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 585 | Open in IMG/M |
| 3300006804|Ga0079221_11645156 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300006806|Ga0079220_10373766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 918 | Open in IMG/M |
| 3300006806|Ga0079220_10558927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 801 | Open in IMG/M |
| 3300006845|Ga0075421_100337898 | All Organisms → cellular organisms → Bacteria | 1822 | Open in IMG/M |
| 3300006847|Ga0075431_100739410 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300006852|Ga0075433_10834713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 805 | Open in IMG/M |
| 3300006854|Ga0075425_102145427 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300006854|Ga0075425_102977268 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300006893|Ga0073928_11123190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 532 | Open in IMG/M |
| 3300006904|Ga0075424_100046006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4551 | Open in IMG/M |
| 3300006914|Ga0075436_100457931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 929 | Open in IMG/M |
| 3300006954|Ga0079219_11641776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 592 | Open in IMG/M |
| 3300006954|Ga0079219_12060380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 545 | Open in IMG/M |
| 3300007076|Ga0075435_101460503 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300007788|Ga0099795_10325291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 682 | Open in IMG/M |
| 3300009038|Ga0099829_10294049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1331 | Open in IMG/M |
| 3300009090|Ga0099827_10548889 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300009137|Ga0066709_100797494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1368 | Open in IMG/M |
| 3300009137|Ga0066709_102021947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 798 | Open in IMG/M |
| 3300009148|Ga0105243_11518260 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300009157|Ga0105092_10411213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 770 | Open in IMG/M |
| 3300009698|Ga0116216_10013903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5069 | Open in IMG/M |
| 3300009698|Ga0116216_10622465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 650 | Open in IMG/M |
| 3300009792|Ga0126374_10766183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 733 | Open in IMG/M |
| 3300009810|Ga0105088_1020109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1041 | Open in IMG/M |
| 3300009839|Ga0116223_10681293 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300009840|Ga0126313_10917549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 715 | Open in IMG/M |
| 3300010040|Ga0126308_11219416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
| 3300010041|Ga0126312_11120503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 578 | Open in IMG/M |
| 3300010042|Ga0126314_10307577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1132 | Open in IMG/M |
| 3300010042|Ga0126314_10982426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 626 | Open in IMG/M |
| 3300010045|Ga0126311_11906858 | Not Available | 505 | Open in IMG/M |
| 3300010159|Ga0099796_10170959 | Not Available | 867 | Open in IMG/M |
| 3300010329|Ga0134111_10095766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1134 | Open in IMG/M |
| 3300010358|Ga0126370_10059404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 2474 | Open in IMG/M |
| 3300010366|Ga0126379_10338684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1529 | Open in IMG/M |
| 3300010366|Ga0126379_10536481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1247 | Open in IMG/M |
| 3300010366|Ga0126379_11257443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 846 | Open in IMG/M |
| 3300010366|Ga0126379_11842149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 709 | Open in IMG/M |
| 3300010371|Ga0134125_10844660 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300010371|Ga0134125_11089362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 875 | Open in IMG/M |
| 3300010371|Ga0134125_11411896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 759 | Open in IMG/M |
| 3300010375|Ga0105239_10597290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1259 | Open in IMG/M |
| 3300010396|Ga0134126_11455648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 756 | Open in IMG/M |
| 3300010401|Ga0134121_13160953 | Not Available | 508 | Open in IMG/M |
| 3300010403|Ga0134123_13328713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 519 | Open in IMG/M |
| 3300010876|Ga0126361_10286287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 967 | Open in IMG/M |
| 3300011107|Ga0151490_1358118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 587 | Open in IMG/M |
| 3300011119|Ga0105246_12071776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 551 | Open in IMG/M |
| 3300011270|Ga0137391_10129417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2194 | Open in IMG/M |
| 3300012096|Ga0137389_11753491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 517 | Open in IMG/M |
| 3300012201|Ga0137365_10073414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2580 | Open in IMG/M |
| 3300012202|Ga0137363_11459705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 575 | Open in IMG/M |
| 3300012203|Ga0137399_10558844 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300012203|Ga0137399_11656585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 528 | Open in IMG/M |
| 3300012204|Ga0137374_10709410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 754 | Open in IMG/M |
| 3300012207|Ga0137381_10713371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 871 | Open in IMG/M |
| 3300012207|Ga0137381_11486375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 569 | Open in IMG/M |
| 3300012209|Ga0137379_10692259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 925 | Open in IMG/M |
| 3300012209|Ga0137379_11014412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 735 | Open in IMG/M |
| 3300012209|Ga0137379_11736868 | Not Available | 520 | Open in IMG/M |
| 3300012210|Ga0137378_10159953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. | 2089 | Open in IMG/M |
| 3300012211|Ga0137377_10674702 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300012211|Ga0137377_11026482 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300012212|Ga0150985_108895265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 808 | Open in IMG/M |
| 3300012212|Ga0150985_108919535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
| 3300012349|Ga0137387_10346441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1076 | Open in IMG/M |
| 3300012350|Ga0137372_10010872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8737 | Open in IMG/M |
| 3300012350|Ga0137372_10247151 | All Organisms → cellular organisms → Bacteria | 1405 | Open in IMG/M |
| 3300012350|Ga0137372_10517490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 885 | Open in IMG/M |
| 3300012354|Ga0137366_10596890 | Not Available | 792 | Open in IMG/M |
| 3300012359|Ga0137385_11611702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 513 | Open in IMG/M |
| 3300012360|Ga0137375_10630810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 887 | Open in IMG/M |
| 3300012363|Ga0137390_10379863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1393 | Open in IMG/M |
| 3300012363|Ga0137390_10527549 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300012685|Ga0137397_10500576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 905 | Open in IMG/M |
| 3300012911|Ga0157301_10080571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 915 | Open in IMG/M |
| 3300012911|Ga0157301_10215928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 655 | Open in IMG/M |
| 3300012917|Ga0137395_11091949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 566 | Open in IMG/M |
| 3300012918|Ga0137396_10494872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 906 | Open in IMG/M |
| 3300012923|Ga0137359_11392012 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300012929|Ga0137404_12315763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 503 | Open in IMG/M |
| 3300012951|Ga0164300_10108457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1233 | Open in IMG/M |
| 3300012951|Ga0164300_10350682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 792 | Open in IMG/M |
| 3300012951|Ga0164300_10589160 | Not Available | 654 | Open in IMG/M |
| 3300012951|Ga0164300_10955350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
| 3300012951|Ga0164300_11036612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
| 3300012971|Ga0126369_10861623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 990 | Open in IMG/M |
| 3300012975|Ga0134110_10518433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
| 3300012985|Ga0164308_10349449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1193 | Open in IMG/M |
| 3300012985|Ga0164308_11273819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 666 | Open in IMG/M |
| 3300012985|Ga0164308_11600718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 601 | Open in IMG/M |
| 3300012985|Ga0164308_12033414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 536 | Open in IMG/M |
| 3300012986|Ga0164304_11039008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 651 | Open in IMG/M |
| 3300012989|Ga0164305_10624386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 869 | Open in IMG/M |
| 3300012989|Ga0164305_11194528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 659 | Open in IMG/M |
| 3300013096|Ga0157307_1107234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
| 3300013297|Ga0157378_10410690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1336 | Open in IMG/M |
| 3300014501|Ga0182024_10236893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2460 | Open in IMG/M |
| 3300014501|Ga0182024_10570014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1424 | Open in IMG/M |
| 3300014745|Ga0157377_10404027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea marina | 931 | Open in IMG/M |
| 3300015241|Ga0137418_11207643 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300015374|Ga0132255_103599378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 659 | Open in IMG/M |
| 3300016294|Ga0182041_10851158 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300016319|Ga0182033_10017647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4254 | Open in IMG/M |
| 3300017823|Ga0187818_10508508 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300017955|Ga0187817_10053380 | All Organisms → cellular organisms → Bacteria | 2494 | Open in IMG/M |
| 3300017965|Ga0190266_10536480 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300017965|Ga0190266_10689198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 636 | Open in IMG/M |
| 3300017994|Ga0187822_10229863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. WAC01280 | 630 | Open in IMG/M |
| 3300018034|Ga0187863_10005011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9332 | Open in IMG/M |
| 3300018071|Ga0184618_10070631 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
| 3300018076|Ga0184609_10352742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 686 | Open in IMG/M |
| 3300018081|Ga0184625_10404898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 703 | Open in IMG/M |
| 3300018422|Ga0190265_10962002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 976 | Open in IMG/M |
| 3300018422|Ga0190265_12575839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 606 | Open in IMG/M |
| 3300018429|Ga0190272_11720732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
| 3300018432|Ga0190275_12234691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 625 | Open in IMG/M |
| 3300018466|Ga0190268_10110918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1303 | Open in IMG/M |
| 3300018469|Ga0190270_12444586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 584 | Open in IMG/M |
| 3300018481|Ga0190271_13026703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
| 3300018920|Ga0190273_11703895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 569 | Open in IMG/M |
| 3300019259|Ga0184646_1087970 | Not Available | 581 | Open in IMG/M |
| 3300019356|Ga0173481_10422874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 658 | Open in IMG/M |
| 3300019377|Ga0190264_11519537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 583 | Open in IMG/M |
| 3300019884|Ga0193741_1121193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 662 | Open in IMG/M |
| 3300019890|Ga0193728_1198105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 845 | Open in IMG/M |
| 3300020582|Ga0210395_10087016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2305 | Open in IMG/M |
| 3300020582|Ga0210395_10542071 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300021073|Ga0210378_10400568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
| 3300021178|Ga0210408_10595990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 875 | Open in IMG/M |
| 3300021358|Ga0213873_10277034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 537 | Open in IMG/M |
| 3300021388|Ga0213875_10358200 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300021406|Ga0210386_10677878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 889 | Open in IMG/M |
| 3300021407|Ga0210383_11027074 | Not Available | 698 | Open in IMG/M |
| 3300021407|Ga0210383_11124526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 662 | Open in IMG/M |
| 3300021407|Ga0210383_11457025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 568 | Open in IMG/M |
| 3300021420|Ga0210394_11620146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 544 | Open in IMG/M |
| 3300021433|Ga0210391_10983538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 657 | Open in IMG/M |
| 3300021474|Ga0210390_11090932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 649 | Open in IMG/M |
| 3300021559|Ga0210409_11223163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
| 3300022714|Ga0242671_1023698 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300024331|Ga0247668_1123018 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300024347|Ga0179591_1050695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3354 | Open in IMG/M |
| 3300025588|Ga0208586_1123797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 548 | Open in IMG/M |
| 3300025604|Ga0207930_1018784 | All Organisms → cellular organisms → Bacteria | 1966 | Open in IMG/M |
| 3300025900|Ga0207710_10239021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 906 | Open in IMG/M |
| 3300025905|Ga0207685_10124954 | Not Available | 1135 | Open in IMG/M |
| 3300025910|Ga0207684_11709045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 507 | Open in IMG/M |
| 3300025915|Ga0207693_10331944 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300025915|Ga0207693_11019414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 631 | Open in IMG/M |
| 3300025922|Ga0207646_10158218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2044 | Open in IMG/M |
| 3300025928|Ga0207700_10188198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1733 | Open in IMG/M |
| 3300025928|Ga0207700_11655872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 565 | Open in IMG/M |
| 3300025934|Ga0207686_11425355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
| 3300025934|Ga0207686_11524953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. ov407 | 551 | Open in IMG/M |
| 3300025935|Ga0207709_10253084 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300025939|Ga0207665_11008615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 662 | Open in IMG/M |
| 3300025942|Ga0207689_11104902 | Not Available | 668 | Open in IMG/M |
| 3300025981|Ga0207640_10216579 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
| 3300025981|Ga0207640_10378621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1146 | Open in IMG/M |
| 3300026275|Ga0209901_1096710 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300026490|Ga0257153_1048534 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300026551|Ga0209648_10497290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 711 | Open in IMG/M |
| 3300027056|Ga0209879_1062704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 595 | Open in IMG/M |
| 3300027158|Ga0208725_1071648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
| 3300027401|Ga0208637_1016894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 782 | Open in IMG/M |
| 3300027681|Ga0208991_1024948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1806 | Open in IMG/M |
| 3300027765|Ga0209073_10237693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 704 | Open in IMG/M |
| 3300027775|Ga0209177_10188577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 726 | Open in IMG/M |
| 3300027795|Ga0209139_10095129 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300027862|Ga0209701_10220224 | Not Available | 1123 | Open in IMG/M |
| 3300027873|Ga0209814_10025352 | All Organisms → cellular organisms → Bacteria | 2425 | Open in IMG/M |
| 3300027875|Ga0209283_10447552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 837 | Open in IMG/M |
| 3300027889|Ga0209380_10305418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 934 | Open in IMG/M |
| 3300027903|Ga0209488_10352262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1094 | Open in IMG/M |
| 3300027903|Ga0209488_11008817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
| 3300027986|Ga0209168_10593589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
| 3300028047|Ga0209526_10670436 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300028379|Ga0268266_10499864 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300028380|Ga0268265_12381282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea marina | 536 | Open in IMG/M |
| 3300028381|Ga0268264_12142052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea marina | 567 | Open in IMG/M |
| 3300028592|Ga0247822_10366389 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300028710|Ga0307322_10211891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
| 3300028717|Ga0307298_10179878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 620 | Open in IMG/M |
| 3300028744|Ga0307318_10062821 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
| 3300028755|Ga0307316_10033805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1679 | Open in IMG/M |
| 3300028790|Ga0307283_10185943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora chokoriensis | 589 | Open in IMG/M |
| 3300028811|Ga0307292_10284542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 691 | Open in IMG/M |
| 3300028819|Ga0307296_10239266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 987 | Open in IMG/M |
| 3300028828|Ga0307312_10037597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 2848 | Open in IMG/M |
| 3300028828|Ga0307312_10768909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 638 | Open in IMG/M |
| 3300028875|Ga0307289_10275770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 692 | Open in IMG/M |
| 3300028881|Ga0307277_10225770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 824 | Open in IMG/M |
| 3300028906|Ga0308309_10392017 | Not Available | 1190 | Open in IMG/M |
| 3300028906|Ga0308309_11893250 | Not Available | 503 | Open in IMG/M |
| 3300029701|Ga0222748_1013834 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300030494|Ga0310037_10019125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3310 | Open in IMG/M |
| 3300031114|Ga0308187_10477251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
| 3300031170|Ga0307498_10174936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 731 | Open in IMG/M |
| 3300031543|Ga0318516_10282243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → environmental samples → uncultured Chloroflexota bacterium | 960 | Open in IMG/M |
| 3300031543|Ga0318516_10381810 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300031545|Ga0318541_10317422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 869 | Open in IMG/M |
| 3300031549|Ga0318571_10367231 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300031679|Ga0318561_10036230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2411 | Open in IMG/M |
| 3300031751|Ga0318494_10042422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2378 | Open in IMG/M |
| 3300031753|Ga0307477_10299987 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300031754|Ga0307475_11185806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 595 | Open in IMG/M |
| 3300031764|Ga0318535_10341788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 669 | Open in IMG/M |
| 3300031771|Ga0318546_10741766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 691 | Open in IMG/M |
| 3300031778|Ga0318498_10416511 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300031798|Ga0318523_10181348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1051 | Open in IMG/M |
| 3300031799|Ga0318565_10484565 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300031823|Ga0307478_10767947 | Not Available | 807 | Open in IMG/M |
| 3300031823|Ga0307478_11628424 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300031893|Ga0318536_10395968 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300031901|Ga0307406_11191449 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300031908|Ga0310900_10425712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1014 | Open in IMG/M |
| 3300031912|Ga0306921_10171345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2542 | Open in IMG/M |
| 3300031959|Ga0318530_10226780 | Not Available | 768 | Open in IMG/M |
| 3300032000|Ga0310903_10641797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 569 | Open in IMG/M |
| 3300032025|Ga0318507_10555069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 500 | Open in IMG/M |
| 3300032039|Ga0318559_10028895 | All Organisms → cellular organisms → Bacteria | 2198 | Open in IMG/M |
| 3300032041|Ga0318549_10526898 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300032064|Ga0318510_10019475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2141 | Open in IMG/M |
| 3300032067|Ga0318524_10275568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 868 | Open in IMG/M |
| 3300032205|Ga0307472_101955132 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300032261|Ga0306920_100260921 | All Organisms → cellular organisms → Bacteria | 2584 | Open in IMG/M |
| 3300032892|Ga0335081_10083754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4813 | Open in IMG/M |
| 3300032895|Ga0335074_10003308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 21956 | Open in IMG/M |
| 3300033158|Ga0335077_11500315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 645 | Open in IMG/M |
| 3300033289|Ga0310914_10151707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2044 | Open in IMG/M |
| 3300033550|Ga0247829_10017321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4465 | Open in IMG/M |
| 3300033551|Ga0247830_11154530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 618 | Open in IMG/M |
| 3300034818|Ga0373950_0118923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 583 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.44% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.15% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.57% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.57% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.21% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.21% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.84% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.47% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.47% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.47% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.10% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.10% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.10% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.10% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.10% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.10% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.74% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.74% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.74% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.74% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.74% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.74% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.74% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.74% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.74% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.74% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.37% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.37% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.37% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.37% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.37% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.37% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.37% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.37% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.37% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.37% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.37% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025588 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025604 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026275 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027158 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027401 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J35102_1183637951 | 3300002568 | Soil | VRRDVESGIASGEVRGTPTLFIDGVVHRGGYDTDALVKALSS* |
| JGI25382J43887_102464231 | 3300002908 | Grasslands Soil | SRDVRSGEASGEVRGTPTLFIDGVVLRGGYEVPTLLEALSR* |
| Ga0062389_1032608492 | 3300004092 | Bog Forest Soil | VRRDVDSGIASGKIRGTPTLFIDGVVHRGSYDPATLLRTLAR* |
| Ga0063356_1063902221 | 3300004463 | Arabidopsis Thaliana Rhizosphere | GRDVDSGTASGEIRGTPTLFIDGVVYRGSYDATALVEVLTR* |
| Ga0062595_1005730573 | 3300004479 | Soil | LRRIRRDIESGLASGKVHGTPTLFIDGLVHLGGYDVATMLEALSE* |
| Ga0062595_1010937563 | 3300004479 | Soil | RRVDRDVRSGIASGDVHGTPTLFIDGVVHLGSYDADTLADVLS* |
| Ga0066815_100412172 | 3300005164 | Soil | VADRIRRDVDSGLASDQVLGTPILFIDGLVHRGGYDPPALLAALAP* |
| Ga0070683_1014074002 | 3300005329 | Corn Rhizosphere | RDVESGLASGQVHGTPTLFIAGVVYRGPRDTAGLLEALAR* |
| Ga0070691_106551442 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | RIRRDVDSGLASDQVLGTPTLFIDGVVHRGGYDPPTLLTALAR* |
| Ga0070714_1000406142 | 3300005435 | Agricultural Soil | MHELLFLRRDVDSGLASGQVLGTPTLFIDGVVYRGGYDPPALLAALAA* |
| Ga0070714_1003236451 | 3300005435 | Agricultural Soil | RIQRDVDSGLASGQVLGTPTLFIDGAVHRRGYDPPTLLAALAV* |
| Ga0070714_1007379373 | 3300005435 | Agricultural Soil | RRDVDSGLASDQVLGTPTLFIDGLVHRGGYDPPALLAALAP* |
| Ga0070711_1013998172 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | RIRRDVDSGLASDQVLGTPTLFIDGLVHRGGYDPPALLAALAP* |
| Ga0066682_109672431 | 3300005450 | Soil | RDVESGIASGEVRGTPTLFIDGIVHLGGYDAATLMEALAG* |
| Ga0070678_1001484534 | 3300005456 | Miscanthus Rhizosphere | AVADRIRRDVDSGLASDQVLGTPTLFIDGLVHRGGYDPAALLAALAR* |
| Ga0070678_1012035763 | 3300005456 | Miscanthus Rhizosphere | RDVDSGLASDQVLGTPTLFIDGVVHRGGYDPPALLAALAP* |
| Ga0070662_1006069291 | 3300005457 | Corn Rhizosphere | VPGRIQRDVNSGLASGQVVGTPTLFIDGLVHSRGYDPPTLLAALAPA |
| Ga0070706_1021609742 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | DVESGRASGEVRGTPTLFIDGVVHRAGYDAETLMAALPG* |
| Ga0070731_109242711 | 3300005538 | Surface Soil | ALGRVRRDVESGIASGEVLGTPTLFIDGVVHRGGYDAVALLEALAR* |
| Ga0066707_103126422 | 3300005556 | Soil | SSGEASGEVRGTPTLFIDGAVHRGGYDVDSLLEVLA* |
| Ga0066670_102621883 | 3300005560 | Soil | EAVLERIGRDVRSGEASGEVLGTPTLFIDGFVHRGGYDVEMLLEALAA* |
| Ga0068855_1018071061 | 3300005563 | Corn Rhizosphere | EATGEVRGTPTLFIDGAVYRGAYDPRTLRGALAS* |
| Ga0066903_1008982774 | 3300005764 | Tropical Forest Soil | SGLASGEVLGTPTLFINGVAHRGGYDAATLLKALAP* |
| Ga0068858_1001616754 | 3300005842 | Switchgrass Rhizosphere | DSGLASDQVLGTPTLFIDGVVHRGGYDPPTLLTALAR* |
| Ga0068860_1022525822 | 3300005843 | Switchgrass Rhizosphere | RDRASGAVPGRIQRDVNSGLASGQVVGTPPVHRRRRARRGYDPPILLAALAPAR* |
| Ga0080026_100283921 | 3300005952 | Permafrost Soil | VNVLASGQVLGTPTLFIDGVVHRAGYDPPTLLAALAR* |
| Ga0066789_100171134 | 3300005994 | Soil | DSGLASGQVLGTPTLFIDGVVHRGGYDPPTLLAALAP* |
| Ga0066790_100017021 | 3300005995 | Soil | DVDSGLASGQVLGTPTLFIDGVVHRGGYDPAALLAALAP* |
| Ga0070717_119107763 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DSGLASGQVLGTPTLFIDGVVHRGGYDLPTLLAALAL* |
| Ga0066652_1009460501 | 3300006046 | Soil | DVESGIASGEVRGTPTLFIDGVVHRGSYDEATLLAALAR* |
| Ga0075024_1007238211 | 3300006047 | Watersheds | VLERVRRDVDSGIASGEVMGTPTLFIDGVVHRRSYDPATLIMTLAR* |
| Ga0075017_1016037941 | 3300006059 | Watersheds | VLERVRRDVDSGIASGEVRGTPTLFIDGVVHRGSYDAATLLRTLAR* |
| Ga0070715_103220481 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | DVDSGLASGQVLGTPTLFIDGVVHRRGYDPPTLLSALAASQ* |
| Ga0070712_1008894791 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VDSGLASGQVLGTPTLFIDGVVYRGGYDPPALLAALAP* |
| Ga0070765_1003884631 | 3300006176 | Soil | VDSGIASGEVMGTPTLFIDGVAYRRSYDPATLIMTLAR* |
| Ga0070765_1006673772 | 3300006176 | Soil | RASEVVLERVRRDVDSGIASGEVLGTPTLFIDGMVHQGGYDPATLIMTLAR* |
| Ga0074056_116731601 | 3300006574 | Soil | RDVDSGLASGQVLGTPTLFIDGVVHRGGYDPPTLLAALGP* |
| Ga0079221_116451562 | 3300006804 | Agricultural Soil | MVRQILACQRDVASGLASGQVLGTPTLFIDGVVHCVGYDPPTLLAALAP* |
| Ga0079220_103737663 | 3300006806 | Agricultural Soil | GLASGQVRGTPTLFIDGIVYRGGYDPLALLAALAL* |
| Ga0079220_105589272 | 3300006806 | Agricultural Soil | IRRDINSGLASGEVLGTPTLFINGVAHRDGYDAATLLKALAP* |
| Ga0075421_1003378982 | 3300006845 | Populus Rhizosphere | VASGQVLGTPTLFIEGIVHRGGDDPPAPLAALAP* |
| Ga0075431_1007394103 | 3300006847 | Populus Rhizosphere | RIRRDVDSGLASGQVLGTPTLFIDGIVHRGGDDPPAPLAALAP* |
| Ga0075433_108347131 | 3300006852 | Populus Rhizosphere | DSGLASGQVMGTPTSFIDGVVHRGGYDPPALLTALAR* |
| Ga0075425_1021454272 | 3300006854 | Populus Rhizosphere | RDRIDRDVASGEASGEVRGTPTLFLDGIVYRDPYDAGTLLEALAR* |
| Ga0075425_1029772681 | 3300006854 | Populus Rhizosphere | RVRRDVETGMASGEVRGTPTLFIDGVVHRGAYDTTALLEVLAG* |
| Ga0073928_111231902 | 3300006893 | Iron-Sulfur Acid Spring | VESGLASGQVLGTPTLFIDGAVHQGGYEAAVLLEALTR* |
| Ga0075424_1000460061 | 3300006904 | Populus Rhizosphere | SGLASGEVLGTPTLFIDGAVVPRPYDEATLLKALTD* |
| Ga0075436_1004579313 | 3300006914 | Populus Rhizosphere | RRDVDSGLASGQVLGTPTLFIASVVHRRGYDPPALLAALAASG* |
| Ga0079219_116417762 | 3300006954 | Agricultural Soil | ERIQRDVDSGLASGQVLGTPTLFIDGVVHRRSYDPPTLLAALAL* |
| Ga0079219_120603801 | 3300006954 | Agricultural Soil | RGGTSTFPGRNMVRQILACQRDVASGLASGQVLGTQTLFIDGVVHCVGYDPPTLLAALAP |
| Ga0075435_1014605032 | 3300007076 | Populus Rhizosphere | SGEASGEVRGTPTLYIDGVVYRGGYDAATLLEALTD* |
| Ga0099795_103252913 | 3300007788 | Vadose Zone Soil | DVDSGLASGQVLGTPTLFIDGVVHRGGYDPPALLAALAP* |
| Ga0099829_102940493 | 3300009038 | Vadose Zone Soil | VLGRVRRDVESGMASGEVLGTPTLFIDGVVHRGGYDAATLLEALAR* |
| Ga0099827_105488893 | 3300009090 | Vadose Zone Soil | RRDIDSGLASGEVRGTPTLFIDGVVHLGGYDAATLLKALTA* |
| Ga0066709_1007974943 | 3300009137 | Grasslands Soil | VRSGTASGEVLGTPTLFIDGVVHRAGYDLATLARAVGR* |
| Ga0066709_1020219474 | 3300009137 | Grasslands Soil | VASGQASGEVSGTPTLFIDGVVYLGGYDTATLMEALAA* |
| Ga0105243_115182601 | 3300009148 | Miscanthus Rhizosphere | RILRDVESGNKTGEILGTPTLFIDGVVYRGAYDADALLEVLRG* |
| Ga0105092_104112132 | 3300009157 | Freshwater Sediment | AVLERVRRDVRSGSATGQVRGTPTLFIDGVVHRGSYQAAALVEVLAPRLQPS* |
| Ga0116216_100139032 | 3300009698 | Peatlands Soil | VDSGLASGQVLGTPTLFIDGVVHCGGYDPPALLAALAR* |
| Ga0116216_106224651 | 3300009698 | Peatlands Soil | VDSGLASGQVLGTPTLFIDGVVHRGGYDPPTLLAALAP* |
| Ga0126374_107661832 | 3300009792 | Tropical Forest Soil | VESGIASGEVHGTPTLFIDGVVHRAGYDEETLFVAVGP* |
| Ga0105088_10201091 | 3300009810 | Groundwater Sand | IRRDVDSGLASGQVLGAPTLFIDGVVHRGGYDPPALLAALAP* |
| Ga0116223_106812932 | 3300009839 | Peatlands Soil | DSGLASGQVLGTPTLFIDGVVHRGGYDPPTLLAALAA* |
| Ga0126313_109175491 | 3300009840 | Serpentine Soil | LRRIRRAVEGGIASGDVQGTPTLFIDGVVRRRGYDAATLIDALAG* |
| Ga0126308_112194161 | 3300010040 | Serpentine Soil | MSTAATGEVLGTPTLFIDGVDHRGAYDADTLVEVMTR* |
| Ga0126312_111205033 | 3300010041 | Serpentine Soil | ARIRLDVESGLATGEVLGTPTLFIDGVVHRGPDDAASLLLEVNVS* |
| Ga0126314_103075772 | 3300010042 | Serpentine Soil | MPTAATGEVLGTPTLFIDGVDHRGAYDADTLVEVMTR* |
| Ga0126314_109824262 | 3300010042 | Serpentine Soil | MGSRDVDSGMASGQVRGTPTLFIDGIVHRGGYDAATLMEALAR* |
| Ga0126311_119068582 | 3300010045 | Serpentine Soil | RRDVESGLASGEVLGTPTLFIDGVVHRGSYDAASLVEEACLA* |
| Ga0099796_101709592 | 3300010159 | Vadose Zone Soil | RRDVDSGEASGEVWGTPTLFIDGVVHRGAYDAAVLLAALAR* |
| Ga0134111_100957662 | 3300010329 | Grasslands Soil | RDVESGIASGEVQGTPTLFIDGVVHLGGYDAATLTEALAG* |
| Ga0126370_100594041 | 3300010358 | Tropical Forest Soil | DSGLASRQVLGTPTLFIDGVVHRGGYDPPTLLAALGP* |
| Ga0126379_103386841 | 3300010366 | Tropical Forest Soil | TGLASDQVLGTPTLFIDGVVHRGGYDPFTLLAALAR* |
| Ga0126379_105364811 | 3300010366 | Tropical Forest Soil | IRRDINSGLASGEVLGTPTLFINAVAHRGGYDAATLLKALAP* |
| Ga0126379_112574431 | 3300010366 | Tropical Forest Soil | RRDVDSGLASGQVLGTPTLFIDGVVHRGGYDPPTLLAALGP* |
| Ga0126379_118421491 | 3300010366 | Tropical Forest Soil | INSGLASGEVLGTPTLFINGAAHRGGYDAATLLKALAR* |
| Ga0134125_108446601 | 3300010371 | Terrestrial Soil | IRRDVDSGLASDQVLGTPTLFIDGLVHRGGYDPPALLAALAR* |
| Ga0134125_110893623 | 3300010371 | Terrestrial Soil | RIRRDVDSGVASGEVHGTPTLFIDGRIHRGDYAAATLMEALAR* |
| Ga0134125_114118962 | 3300010371 | Terrestrial Soil | IRRDVDSGLASDQVLGTPTLFIDGLVHRGGYDPPALLAALAP* |
| Ga0105239_105972903 | 3300010375 | Corn Rhizosphere | EASGEVLGTPTLFIDGVVHRGAYDTAALMEALAS* |
| Ga0134126_114556481 | 3300010396 | Terrestrial Soil | RVLRRVARDMSSGIDSGEVLGTPTLFIDGAVHAGGYDAATLLAALGVA* |
| Ga0134121_131609531 | 3300010401 | Terrestrial Soil | TAVAYRIRRYVPSVLPSRQLLGTPTLFIAGVVHRGGYDPPTLLAALAP* |
| Ga0134123_133287131 | 3300010403 | Terrestrial Soil | LARIRRDVESGRASGEVRGTPTLFIDGVVHRGGYEAATLMDALGA* |
| Ga0126361_102862872 | 3300010876 | Boreal Forest Soil | ERIQRDVDSGLASGQVLGTPTLFIDGIVHRGGYDPPVLLAALAP* |
| Ga0151490_13581182 | 3300011107 | Soil | LASGQVLGTPTLFIDGIVHRGGYDPPALLAALAP* |
| Ga0105246_120717761 | 3300011119 | Miscanthus Rhizosphere | LASDQVLGTPTLFIDGVVHRGGYDPPALLAALVIRGPG* |
| Ga0137391_101294175 | 3300011270 | Vadose Zone Soil | DVDSGLASGQVLGTPTLFIDGVVHRGGYDPPALLAALARWR* |
| Ga0137389_117534911 | 3300012096 | Vadose Zone Soil | DVVLERVRRDVDSGIASGQVRGTPTLFIDGMVHRASYDAATLLRTLGG* |
| Ga0137365_100734144 | 3300012201 | Vadose Zone Soil | MASGDVLGTPTLFVDGIVHRAGYDAATLLEALAR* |
| Ga0137363_114597051 | 3300012202 | Vadose Zone Soil | SIGVGDRIRRDVGSGLASGQVVRTPTLFIDGVVHRGGYDPPTLLAALAS* |
| Ga0137399_105588441 | 3300012203 | Vadose Zone Soil | RRDAGSGLASGQVAGTPTLFIDGVVHRGGYDPPALLAALARWR* |
| Ga0137399_116565851 | 3300012203 | Vadose Zone Soil | RIQRDVDSGLASGQVLGTPTLFIDGVVHRRGYDPPTLLAALAA* |
| Ga0137374_107094102 | 3300012204 | Vadose Zone Soil | FDQDRFSSEVLGRVGRDVASGLASGEVRGTPTLFIDGVVHAGGYDEPTLIEALAV* |
| Ga0137381_107133711 | 3300012207 | Vadose Zone Soil | RRDVDSGLASGQVLGTPTLFIDGVVHRRGYDPPTLLAALAP* |
| Ga0137381_114863751 | 3300012207 | Vadose Zone Soil | DSGLASGQVVGTPTLFIDGVVHRGGYDPPTLLAALAP* |
| Ga0137379_106922593 | 3300012209 | Vadose Zone Soil | LASGQVAGTPTLFIDGVVHRGGYDPPTLLTALAP* |
| Ga0137379_110144121 | 3300012209 | Vadose Zone Soil | RDINSGLASGEVLGTPALFINGVAHRGGYDAATLLKALAPGT* |
| Ga0137379_117368681 | 3300012209 | Vadose Zone Soil | RDVDSGLASGQVLGIPTLFVDDVVHRGGYDPPTLLAALAP* |
| Ga0137378_101599531 | 3300012210 | Vadose Zone Soil | SGRASGQVLGTPTLFIEGVVHRGGYDPPTLLAALGP* |
| Ga0137377_106747021 | 3300012211 | Vadose Zone Soil | LASGQVLGTPTLFIDGVVHRRGYDPPTLLAALAP* |
| Ga0137377_110264822 | 3300012211 | Vadose Zone Soil | VVRRGVRRDVRSGTASGEVLGTPTLFIDGVVHRAGYDLATLARAVAR* |
| Ga0150985_1088952651 | 3300012212 | Avena Fatua Rhizosphere | GVLARIRRDVESGIATGEILGTPTMFIDGVVHRGSYDAASLLQEVTVP* |
| Ga0150985_1089195352 | 3300012212 | Avena Fatua Rhizosphere | DLGQVRGTPTLFIDGVLHQGGHDPASLLEALRTRA* |
| Ga0137387_103464412 | 3300012349 | Vadose Zone Soil | ARVLERVDRDVQSGIASGEVGGTPTLFIDGVVHRGSYDTAALLQALAG* |
| Ga0137372_1001087215 | 3300012350 | Vadose Zone Soil | VESGMASGQVRGTPTLFIDGVVHRGGYDAAALLEALAG* |
| Ga0137372_102471511 | 3300012350 | Vadose Zone Soil | LASGQVLGTPTLFIDGVVHRGGYDPPTLLAALATSD* |
| Ga0137372_105174901 | 3300012350 | Vadose Zone Soil | VLGRVRRDVDSGIASGAVRGTPVLFIDGVVHGGGYDAAVLLAALAR* |
| Ga0137366_105968902 | 3300012354 | Vadose Zone Soil | SSLASGQVLGTPTLFINGVVHRGGYDPPTLLAALGP* |
| Ga0137385_116117022 | 3300012359 | Vadose Zone Soil | RIERDRASGEASGEVQGTPTLFIDGVVHRGGYDAATLIEELAG* |
| Ga0137375_106308102 | 3300012360 | Vadose Zone Soil | ERIRRDVDSGLASGQVLGTPTLFIDGIVYRGGYDPPALLAALAP* |
| Ga0137390_103798631 | 3300012363 | Vadose Zone Soil | DVRSGEASGEVRGTPTLFIDGVVYRGGYDVPTLLEALS* |
| Ga0137390_105275491 | 3300012363 | Vadose Zone Soil | LASGQVVGTPTLFIDGVVHRGGYDPPALLAALAP* |
| Ga0137397_105005763 | 3300012685 | Vadose Zone Soil | RIRRDVGSGLASGQVVRTPTLFIDGVVHRGGYDPPTLLAALAP* |
| Ga0157301_100805711 | 3300012911 | Soil | ERVRRDVESGIASGEVLGTPTLFIDGVVYRGDYDAATLLEAIGGP* |
| Ga0157301_102159283 | 3300012911 | Soil | GLASGEVLGTPTLFIDGTVHRGPYDAASLLQEVTVS* |
| Ga0137395_110919491 | 3300012917 | Vadose Zone Soil | DVESGMASGEVLGTPTLFIDGVVHRGGYDAATLLEALAR* |
| Ga0137396_104948722 | 3300012918 | Vadose Zone Soil | DSGIASGEVQGTPTLFIDGVVHRDGYDAATLLEALAR* |
| Ga0137359_113920121 | 3300012923 | Vadose Zone Soil | SGIASGDVRSTPTLFIDGVVHTGGYDAETLLEALT* |
| Ga0137404_123157632 | 3300012929 | Vadose Zone Soil | MWTAAWASGQVLGTPTLFIDGIVYRGGYDPPALLAALAP* |
| Ga0164300_101084571 | 3300012951 | Soil | RSGMESGEVRGTPTLFIDGAVHLGAYDLDTLREAMTRP* |
| Ga0164300_103506822 | 3300012951 | Soil | MQTGEVRGTPTLFTDGIVHRGGYDARTLLEALAE* |
| Ga0164300_105891601 | 3300012951 | Soil | DRTSGEATGEVQGTPTLFLDGVVHRGGYEVSTLVEALAR* |
| Ga0164300_109553501 | 3300012951 | Soil | RDMQSGAASGEVRGTPTLFIDGVVHRGDPRVAALLEALA* |
| Ga0164300_110366123 | 3300012951 | Soil | GEASGEVLGTPTPFIDGVVHRGGYDTAALMEALAS* |
| Ga0126369_108616231 | 3300012971 | Tropical Forest Soil | RDVDSGLASGQVLGTPTLFIDGVVHRGGYDPPALLAALAP* |
| Ga0134110_105184333 | 3300012975 | Grasslands Soil | VERDVASGEASGVVLGTPTLFIDGIVYRGGYDAPTLLRALGG* |
| Ga0164308_103494491 | 3300012985 | Soil | ERVLDRIRRDVDSGVGSGEVLGTPTLFIDGVVYRDAYDADRLLDALR* |
| Ga0164308_112738192 | 3300012985 | Soil | VLGRVRRDVESGEASGEVRGTPTLYIDGIVYRGGYDAAALLEALTD* |
| Ga0164308_116007182 | 3300012985 | Soil | DVESGLATGAVRGTPTLFIDGVVHLGGYDAPALLEALA* |
| Ga0164308_120334141 | 3300012985 | Soil | VDSGLASGQVLGTPTLFIDGVVHRGGYDPPTLLAALGQ* |
| Ga0164304_110390081 | 3300012986 | Soil | RISDPVLNRIRRDVSSGEASGEVRGTPTLFIDGAVHRGGYDVDSLLEALA* |
| Ga0164305_106243862 | 3300012989 | Soil | RAGDVVLARIRRDVESGLETGEVLGTPTMFIDGDVHRGPYDAAALLQAIEAG* |
| Ga0164305_111945282 | 3300012989 | Soil | VNSGLSSGQVLGTPTLFIDGVVHRGGYDRPAMLAALAP* |
| Ga0157307_11072342 | 3300013096 | Soil | VLGRIQRDVNSGLASGQVVGTPTLFIDGLVHSRGYDPPTLLAALAPAR* |
| Ga0157378_104106903 | 3300013297 | Miscanthus Rhizosphere | VRSGVASGEVQGTPTIFIDGVVYRDGYDTETLLDVLAR* |
| Ga0182024_102368931 | 3300014501 | Permafrost | IQRDVDSGLASGQVLGTPTLFIDGVVHRGGYDPLTLLAALAP* |
| Ga0182024_105700141 | 3300014501 | Permafrost | TVLERIQRDVDSGLASGQVLGTPTLFIDGVVHRGDYNPPTLLAALAPSK* |
| Ga0157377_104040273 | 3300014745 | Miscanthus Rhizosphere | DRIRRDVESGVAGGEVRGTPTLFIDGLVPRGSYDAPTLLTAPAARR* |
| Ga0137418_112076432 | 3300015241 | Vadose Zone Soil | DRTGTEVLGRIARDVESGMASGEVQGTPTLFIDGVVHLGGYDAATLLEALGR* |
| Ga0132255_1035993782 | 3300015374 | Arabidopsis Rhizosphere | DVDSGLASGQVLGTPTLYIDGVVHRGGYDPPTLLAALASSE* |
| Ga0182041_108511581 | 3300016294 | Soil | MSSGIASGQVLGTPTLFIDGVVHAGGYDAQSLIDALTHT |
| Ga0182033_100176471 | 3300016319 | Soil | SGLASGEVLGTPTLFINGAAHRGGYDAATLLKALAP |
| Ga0187818_105085082 | 3300017823 | Freshwater Sediment | DVDSGLASGQVLGTPTLFIDGVVHRGGYDPPALLAALAP |
| Ga0187817_100533801 | 3300017955 | Freshwater Sediment | RDVDSGLASGQVLGTPTLFIDGVVHRGGYDPPALLAALAR |
| Ga0190266_105364801 | 3300017965 | Soil | GRVRRDMESGMASGEVLGTPTLFIDGVVYRGDYDTATLLDVLARP |
| Ga0190266_106891982 | 3300017965 | Soil | AVAERIRRDVDSGLASGQVLGTPTLFIDGIVHRGGYDPRALLAALSP |
| Ga0187822_102298631 | 3300017994 | Freshwater Sediment | GLDSGQVLGTPTLFIDGVVHRGGYDPPALLAALARFR |
| Ga0187863_1000501113 | 3300018034 | Peatland | VLERIQRDVDSGLASGQVLGTPTLFIDGVVHRDGYDPLTLLAALAP |
| Ga0184618_100706313 | 3300018071 | Groundwater Sediment | QRDVNSGLASGQVVGTPTLFIDGIVHRRGYDPPTLLAALARAR |
| Ga0184609_103527421 | 3300018076 | Groundwater Sediment | RDVDSGLASGQVLGTPTLFIDGIVHRGGYDPPALLAALAP |
| Ga0184625_104048982 | 3300018081 | Groundwater Sediment | GMASREVRGTPTLFIDGIVHRGGYDAAALLEALATTGARG |
| Ga0190265_109620023 | 3300018422 | Soil | RDVQSGMATGEVLGTPTLFIDGAVHRGGYDAATLLEALAR |
| Ga0190265_125758392 | 3300018422 | Soil | VRRDVRSGSATGQVTGTPTLFIDGVVHRGSYQAAALLEVLAPRLQSS |
| Ga0190272_117207321 | 3300018429 | Soil | AVLARVRRDVLSGMTTGEVRGTPTLFIDGAVHRGGYDAATLLEALAR |
| Ga0190275_122346911 | 3300018432 | Soil | SGLATGEVLGTPTIFIDGVVHRGSYEAASLLQEVTVP |
| Ga0190268_101109181 | 3300018466 | Soil | DVLSGMTTGEVRGTPTLFIDGAVHRGGYDAATLLEALAR |
| Ga0190270_124445862 | 3300018469 | Soil | AARIRRDVDSGMASGQVLGTPTLFIDGIAHRRGYDPPTLLAALAPAR |
| Ga0190271_130267033 | 3300018481 | Soil | DSGTASGELRGTPTLFIDGVVHLGGYDAATLLEALTQ |
| Ga0190273_117038951 | 3300018920 | Soil | DMAGDEVLARIRRDVDSGLATGEVQGTPTLFIDGVVHRSAYDADALMEALAR |
| Ga0184646_10879702 | 3300019259 | Groundwater Sediment | RRDVESGIASGEVRGTPTLFIDGVVHLGAYDAATLLEALVR |
| Ga0173481_104228742 | 3300019356 | Soil | VSSGESSGEVRGTPTLFIDGAVHRGGYDVDSLLEALA |
| Ga0190264_115195371 | 3300019377 | Soil | DIRSGSATGQVTGTPTLFIDGVVHRGSYTAAALLDVLAPRLKAS |
| Ga0193741_11211931 | 3300019884 | Soil | RVRRDVQSGLASGEVRGTPTLFIDGVVHRGGYDAATLLEVLAG |
| Ga0193728_11981052 | 3300019890 | Soil | RIRRDVDSGLASGQVLGTPTLFIDGVVHRGGYDPPTLLAVLAP |
| Ga0210395_100870165 | 3300020582 | Soil | DSGRATGEVLGTPTLFIDGAVHRGGYDPPTLLAALAS |
| Ga0210395_105420711 | 3300020582 | Soil | VGSGQASGEVRGTPTLFIDGVVPRGGFAASASLEVLAR |
| Ga0210378_104005681 | 3300021073 | Groundwater Sediment | GLARIRRDVESGTASGQVQGTPTLFIDGVVHRGAYDAGALLEALAR |
| Ga0210408_105959901 | 3300021178 | Soil | VDSGLASGQVLGTPTLFIDGVVHRGGYDPPALLAALARWR |
| Ga0213873_102770341 | 3300021358 | Rhizosphere | WESDLVLERIRRDVCSGDASGEVLGTPTLFIDGVLHRNGYDPASLREALSR |
| Ga0213875_103582003 | 3300021388 | Plant Roots | RFEDERESDVVLERIRRDVRSGDASGEVLGTPTLFIDGVLHPGGHDPESLREALSR |
| Ga0210386_106778782 | 3300021406 | Soil | GMASGQVLGIPTLFIDGVVHRGGYDPPALLTALAS |
| Ga0210383_110270741 | 3300021407 | Soil | RSLASGQVLGTPTLFIDGVLHRGGYDPHTLLPALDVLAP |
| Ga0210383_111245262 | 3300021407 | Soil | IRRDVDSGLASGQVVGTPTLFIDGVVHRGGYDPPTLLAALAP |
| Ga0210383_114570252 | 3300021407 | Soil | DSGLASGQVLGTPTLFIDGVVHRGGYDPPSLLAALAQ |
| Ga0210394_116201461 | 3300021420 | Soil | ASGQVLGTPTLFIDGVVHRGGYDPPALLAALARWR |
| Ga0210391_109835382 | 3300021433 | Soil | GLASGQVVDTPTLFIDGVVHRGGYDPPALLAALAP |
| Ga0210390_110909321 | 3300021474 | Soil | PLVLGRVQRDVKSGMASGEVLGTPTLFIDGVVHRGGYDTATLIEALAR |
| Ga0210409_112231632 | 3300021559 | Soil | DVDSGIASGEVWGTPTLFIDGVVHRGSYDPATLLSTLGR |
| Ga0242671_10236981 | 3300022714 | Soil | LASGQVLGTPTLFIDGVVYRGGYDPAALLAALATTR |
| Ga0247668_11230181 | 3300024331 | Soil | DVDSGLASDQVLGTPTLFIDGLVHRGGYDPPALLAALAP |
| Ga0179591_10506951 | 3300024347 | Vadose Zone Soil | LTAIASTVDVLGRVRRDVESGIATGEVQGTPTLFIDGVVHLGSYDASSLMEALAT |
| Ga0208586_11237971 | 3300025588 | Arctic Peat Soil | RRDIDSGLASGQVAGTPTLFIDGVVHRGGYDPPTLLAALAP |
| Ga0207930_10187841 | 3300025604 | Arctic Peat Soil | STAALERIQRDVDSGLASGRVLGTPTLFIDCVVHRGGYDPPALLAALAPAR |
| Ga0207710_102390211 | 3300025900 | Switchgrass Rhizosphere | VDSGLASDQVLGTPTLFIDGAVHRGGYDPPTLLTALAP |
| Ga0207685_101249541 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | RIQRDVDSGLASGQVLGTPTLFIDGVVHRGGYDPPTLLAALAR |
| Ga0207684_117090452 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | DVDSGLASGQVLGTPTLFIDGVVHRGGYDPSTLLAALPR |
| Ga0207693_103319441 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | RRDVDSGLASGQVLGTPTLFIDGVVHRGGYDPPALLAALAP |
| Ga0207693_110194142 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VNSGLSSGQVLGTPTLFIDGVVHRGGYDRPALLAALAR |
| Ga0207646_101582181 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LERVRRDVRSGIASGEVLGTPTLFIDGVVHGAGYDLATLARAVAR |
| Ga0207700_101881981 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MHELLFLRRDVDSGLASGQVLGTPTLFIDGVVYRGGYDPPALLAALAA |
| Ga0207700_116558721 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GLASGQVAGTPTLFIDGVVHRGGYDPPALLAALDR |
| Ga0207686_114253551 | 3300025934 | Miscanthus Rhizosphere | FEADRLSDPVLNRIRRDVSSGEASGEVRGTPTLFIDGAVHRGGYDVDSLLEALA |
| Ga0207686_115249532 | 3300025934 | Miscanthus Rhizosphere | GSGEASGEVLGTPTLFIDGVVHRGAYDTAALMEALAS |
| Ga0207709_102530841 | 3300025935 | Miscanthus Rhizosphere | VNSGLASGQVVGTPPVHRRRRARRGYDPPILLAALAPAR |
| Ga0207665_110086151 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | RTSERVLDRIRRDVDSGVASGEVLGTPTLFIDGVVYRDAYDADRLLDALR |
| Ga0207689_111049021 | 3300025942 | Miscanthus Rhizosphere | WRGTDVLARVCRDLGSGEASGEVLGTPTLFIDGVVHRGAYDTAALMEALAS |
| Ga0207640_102165793 | 3300025981 | Corn Rhizosphere | VDSGLASDQVLGTPTLFIDGVVHRGGYDPPTLLTALAR |
| Ga0207640_103786213 | 3300025981 | Corn Rhizosphere | SGLATGEVRGTPTLFVDGVVHAGGYDAASLAEAVGG |
| Ga0209901_10967101 | 3300026275 | Permafrost Soil | RIRRDAESGLASGAVHGTPTLFIDGLVHRGGYDPATLLEVLAK |
| Ga0257153_10485341 | 3300026490 | Soil | VDSGLASGQVLGTPTLFIDGVVYRGRYDPATLLTALAP |
| Ga0209648_104972903 | 3300026551 | Grasslands Soil | ASGLASGQVLGTPMLFIDGVVHRGGYDPPTLLAALTP |
| Ga0209879_10627042 | 3300027056 | Groundwater Sand | VDSGLASGQVLGAPTLFIDGVVHRSGYDPPALLAALAP |
| Ga0208725_10716481 | 3300027158 | Forest Soil | ARIRRDVHSGLASGQVLGTPTLFIDGVVYRGGYDPPALVAALATTR |
| Ga0208637_10168941 | 3300027401 | Soil | VADRIRRDVDSGLASDQVLGTPILFIDGLVHRGGYDPPALLA |
| Ga0208991_10249484 | 3300027681 | Forest Soil | DVRSGMATGEVRGTPTLFIDGVVHRGAYDGGTLMAALAR |
| Ga0209073_102376931 | 3300027765 | Agricultural Soil | LIRRDINSGLASGEVLGTPTLFINGVAHRDGYDAATLLKALAP |
| Ga0209177_101885772 | 3300027775 | Agricultural Soil | VNSGLSSGQVLGTPTLFIDGVVLRGGYDRPALLAALAR |
| Ga0209139_100951293 | 3300027795 | Bog Forest Soil | SGLASGQVVGTPTLFIDGVVHRGGYDPPTLLAVLAP |
| Ga0209701_102202243 | 3300027862 | Vadose Zone Soil | DSGLASGQVLGTPTLFIDGVVHRGGYDPPTLLAALGP |
| Ga0209814_100253521 | 3300027873 | Populus Rhizosphere | VAERIRRDVDSGLASGQVLGAPTLFIDGVVHRGGYDPPALLAALAP |
| Ga0209283_104475521 | 3300027875 | Vadose Zone Soil | RFEQDRTSAGVLGRIRRDVESGIASGELRGTPTLFIDGVVYRGGYNAATLLVALAR |
| Ga0209380_103054181 | 3300027889 | Soil | RDVASGLASGQVLGTPTLFIDGVVHRGGYDPPALLAALAAKAVMRSRSAR |
| Ga0209488_103522621 | 3300027903 | Vadose Zone Soil | VVLERVRRDVDSGIASGKVLGTPTLFIDGVVHRGSYDPATLLSTLAR |
| Ga0209488_110088173 | 3300027903 | Vadose Zone Soil | VDSGLASGQVLGTPALFIDGVVHRGGYDPPTLLAALAA |
| Ga0209168_105935891 | 3300027986 | Surface Soil | VLERVRRDVDSGIASGEVLGTPTLFIDGVVHRGDYDPATLIMTLAR |
| Ga0209526_106704361 | 3300028047 | Forest Soil | RSGIASGEVRGTPTLFINGVVHRAGYDAPTLLGVLAR |
| Ga0268266_104998643 | 3300028379 | Switchgrass Rhizosphere | RIRRDVDSGLASDQVLGTPTLFIDGLVHRGGYDPPALLAALAP |
| Ga0268265_123812821 | 3300028380 | Switchgrass Rhizosphere | RIRRDVESGVARGEVRGTPTLFIDGVVHRGSYDAPTLPTAPAARR |
| Ga0268264_121420521 | 3300028381 | Switchgrass Rhizosphere | VAGGEVRGTPTRFIDGVVHRGSYDAPTLLTAPSARR |
| Ga0247822_103663891 | 3300028592 | Soil | QRDVNSGLASGQVVGTPLFIDGVVHRRGYDPPILLAALAPAR |
| Ga0307322_102118912 | 3300028710 | Soil | RVQRDVDSGRASGEIQGTPTLFIDGVVHRGAYDAPGLMEALAR |
| Ga0307298_101798783 | 3300028717 | Soil | STGVLARIRRDVDSGLATGEILGTPTLFIDGVVHRGPHDAATLLQEVTNP |
| Ga0307318_100628213 | 3300028744 | Soil | VDSGLASGQVLGTPTLFIDGIVHRGGYDPRALLAALSP |
| Ga0307316_100338051 | 3300028755 | Soil | ESGMASGEVLGTPTLFIDGVVYRGGYDAATLLEAIGGP |
| Ga0307283_101859431 | 3300028790 | Soil | VLGRIQRDVYGGLASGQVVGTPTLFIDGVVHRRGYDPPTLLAALAPAR |
| Ga0307292_102845422 | 3300028811 | Soil | DMESGMASGEVLGTPTLFIDGVVYRGGYDAATLLEAIGGP |
| Ga0307296_102392661 | 3300028819 | Soil | VPGRIQRDVDSGLASGQVLGTPTLFIDGVVRRRGYDPPNLLATLAPSR |
| Ga0307312_100375973 | 3300028828 | Soil | VLGRIQRDVNGGLASGQVVGTPTLFIDGVVHRRGYDPPTLLAALAPAR |
| Ga0307312_107689092 | 3300028828 | Soil | SGLASGQVLGTPTLFIGGVVHRGGYDPPTLLAALAP |
| Ga0307289_102757702 | 3300028875 | Soil | RDVESGLASGEVLGTPTLFIDGVVHRGPYDAASLVEEVSLP |
| Ga0307277_102257703 | 3300028881 | Soil | ESGIATGEVLGTPTMFIDGVVLRGSFGADSLLEELNVHERLHPR |
| Ga0308309_103920173 | 3300028906 | Soil | VRRDVDSGIASGEVMGTPTLFIDGVAHRRSYDPATLIMTLAR |
| Ga0308309_118932501 | 3300028906 | Soil | ASDIVLERVRRDVDSGIASGEVMGTPTLFIDGVAYRRSYDPATLIMTLAR |
| Ga0222748_10138343 | 3300029701 | Soil | RRDVHSGLASGQVLGTPTLFIDGVVYRGGYDPPALVAALATTR |
| Ga0310037_100191255 | 3300030494 | Peatlands Soil | VDSGLASGQVLGTPTLFIDGVVHCGGYDPPALLAALAR |
| Ga0308187_104772511 | 3300031114 | Soil | SGMASGELRGTPTLFIDGVVHRGGYDAATLMEALAR |
| Ga0307498_101749364 | 3300031170 | Soil | DSGLASGQVLGTPTLFIDGVVHRGGYDPPTLLSALAP |
| Ga0318516_102822431 | 3300031543 | Soil | LERVERDVRSGAASGEVFGTPTLFIDGAIHRGDYNVDSLLEIIAG |
| Ga0318516_103818101 | 3300031543 | Soil | MSSGIASGQVLGTPTLFIDGAVHTGGYDLASLIDALSSDH |
| Ga0318541_103174223 | 3300031545 | Soil | DVDSGLASGQVLGTPTLFIDGVVHRGGYDPPTVLAALAAPR |
| Ga0318571_103672313 | 3300031549 | Soil | IRRDVDSGLASGQVLGTPTLFIDDVVHRGGYDPPTLLAALAR |
| Ga0318561_100362301 | 3300031679 | Soil | AGPLVLGGIRRDVNSGLASGEVLGTPTLFINGAAHRGGYDAATLLKALAP |
| Ga0318494_100424226 | 3300031751 | Soil | DVNSGLASGEVLGTPTLFINGAAHRGGYDAATLLKALAP |
| Ga0307477_102999871 | 3300031753 | Hardwood Forest Soil | ASGEVIGTPTLFIDGALHRGGYDATTLLSALARVREPTVKR |
| Ga0307475_111858062 | 3300031754 | Hardwood Forest Soil | IRRDVRSGIDSGDVLGTPTLFISGSLYVGPYDADTLTKALVT |
| Ga0318535_103417884 | 3300031764 | Soil | DVDSGLASGQVRGTPTLFIDGVVHCGGYDPPALLAALAR |
| Ga0318546_107417661 | 3300031771 | Soil | SGLASGQVLGTPTLFIDGVVHRGGYDPPALLAALA |
| Ga0318498_104165111 | 3300031778 | Soil | AVLRRVARDMSSGIASGQVLGTPTLFIDGAVHTGGYDLASLIDALSSDH |
| Ga0318523_101813483 | 3300031798 | Soil | NSGVASGEVLGTPTLFINGLAHRGGYDAATLLKALAP |
| Ga0318565_104845651 | 3300031799 | Soil | DMSSGIASGQVLGTPTLFIDGAVHTGGYDLASLIDALSSDH |
| Ga0307478_107679472 | 3300031823 | Hardwood Forest Soil | VAGRIRRDVDSGLASDQVLGTSALFIDGVFHRGGYDPPALLAALSL |
| Ga0307478_116284242 | 3300031823 | Hardwood Forest Soil | ASGVASGQVLGTPTLFIDGVVYRGGYDPPTLLAALTP |
| Ga0318536_103959682 | 3300031893 | Soil | VERIRRDVDSGVASGQVLGTPTLFIDGTVHRGGYDPPTLLAELAS |
| Ga0307406_111914492 | 3300031901 | Rhizosphere | VLARIRRDVDSGLATGEVQGTPTLFIDGVVHRGAYDTASLMEALDR |
| Ga0310900_104257121 | 3300031908 | Soil | DVDSGLASGQVLGTPTLFIDGVVHRRGYDPPTLLAALAPAR |
| Ga0306921_101713451 | 3300031912 | Soil | LASGEMLGTPALFINGAAHRGGYDAATLLKALAPRV |
| Ga0318530_102267802 | 3300031959 | Soil | LVLGGIRRDVNSGLASGEVLGTPTLFINGAAHRGGYDAATLLKALAP |
| Ga0310903_106417972 | 3300032000 | Soil | GRIQRDVNSGLASGQVVGTPLFIDGVVHRRGYDPPILLAALAPAR |
| Ga0318507_105550691 | 3300032025 | Soil | DVDSGLASGQVLGTPTLFIDGVVHRGGYDPPALLAALAR |
| Ga0318559_100288953 | 3300032039 | Soil | VDSGLASGQVLGTPTLFIDGVVHRGGYDPPALLAALAR |
| Ga0318549_105268981 | 3300032041 | Soil | LSSGIASGQVLGTPTLFIDGAVHTGGYDLASLIDALSSNH |
| Ga0318510_100194756 | 3300032064 | Soil | PLVLGGIRRDVNSGLASGEVLGTPTLFINGAAHRGGYDAATLLKALAP |
| Ga0318524_102755681 | 3300032067 | Soil | ARDFTSGLASGQVAGTPTLFIGGAVHLGSYDAQTLLEALTRATP |
| Ga0307472_1019551321 | 3300032205 | Hardwood Forest Soil | RIRRDVDSGLASDQVLGTPTLFIDGLVHRGGYDPPALLAALAR |
| Ga0306920_1002609215 | 3300032261 | Soil | RRDVDSGLASGQVLGTPTLFIDGVVHRGGYDPPALLAALAR |
| Ga0335081_100837541 | 3300032892 | Soil | VVLERIERDFRSGIESGEVRGTPTLFIDGVVHLGRYDAETLLALVKR |
| Ga0335074_100033089 | 3300032895 | Soil | VAERIDRDVQSGLASGRVLGTPTLFIKGIGYRGGYDPPALVAALAP |
| Ga0335077_115003152 | 3300033158 | Soil | RSGIESGEVQGTPTLFIDGVVYLGGYDAESILGVLTR |
| Ga0310914_101517071 | 3300033289 | Soil | IRRDVNSGLASGEVLGTPALFINGAAHRGGYDAATLLKALAPRV |
| Ga0247829_100173211 | 3300033550 | Soil | VNSSLASGQVVGTPLFIDGVVHRRGYDPPILLAALAPAR |
| Ga0247830_111545301 | 3300033551 | Soil | ALTVAVEPLDVESGLASGLVTGTPTLFIDGRVHRGAYDAPRLLEALGR |
| Ga0373950_0118923_1_126 | 3300034818 | Rhizosphere Soil | QRDVDSGLASGQVLGTPTLFIDGVVHRGGYDPPTLLAALAL |
| ⦗Top⦘ |