| Basic Information | |
|---|---|
| Family ID | F013367 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 272 |
| Average Sequence Length | 47 residues |
| Representative Sequence | ATHIAFWLGDGRILHSTEREGVDGVVEEAEPDDLRAQRRRLIRL |
| Number of Associated Samples | 219 |
| Number of Associated Scaffolds | 272 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.39 % |
| % of genes near scaffold ends (potentially truncated) | 93.01 % |
| % of genes from short scaffolds (< 2000 bps) | 87.87 % |
| Associated GOLD sequencing projects | 207 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.647 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.809 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.897 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.735 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.11% β-sheet: 23.61% Coil/Unstructured: 65.28% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 272 Family Scaffolds |
|---|---|---|
| PF00496 | SBP_bac_5 | 52.57 |
| PF13354 | Beta-lactamase2 | 5.51 |
| PF00196 | GerE | 4.41 |
| PF00962 | A_deaminase | 2.94 |
| PF12911 | OppC_N | 2.21 |
| PF00005 | ABC_tran | 2.21 |
| PF08352 | oligo_HPY | 1.47 |
| PF01966 | HD | 0.37 |
| PF01418 | HTH_6 | 0.37 |
| PF10099 | RskA | 0.37 |
| PF08402 | TOBE_2 | 0.37 |
| PF00877 | NLPC_P60 | 0.37 |
| COG ID | Name | Functional Category | % Frequency in 272 Family Scaffolds |
|---|---|---|---|
| COG1816 | Adenosine/6-amino-6-deoxyfutalosine deaminase | Nucleotide transport and metabolism [F] | 2.94 |
| COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 0.37 |
| COG1737 | DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domains | Transcription [K] | 0.37 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.01 % |
| Unclassified | root | N/A | 6.99 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig114969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 786 | Open in IMG/M |
| 2140918013|NODE_12823_length_4785_cov_9.453082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 4817 | Open in IMG/M |
| 2170459003|FZ032L002GJKN9 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
| 2170459009|GA8DASG01EUTHK | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 531 | Open in IMG/M |
| 2170459009|GA8DASG02FZLKA | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
| 3300000956|JGI10216J12902_110411596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 668 | Open in IMG/M |
| 3300001305|C688J14111_10247246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
| 3300001526|A105W1_1148141 | Not Available | 513 | Open in IMG/M |
| 3300002077|JGI24744J21845_10040146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 877 | Open in IMG/M |
| 3300002568|C688J35102_117734166 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300003203|JGI25406J46586_10108071 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300004081|Ga0063454_100172343 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300004114|Ga0062593_101538664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 719 | Open in IMG/M |
| 3300004114|Ga0062593_102120230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
| 3300004114|Ga0062593_103440848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
| 3300004153|Ga0063455_100234282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 945 | Open in IMG/M |
| 3300004157|Ga0062590_100260047 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1316 | Open in IMG/M |
| 3300004157|Ga0062590_100339175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1195 | Open in IMG/M |
| 3300004157|Ga0062590_101512264 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300004157|Ga0062590_101704150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 642 | Open in IMG/M |
| 3300004463|Ga0063356_101591747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 972 | Open in IMG/M |
| 3300004479|Ga0062595_101623199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 604 | Open in IMG/M |
| 3300005093|Ga0062594_100670566 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300005172|Ga0066683_10158690 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
| 3300005172|Ga0066683_10494025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 748 | Open in IMG/M |
| 3300005176|Ga0066679_10288869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1064 | Open in IMG/M |
| 3300005176|Ga0066679_10746704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 630 | Open in IMG/M |
| 3300005177|Ga0066690_10770739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 629 | Open in IMG/M |
| 3300005179|Ga0066684_10181931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1351 | Open in IMG/M |
| 3300005187|Ga0066675_11095210 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300005336|Ga0070680_101264627 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300005343|Ga0070687_101365243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 528 | Open in IMG/M |
| 3300005355|Ga0070671_100608966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 944 | Open in IMG/M |
| 3300005434|Ga0070709_10141306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1655 | Open in IMG/M |
| 3300005434|Ga0070709_11120152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 630 | Open in IMG/M |
| 3300005439|Ga0070711_100496842 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300005441|Ga0070700_101886948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
| 3300005446|Ga0066686_10796287 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300005447|Ga0066689_10555111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 726 | Open in IMG/M |
| 3300005451|Ga0066681_10797862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 570 | Open in IMG/M |
| 3300005451|Ga0066681_10991213 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300005458|Ga0070681_10704939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 925 | Open in IMG/M |
| 3300005467|Ga0070706_100045355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4061 | Open in IMG/M |
| 3300005468|Ga0070707_101337945 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300005468|Ga0070707_102343854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 501 | Open in IMG/M |
| 3300005518|Ga0070699_101164931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 707 | Open in IMG/M |
| 3300005539|Ga0068853_101932556 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300005540|Ga0066697_10445536 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300005545|Ga0070695_100863765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 729 | Open in IMG/M |
| 3300005549|Ga0070704_102275427 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300005553|Ga0066695_10741346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 572 | Open in IMG/M |
| 3300005558|Ga0066698_10743181 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300005559|Ga0066700_11062787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 530 | Open in IMG/M |
| 3300005561|Ga0066699_10451713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 920 | Open in IMG/M |
| 3300005561|Ga0066699_10713237 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300005576|Ga0066708_10458483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 819 | Open in IMG/M |
| 3300005587|Ga0066654_10216291 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300005598|Ga0066706_10440324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1038 | Open in IMG/M |
| 3300005614|Ga0068856_100731359 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300005614|Ga0068856_101975632 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300005719|Ga0068861_100024766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4344 | Open in IMG/M |
| 3300005764|Ga0066903_102090416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1090 | Open in IMG/M |
| 3300005764|Ga0066903_108764768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
| 3300006034|Ga0066656_10154899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1435 | Open in IMG/M |
| 3300006034|Ga0066656_11143465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
| 3300006046|Ga0066652_101906099 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300006049|Ga0075417_10395628 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300006059|Ga0075017_100946119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 670 | Open in IMG/M |
| 3300006102|Ga0075015_100610050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 640 | Open in IMG/M |
| 3300006163|Ga0070715_10463928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 718 | Open in IMG/M |
| 3300006163|Ga0070715_10514709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 687 | Open in IMG/M |
| 3300006163|Ga0070715_10519681 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300006173|Ga0070716_100485358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 908 | Open in IMG/M |
| 3300006175|Ga0070712_100127592 | All Organisms → cellular organisms → Bacteria | 1924 | Open in IMG/M |
| 3300006175|Ga0070712_100191708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1600 | Open in IMG/M |
| 3300006175|Ga0070712_100388915 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300006579|Ga0074054_10263772 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300006605|Ga0074057_10812048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 610 | Open in IMG/M |
| 3300006794|Ga0066658_10173622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1118 | Open in IMG/M |
| 3300006854|Ga0075425_101291360 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300006904|Ga0075424_100167924 | All Organisms → cellular organisms → Bacteria | 2327 | Open in IMG/M |
| 3300006953|Ga0074063_13589701 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300007255|Ga0099791_10451409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 622 | Open in IMG/M |
| 3300009012|Ga0066710_101591090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1002 | Open in IMG/M |
| 3300009012|Ga0066710_104187577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 539 | Open in IMG/M |
| 3300009090|Ga0099827_11411327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 606 | Open in IMG/M |
| 3300009093|Ga0105240_11223771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 794 | Open in IMG/M |
| 3300009137|Ga0066709_100977055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1238 | Open in IMG/M |
| 3300009137|Ga0066709_101615890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 927 | Open in IMG/M |
| 3300009137|Ga0066709_102240031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
| 3300009137|Ga0066709_104366659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
| 3300009840|Ga0126313_11185283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 629 | Open in IMG/M |
| 3300010039|Ga0126309_10317771 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300010044|Ga0126310_10696756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 769 | Open in IMG/M |
| 3300010045|Ga0126311_11657032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 539 | Open in IMG/M |
| 3300010120|Ga0127451_1031216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1216 | Open in IMG/M |
| 3300010145|Ga0126321_1339121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 632 | Open in IMG/M |
| 3300010147|Ga0126319_1123571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 820 | Open in IMG/M |
| 3300010166|Ga0126306_11807045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 3300010303|Ga0134082_10285895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 689 | Open in IMG/M |
| 3300010320|Ga0134109_10433784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
| 3300010320|Ga0134109_10497153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 503 | Open in IMG/M |
| 3300010322|Ga0134084_10248473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 641 | Open in IMG/M |
| 3300010322|Ga0134084_10380803 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300010326|Ga0134065_10321106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 599 | Open in IMG/M |
| 3300010335|Ga0134063_10233478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 872 | Open in IMG/M |
| 3300010371|Ga0134125_10402285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1518 | Open in IMG/M |
| 3300010371|Ga0134125_10938000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Phytoactinopolyspora → Phytoactinopolyspora mesophila | 950 | Open in IMG/M |
| 3300010371|Ga0134125_13017740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
| 3300010373|Ga0134128_10094105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 3408 | Open in IMG/M |
| 3300010373|Ga0134128_12294659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
| 3300010403|Ga0134123_11608781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 698 | Open in IMG/M |
| 3300010999|Ga0138505_100025898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 777 | Open in IMG/M |
| 3300011971|Ga0120175_1026313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 696 | Open in IMG/M |
| 3300011994|Ga0120157_1022262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1523 | Open in IMG/M |
| 3300012011|Ga0120152_1164393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 578 | Open in IMG/M |
| 3300012014|Ga0120159_1087299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 910 | Open in IMG/M |
| 3300012200|Ga0137382_10031296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3181 | Open in IMG/M |
| 3300012204|Ga0137374_10124551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2362 | Open in IMG/M |
| 3300012204|Ga0137374_10566496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 871 | Open in IMG/M |
| 3300012204|Ga0137374_10776305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 713 | Open in IMG/M |
| 3300012211|Ga0137377_10267118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1642 | Open in IMG/M |
| 3300012212|Ga0150985_102697952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1179 | Open in IMG/M |
| 3300012212|Ga0150985_105867711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1229 | Open in IMG/M |
| 3300012212|Ga0150985_115895016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 885 | Open in IMG/M |
| 3300012354|Ga0137366_10054914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium rutilum | 3051 | Open in IMG/M |
| 3300012355|Ga0137369_10014674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7580 | Open in IMG/M |
| 3300012355|Ga0137369_10534490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 824 | Open in IMG/M |
| 3300012358|Ga0137368_10093494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2356 | Open in IMG/M |
| 3300012358|Ga0137368_10924649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 529 | Open in IMG/M |
| 3300012360|Ga0137375_11018005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 650 | Open in IMG/M |
| 3300012382|Ga0134038_1280585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 521 | Open in IMG/M |
| 3300012469|Ga0150984_100529730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 595 | Open in IMG/M |
| 3300012532|Ga0137373_10746632 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300012893|Ga0157284_10193000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 608 | Open in IMG/M |
| 3300012917|Ga0137395_10425314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 953 | Open in IMG/M |
| 3300012929|Ga0137404_11738610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 579 | Open in IMG/M |
| 3300012930|Ga0137407_10590503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1042 | Open in IMG/M |
| 3300012931|Ga0153915_10638350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1227 | Open in IMG/M |
| 3300012948|Ga0126375_11862754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
| 3300012951|Ga0164300_11069869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
| 3300012960|Ga0164301_10663182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 779 | Open in IMG/M |
| 3300012960|Ga0164301_11900343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 503 | Open in IMG/M |
| 3300012961|Ga0164302_10510346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 851 | Open in IMG/M |
| 3300012971|Ga0126369_12354411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 619 | Open in IMG/M |
| 3300012971|Ga0126369_12765939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 574 | Open in IMG/M |
| 3300012975|Ga0134110_10585194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300012987|Ga0164307_11642881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 544 | Open in IMG/M |
| 3300012989|Ga0164305_10693535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 831 | Open in IMG/M |
| 3300012989|Ga0164305_11177991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 663 | Open in IMG/M |
| 3300013100|Ga0157373_10885508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 662 | Open in IMG/M |
| 3300013307|Ga0157372_10448384 | Not Available | 1504 | Open in IMG/M |
| 3300013308|Ga0157375_12344892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 636 | Open in IMG/M |
| 3300013765|Ga0120172_1022937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1803 | Open in IMG/M |
| 3300013765|Ga0120172_1121044 | Not Available | 629 | Open in IMG/M |
| 3300014150|Ga0134081_10202451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 675 | Open in IMG/M |
| 3300014325|Ga0163163_11455749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 746 | Open in IMG/M |
| 3300014501|Ga0182024_12900283 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300014658|Ga0181519_10498673 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300014827|Ga0120171_1135153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 581 | Open in IMG/M |
| 3300014829|Ga0120104_1038511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 883 | Open in IMG/M |
| 3300014968|Ga0157379_12668266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
| 3300015077|Ga0173483_10350644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 741 | Open in IMG/M |
| 3300015203|Ga0167650_1011398 | All Organisms → cellular organisms → Bacteria | 2533 | Open in IMG/M |
| 3300015356|Ga0134073_10044832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1166 | Open in IMG/M |
| 3300015359|Ga0134085_10595269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
| 3300015371|Ga0132258_11380535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1780 | Open in IMG/M |
| 3300015371|Ga0132258_11493512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1707 | Open in IMG/M |
| 3300015372|Ga0132256_102513720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 616 | Open in IMG/M |
| 3300015372|Ga0132256_102649694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 601 | Open in IMG/M |
| 3300015373|Ga0132257_101125289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 992 | Open in IMG/M |
| 3300015374|Ga0132255_104060547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 621 | Open in IMG/M |
| 3300017947|Ga0187785_10155390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 964 | Open in IMG/M |
| 3300018027|Ga0184605_10383125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 631 | Open in IMG/M |
| 3300018032|Ga0187788_10246414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 707 | Open in IMG/M |
| 3300018071|Ga0184618_10506975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300018072|Ga0184635_10247073 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300018073|Ga0184624_10369086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 641 | Open in IMG/M |
| 3300018076|Ga0184609_10244367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 839 | Open in IMG/M |
| 3300018081|Ga0184625_10401032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 707 | Open in IMG/M |
| 3300018431|Ga0066655_10575246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 756 | Open in IMG/M |
| 3300018432|Ga0190275_10628705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1124 | Open in IMG/M |
| 3300018468|Ga0066662_11511012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 699 | Open in IMG/M |
| 3300019269|Ga0184644_1425727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3003 | Open in IMG/M |
| 3300019875|Ga0193701_1042961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 922 | Open in IMG/M |
| 3300019875|Ga0193701_1048218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 864 | Open in IMG/M |
| 3300019890|Ga0193728_1315404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 583 | Open in IMG/M |
| 3300020004|Ga0193755_1029946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1801 | Open in IMG/M |
| 3300020069|Ga0197907_10128391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1950 | Open in IMG/M |
| 3300020070|Ga0206356_11221494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 660 | Open in IMG/M |
| 3300020070|Ga0206356_11833208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 634 | Open in IMG/M |
| 3300020082|Ga0206353_10220498 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300020170|Ga0179594_10099370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1045 | Open in IMG/M |
| 3300021363|Ga0193699_10237229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 759 | Open in IMG/M |
| 3300021413|Ga0193750_1031455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1203 | Open in IMG/M |
| 3300021441|Ga0213871_10288432 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300021445|Ga0182009_10752885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 530 | Open in IMG/M |
| 3300022756|Ga0222622_10459584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 905 | Open in IMG/M |
| 3300025898|Ga0207692_10109759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1528 | Open in IMG/M |
| 3300025899|Ga0207642_10604386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 683 | Open in IMG/M |
| 3300025905|Ga0207685_10648213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
| 3300025906|Ga0207699_10116004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1724 | Open in IMG/M |
| 3300025906|Ga0207699_10972023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 627 | Open in IMG/M |
| 3300025910|Ga0207684_10547193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 990 | Open in IMG/M |
| 3300025922|Ga0207646_11932698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 502 | Open in IMG/M |
| 3300025927|Ga0207687_10184734 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300026023|Ga0207677_11602168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 603 | Open in IMG/M |
| 3300026067|Ga0207678_11110630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 700 | Open in IMG/M |
| 3300026075|Ga0207708_11888639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
| 3300026075|Ga0207708_11933647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300026078|Ga0207702_10681852 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300026078|Ga0207702_11851824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 595 | Open in IMG/M |
| 3300026301|Ga0209238_1042980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1643 | Open in IMG/M |
| 3300026317|Ga0209154_1016819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3469 | Open in IMG/M |
| 3300026323|Ga0209472_1308159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 508 | Open in IMG/M |
| 3300026326|Ga0209801_1035529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2335 | Open in IMG/M |
| 3300026552|Ga0209577_10123175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2073 | Open in IMG/M |
| 3300027862|Ga0209701_10032510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3384 | Open in IMG/M |
| 3300027873|Ga0209814_10393715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
| 3300028563|Ga0265319_1204593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 605 | Open in IMG/M |
| 3300028654|Ga0265322_10029575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1565 | Open in IMG/M |
| 3300028715|Ga0307313_10080436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 979 | Open in IMG/M |
| 3300028718|Ga0307307_10226249 | Not Available | 595 | Open in IMG/M |
| 3300028719|Ga0307301_10020139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1947 | Open in IMG/M |
| 3300028722|Ga0307319_10025623 | All Organisms → cellular organisms → Bacteria | 1814 | Open in IMG/M |
| 3300028754|Ga0307297_10141789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 815 | Open in IMG/M |
| 3300028784|Ga0307282_10071192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1581 | Open in IMG/M |
| 3300028787|Ga0307323_10113791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 972 | Open in IMG/M |
| 3300028787|Ga0307323_10144002 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300028791|Ga0307290_10284641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 605 | Open in IMG/M |
| 3300028793|Ga0307299_10354549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
| 3300028796|Ga0307287_10056909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1444 | Open in IMG/M |
| 3300028807|Ga0307305_10192940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 937 | Open in IMG/M |
| 3300028810|Ga0307294_10084771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 981 | Open in IMG/M |
| 3300028819|Ga0307296_10089468 | All Organisms → Viruses → Predicted Viral | 1645 | Open in IMG/M |
| 3300028828|Ga0307312_10500358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 802 | Open in IMG/M |
| 3300028828|Ga0307312_10705152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 668 | Open in IMG/M |
| 3300028878|Ga0307278_10268109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 757 | Open in IMG/M |
| 3300028881|Ga0307277_10140064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1045 | Open in IMG/M |
| 3300028884|Ga0307308_10031975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2450 | Open in IMG/M |
| 3300030511|Ga0268241_10048323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 907 | Open in IMG/M |
| 3300030511|Ga0268241_10102665 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300031058|Ga0308189_10421369 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300031092|Ga0308204_10007873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1820 | Open in IMG/M |
| 3300031242|Ga0265329_10294412 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300031521|Ga0311364_12419546 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300031670|Ga0307374_10671312 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300031716|Ga0310813_10532166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1031 | Open in IMG/M |
| 3300031938|Ga0308175_101519280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 748 | Open in IMG/M |
| 3300031938|Ga0308175_101805535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 685 | Open in IMG/M |
| 3300031938|Ga0308175_103019887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
| 3300031996|Ga0308176_11517621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 714 | Open in IMG/M |
| 3300032180|Ga0307471_104002004 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300033513|Ga0316628_100303420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1986 | Open in IMG/M |
| 3300033551|Ga0247830_10507296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 949 | Open in IMG/M |
| 3300033803|Ga0314862_0087079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 713 | Open in IMG/M |
| 3300034268|Ga0372943_0063990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2088 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.40% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.19% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.35% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.31% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.31% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.21% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.21% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.47% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.47% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.47% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.47% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.47% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.10% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.10% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.10% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.10% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.74% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.74% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.74% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.74% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.74% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.37% |
| Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment | 0.37% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.37% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.37% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.37% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.37% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.37% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.37% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.37% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.37% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.37% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.37% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.37% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.37% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.37% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.37% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.37% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.37% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.37% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.37% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.37% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001526 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-5cm-1A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Host-Associated | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003152 | Freshwater sediment microbial communities from Loktak Lake, India | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010120 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
| 3300011971 | Permafrost microbial communities from Nunavut, Canada - A7_80cm_12M | Environmental | Open in IMG/M |
| 3300011994 | Permafrost microbial communities from Nunavut, Canada - A7_65cm_12M | Environmental | Open in IMG/M |
| 3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012382 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300014827 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_18M | Environmental | Open in IMG/M |
| 3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015203 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021413 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1 | Environmental | Open in IMG/M |
| 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Host-Associated | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Host-Associated | Open in IMG/M |
| 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Host-Associated | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031200 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_S | Environmental | Open in IMG/M |
| 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Host-Associated | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_16413510 | 2124908045 | Soil | GDLITYGDEGGPDSATHIAFWLGEGRILHSTERDGVNGVVEEVEPTQLRALRRRLIRL |
| Iowa-Corn-GraphCirc_02739190 | 2140918013 | Soil | DHIAFWLGEGRILHSTGRDGGIGVVEEDEPASLRVRRRKLVRL |
| E4A_06687200 | 2170459003 | Grass Soil | GGGRILHSTRREGVDGVVEENEPQELRLRRRVFFRL |
| F47_11366550 | 2170459009 | Grass Soil | ATGADHIAFWLGKGRILHSTRRDGVDGVVEEKEPAELRSRRRHVFRF |
| F47_10582470 | 2170459009 | Grass Soil | DLVTYGDASADHVAFWLGEGRILHSTQREGANGVLEEAEPAELNARRRVIFRL |
| JGI10216J12902_1104115962 | 3300000956 | Soil | VSYGEERADHIAFSLGGGRILHSTQRDGIDGVIEEEEPTELRSRRRATFRL* |
| C688J14111_102472462 | 3300001305 | Soil | AFWLGGGRILHSTEREGVDGVVEEAEPEHLRRMRRRIVRL* |
| A105W1_11481411 | 3300001526 | Permafrost | IAFWVGEGGILHSTGRDDLGVVEEDEPESLRTRRRFLVRL* |
| JGI24744J21845_100401462 | 3300002077 | Corn, Switchgrass And Miscanthus Rhizosphere | TYGDEKAATHIAFWLGDGRILHSTERESVDGVVEEAEPPDLHAQRRRLIRF* |
| C688J35102_1177341661 | 3300002568 | Soil | YGDPHKPADHVAFWLGDGRILHSTQREGVNGVVEEHEPEYLKARRRGTFHL* |
| Ga0052254_10125431 | 3300003152 | Sediment | VDHVAFWLGDGAILHATGRAGFRCVVAEPEPEALRERRRGFRRL* |
| JGI25406J46586_101080712 | 3300003203 | Tabebuia Heterophylla Rhizosphere | RLGDLITYGDPGKEGATHIAFWLGDGRILHSTQREDADGVVEEREPDDLRARRRKVVRF* |
| soilH1_100894001 | 3300003321 | Sugarcane Root And Bulk Soil | DHVAFWLGGGRILHATGRQGVCAVVEEVEPPELGARRRRFLRF* |
| Ga0063454_1001723432 | 3300004081 | Soil | TYGDPDKPADHIAFWLGDERILHSTRREGVNGVVEEVEPAELRARRRKIVRL* |
| Ga0062593_1015386642 | 3300004114 | Soil | WLGEGRILHSTERDGANGVVEELEPDELRSKRRRLIRLSTAPH* |
| Ga0062593_1021202302 | 3300004114 | Soil | GDLITYGDEATTHIAFWLGEGRILHSTERDDVACVLEEPEPADLRTRRRALVRLQ* |
| Ga0062593_1034408482 | 3300004114 | Soil | AGSATHIAFWLGEGRILHSSERDGANGVVEELEPTPLRALRRRLIRL* |
| Ga0063455_1002342821 | 3300004153 | Soil | LITYADPGKPADHIAFWLGDGRILHSTSREGLGVNEEVEPESLRGRRRKLIRL* |
| Ga0062590_1002600472 | 3300004157 | Soil | DEATTHIAFWLGEGRILHSTERDDVACVLEEPEPADLRTRRRALVRLQ* |
| Ga0062590_1003391752 | 3300004157 | Soil | GQGEATTHIAFWLGDGRILHATDRDGVSRVLDELEPDELRSRRRRLVRL* |
| Ga0062590_1015122642 | 3300004157 | Soil | EGGDHATHIAFWLGDGRILHSTQREGVDGVVEEPEPPDLRGRRRMILRLQ* |
| Ga0062590_1017041502 | 3300004157 | Soil | NRTTHIAFWLGEGRILHSTERDDANGVVEELEPDELRSKRRRLIRLSTSPH* |
| Ga0063356_1015917472 | 3300004463 | Arabidopsis Thaliana Rhizosphere | FWLGDGWILHSTERYDANGVVEEREPADLHARRRRLVRF* |
| Ga0062595_1016231991 | 3300004479 | Soil | IAFWVGEGRILHSTGRENGIGVLEEEEPAYLRERRHKLVRL* |
| Ga0062594_1006705661 | 3300005093 | Soil | YGDADRATHIAFWLGDGRILHSTERDDANGVVEEPEPADLRARRRRLVRL* |
| Ga0066683_101586902 | 3300005172 | Soil | MARPALQPGDRVTYGEDDKATHIAFWMGDGRILHSTEREGVDGVVEELEPAHLRAQRRQLIRL* |
| Ga0066683_104940251 | 3300005172 | Soil | AFWLGDGRILHATQRDGVDGVVEEPEPDELRTKRRLFVRLSS* |
| Ga0066679_102888691 | 3300005176 | Soil | EKATHIAFWVGDGRILHSTERADVDGVVEEEEPRHLFAQRRRLIRL* |
| Ga0066679_107467041 | 3300005176 | Soil | ATHIAFWLGNGRILHSTQREGVDGVVEEEERAHLRAMRRCAIRI* |
| Ga0066690_107707392 | 3300005177 | Soil | DEHATTHVAFWLGNGWILHSTEREGVNGVVEEPEPEHLRKQRRRLVRF* |
| Ga0066684_101819311 | 3300005179 | Soil | FWLGDGRILHSTQREGVDGVVEEPEPDDLRTKRRRLVRLNP* |
| Ga0066675_110952101 | 3300005187 | Soil | GPADGRADHVAFWLGEGRILHATQRDGVERVIEEEEPEELQERRRMLFRF* |
| Ga0070680_1012646271 | 3300005336 | Corn Rhizosphere | GAADHVAFWLGDGRILHSTSREGADGVTEEVEPEELRARRRRTFRL* |
| Ga0070687_1013652432 | 3300005343 | Switchgrass Rhizosphere | GATEATHIAFWVGEGRVLHSTEREGVDGVVEEVEPDELRAQRRRLIRL* |
| Ga0070671_1006089662 | 3300005355 | Switchgrass Rhizosphere | DDRTTHIAFWLGEGRILHSTERDDANGVVEELEPDELRSKRRRLIRLSTSPH* |
| Ga0070709_101413061 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | AFWLGAGRILHSTQREGTDGVVEETEPEELAGMRRLIFRL* |
| Ga0070709_111201522 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | DHIAFWLGGGRILHATRRDDVDGVLEEPEPAELRARRRRLFRL* |
| Ga0070711_1004968422 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | HIAFWLGEGRIIHSTRREGTNGVLEEVEPAELSARRRLIFRL* |
| Ga0070700_1018869481 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | DLITYGDANGATHIAFWLGDGRILHSTERAGVDGVVEEPEPDELRLQRRRVIRL* |
| Ga0066686_107962871 | 3300005446 | Soil | VTYGDSERTTHIAFWLGEGRILHSTEREDVNGVIEEPEPAELLHKRRCFVRF* |
| Ga0066689_105551112 | 3300005447 | Soil | AFWLGDGRILHATERDGADGVVEEPEPDDLRAKRSHFVRLPA* |
| Ga0066681_107978621 | 3300005451 | Soil | THIAFWLGDGRILHSTEREDLACVLEEPEPVDLRSRRRRCLRL* |
| Ga0066681_109912131 | 3300005451 | Soil | DGRADHVAFWLGEGRILHATQRDGVDRVIEEEEPEELQERRRMLFRF* |
| Ga0070681_107049391 | 3300005458 | Corn Rhizosphere | SADHVAFWLGNGRILHSTQREGANGVVEEQEPAELTARRRRVFRL* |
| Ga0070706_1000453551 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | ADHIAFWLGEDRILHSTRRDGVDGVVEEREPEYLRARRRKSFRLSNNAAL* |
| Ga0070707_1013379451 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | TYGSAETADHVAFWLGGGRILHSTQRDGIDGVVEEDEPNELRERRRAFFRL* |
| Ga0070707_1023438541 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | AFWLGDGRILHSTERDDVNGVLEEPEPDDLRARRRRLLRF* |
| Ga0070699_1011649311 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | GAEGADHVAFWLGEGRILHATGREGVCKVVEEAEPDELRARRRAAFRL* |
| Ga0073909_100050464 | 3300005526 | Surface Soil | EGADHIAFWVGGGRILHSTQRDGVDGVVEEEEPAELRESRRALVRLAPSGR* |
| Ga0070679_1016335582 | 3300005530 | Corn Rhizosphere | AFWLGDGRILHATAREGLGVVEEIEPEELRARRRRVVRLAGARPMSA* |
| Ga0068853_1019325561 | 3300005539 | Corn Rhizosphere | ADHIAFWLGEGRILHSTRREGANGVIEEVEPEELRLRRRKVFRL* |
| Ga0066697_104455362 | 3300005540 | Soil | EATHIAFWLGDGRILHSTEREGVDGVVEEVEPDDLRAQRRRLIRL* |
| Ga0070686_1012280492 | 3300005544 | Switchgrass Rhizosphere | GEPVDHIAFWVGEGRILHSTGRENGIGVLEEEEPAYLHERRHKLVRL* |
| Ga0070695_1008637652 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | IAFWVGEGRILHSTEREGVDGVVEEAEPDELRAQRRRLIRL* |
| Ga0070704_1022754272 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | YGNETATHIAFWLGDGRILHSTEREGVDGVVEEAEPDDLRAQRRRLIRL* |
| Ga0066695_107413461 | 3300005553 | Soil | ADHIAFWVGGGRILHSTQRGGVDGVVEEEEPAELRARRRSTFRL* |
| Ga0066698_107431812 | 3300005558 | Soil | LISYGDAERADHVAFWLGDGRILHATARDGVNCVVEEPEPDELRLRRRRAFRF* |
| Ga0066700_110627872 | 3300005559 | Soil | DGRILHSTQREHADGVLEEREPEDLRARRRTLVRF* |
| Ga0066699_104517131 | 3300005561 | Soil | TYGDETAVTHVAFWLGEGRILHSTEREDANGVVEEPEPDELRARRRRLVRLGA* |
| Ga0066699_107132371 | 3300005561 | Soil | QPGDLISYAEDGETNATHVAFWLGGGRILHSTQRDGVDGVVEEDEPAHLNALRRRTFRL* |
| Ga0066708_104584831 | 3300005576 | Soil | AENGETHATHIAFWLGGGRILHSTEREGVDGVVEEAEPEHLRRMRRRIVRL* |
| Ga0066654_102162911 | 3300005587 | Soil | VDHIAFWLGGGRILHATGRDDGIGVVEEDEPEYLRARRHKLVRL* |
| Ga0066706_104403241 | 3300005598 | Soil | FWLGDGRILHSTEREGVDGVVEELEPAHLRAQRRQLIRL* |
| Ga0068856_1007313591 | 3300005614 | Corn Rhizosphere | AFWLGEGRILHSTDRDDVACVLEEPEPGDLRTRRRGLVRLR* |
| Ga0068856_1019756321 | 3300005614 | Corn Rhizosphere | YAENGEAHATHIAFWLGDGRILHSTQRDGVDGVVEELEPEHLKEMRRRIIRL* |
| Ga0068861_1000247661 | 3300005719 | Switchgrass Rhizosphere | KAATHIAFWLGDGRILHSTERESVDGVVEEAEPPDLHAQRRRLIRF* |
| Ga0066903_1020904162 | 3300005764 | Tropical Forest Soil | ADHIAFWLGDGRILHATDRAGTSRVLEEPEPAELRARRRRVVRF* |
| Ga0066903_1087647681 | 3300005764 | Tropical Forest Soil | FWLGEGRILHSTQRDGADGVVEEQEPAELRPRFRKYVRL* |
| Ga0066656_101548992 | 3300006034 | Soil | VAFWLGDGRILHSTEREDANGVVEEPEPEDLRARRRRLVRLRA* |
| Ga0066656_111434651 | 3300006034 | Soil | TTHIAFWLGDGHILHATERDGVDGVLEEPEPDELRTKRRAFVRLLP* |
| Ga0066652_1019060992 | 3300006046 | Soil | DSERTTHIAFWLGEGRILHSTEREDVNGVIEEPEPAELLHKRRCFVRF* |
| Ga0075417_103956282 | 3300006049 | Populus Rhizosphere | TYGDDGQDHATHIAFWLGEDRILHSTQRAGVDGVLEELEPDDLRARRRKLVRF* |
| Ga0075017_1009461192 | 3300006059 | Watersheds | DETRADHIVFWLGDGRILHSTRRDGVDGVVEEPEPPELLERRRRGIRFTVPTPNSFAS* |
| Ga0075015_1006100501 | 3300006102 | Watersheds | TYGDETRADHIVFWLGDGRILHSTQRDGVDGVVEEPEPPELLERRRRGIRFTVPTPNSFAS* |
| Ga0070715_104639281 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | AEEGETHATHIAFWLGDGRILHSTERGGVDGVVEEPEPLHLRQTRRRVIRL* |
| Ga0070715_105147091 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | GNENVADHVAFWLGEGRILHATGRAGVCAVVEEPEPPELRSRRRRFFRF* |
| Ga0070715_105196812 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | ATHIAFWLGDGRILHSTEREGVDGVVEEAEPDDLRAQRRRLIRL* |
| Ga0070716_1004853581 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | WLGDGRILHSTEREGVDGVVEEPEPLHLRQTRRRVIRL* |
| Ga0070712_1001275921 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GDLVTYGDERETTHVAFWLGGGRILHATQREGVDGVVEEPEPVDLREKRRACIRLLS* |
| Ga0070712_1001917082 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | TADHVAFWVGDGRILHATERDGVSRVLEEPEPSELRARRRGTVRL* |
| Ga0070712_1003889153 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LGDGRILHSTGRDGGIGVVEEDEPGYLHAQRRKLIRL* |
| Ga0074054_102637722 | 3300006579 | Soil | GEEVADHIAFWLGDGRILHSTGRDDGVGVIEELEPASLRARRRKLVRL* |
| Ga0074057_108120481 | 3300006605 | Soil | GKEVADHIAFWLGDGRILHSTGRDDGVGVIEELEPESLRARRRKLVRL* |
| Ga0066658_101736221 | 3300006794 | Soil | TYGDEQEATHIAFWLGDGHILHATERDGVDGVLEEPEPDELRTKRRAFVRLLP* |
| Ga0075425_1012913601 | 3300006854 | Populus Rhizosphere | DLITYAEPGETHATHIAFWLGDGRILHSTQRDGVDGVVEEVEPEHLKEMRRRIIRL* |
| Ga0075424_1001679243 | 3300006904 | Populus Rhizosphere | DGQDHATHIAFWLGEDRILHSTQRAGVDGVLEELEPDDLRARRRKLVRF* |
| Ga0074063_135897011 | 3300006953 | Soil | YGNETATHIAFWLGDGRILHSTEREGVDGVVEEAEPDDLRAQRRRLIRLLIPDVLTA* |
| Ga0079218_112675871 | 3300007004 | Agricultural Soil | DHVAFWLGEGRILHASGRKGVECVLEEPEPNELFTKRRSCRRFVTL* |
| Ga0099791_104514091 | 3300007255 | Vadose Zone Soil | ADHVAFWLGRGRILHSTQRDGVDGVVEEDEPNELQERWRAFFRL* |
| Ga0066710_1015910901 | 3300009012 | Grasslands Soil | WLGDGRILHSTEREGIDGVVEELEPAQLRAQRRRLIRL |
| Ga0066710_1041875771 | 3300009012 | Grasslands Soil | HVAFWLGDGRILHSTRREDVNGVVEEREPEDLRAQRRRLVRLDA |
| Ga0099827_114113272 | 3300009090 | Vadose Zone Soil | EETADHIAFWLGGGRILHSTQRDGVDGVLEEPEPAELHARRRRVFRL* |
| Ga0105240_112237711 | 3300009093 | Corn Rhizosphere | NGAADHVAFWLGDGRILHSTSREGADGVTEEVEPEELRARRRRTFRL* |
| Ga0066709_1009770552 | 3300009137 | Grasslands Soil | AFWVGGGRILHSTQRGGVDGVVEEEEPAELRARRRSTFRL* |
| Ga0066709_1016158903 | 3300009137 | Grasslands Soil | EADHIAFWLGDGRILHSTGREGGIGVVEEAEPESLRVRRRKLVRL* |
| Ga0066709_1022400311 | 3300009137 | Grasslands Soil | DLITYGDEDNTTHIVFWVGDGQILHSTEREDVNGVVEELEPAELRAMRRRLIRL* |
| Ga0066709_1043666592 | 3300009137 | Grasslands Soil | THIAFWLGGGRILHSTEREGVDGVVEEAEPEHLRRMRRRIVRL* |
| Ga0126313_111852831 | 3300009840 | Serpentine Soil | EEEATHIAFWLGEGRILHSTSREGINGVVEEEQPAELAAKVRRCVRF* |
| Ga0126309_103177711 | 3300010039 | Serpentine Soil | IAFWLGDGRILHSTQRDDANGVTEEPEPADLKARRRKLIRL* |
| Ga0126310_106967562 | 3300010044 | Serpentine Soil | EGELRPGDLVCYEGHIAFWLGDGRILHSTQRDGVNGVVEEPEPAELRPRFRSYVRL* |
| Ga0126311_116570322 | 3300010045 | Serpentine Soil | ATHVAFWLGDDRILHSTQRDGVNGVVEETEPGDLRTRRRTLLRL* |
| Ga0127451_10312161 | 3300010120 | Grasslands Soil | TYGDSERTTHIAFWLGEGRILHSTEREDVNGVIEEPEPAELLHKRRCFVRF* |
| Ga0126321_13391211 | 3300010145 | Soil | HIAFWLGDGRILHSTERESVNGVVEEVEPTDLRAQRRRLIRL* |
| Ga0126319_11235712 | 3300010147 | Soil | LVTYGDERADHVAFWVGEGRVLHATQRDGISRVVEEPEPQELRSQRRVTFRL* |
| Ga0126306_118070452 | 3300010166 | Serpentine Soil | PGDLMCYDGHIAFWLGEGHILHSTSRDGVNGVVEEPEPAELRPRFHRYVRL* |
| Ga0134082_102858952 | 3300010303 | Grasslands Soil | TYGEDGEPKATHIAFWLGDGRILHSTQREGIDGVVEEDEPAQLKPMRRRAIRL* |
| Ga0134109_104337841 | 3300010320 | Grasslands Soil | TYGGDEATHIAFWLGDGRILHSTEREGVDGVVEEVEPDDLRAQRRRLIRL* |
| Ga0134109_104971531 | 3300010320 | Grasslands Soil | GEDGEPKATHIAFWLGDGRILHSTQREGIDGVVEEDEPAQLKPMRRRAIRL* |
| Ga0134084_102484732 | 3300010322 | Grasslands Soil | AFWLGDGRILHSTEREDLACVLEEPEPVDLRSRRRRCLRL* |
| Ga0134084_103808031 | 3300010322 | Grasslands Soil | LITYAESGETHATHIAFGLGDGRILHSTQREGVNGVVEETEPEHLKKMQRRIIRL* |
| Ga0134065_103211061 | 3300010326 | Grasslands Soil | DHIAFWVGGGRILHSTQRDGVNGVVEEEEPAELRERRRVLVRLGAGER* |
| Ga0134063_102334782 | 3300010335 | Grasslands Soil | YGDERTTHIAFWLGGGRILHATERDDMNGVLEEPEPEDLRARRRKLVRI* |
| Ga0134125_104022851 | 3300010371 | Terrestrial Soil | HIAFWIGDGRILHSTGRDDGIGVVEEQEPETLRARRRKVVRL* |
| Ga0134125_109380001 | 3300010371 | Terrestrial Soil | DELADHVAFWLGDGRILHAVGRSGVEAVVEELEPADLVRLRRRFIRFCAA* |
| Ga0134125_130177401 | 3300010371 | Terrestrial Soil | GAADHVAFWLGDGRILHSTSRDGFDGVTEEPEPQELRARRRRTFRL* |
| Ga0134128_100941051 | 3300010373 | Terrestrial Soil | HIAFWLGDGRILHSTERESVDGVVEEAEPADLHAQRRRLIRF* |
| Ga0134128_122946591 | 3300010373 | Terrestrial Soil | LITYGDEEQATHIAFWLGDGRILHSTEREGVDGVVEETEPPHLQAQRRRLIRL* |
| Ga0134123_116087811 | 3300010403 | Terrestrial Soil | PEGADHIAFWVGAGRILHSTQRDGVDGVVEEEEPAELRERRRALVRLAPGGR* |
| Ga0138505_1000258981 | 3300010999 | Soil | HIAFWVGDGRILHSTERDGANGVVEELEPAELRPLRRRLIRL* |
| Ga0120175_10263131 | 3300011971 | Permafrost | AASADHIAFWLGDGRILHSTQREGADGVLEEQEPAELNARRRVMFRL* |
| Ga0120157_10222621 | 3300011994 | Permafrost | IAFWVGEGRILHSTGRDDLGVVEEDEPESLRTRRRFLVRL* |
| Ga0120152_11643931 | 3300012011 | Permafrost | GRILHSTGREDGIGVVEEFEPEYLYAQRHKLIRL* |
| Ga0120159_10872991 | 3300012014 | Permafrost | TYGNDEVAHATHVAFWLGNGRILHATERDDANGVLEEDEPNELRVRRRKLVRF* |
| Ga0137382_100312964 | 3300012200 | Vadose Zone Soil | THIAFWLRDGRILHSTEREGVDGVVEEPEPDHLRTQRRRLIRL* |
| Ga0137374_101245511 | 3300012204 | Vadose Zone Soil | DLVCYDGHIAFWLGDRRILHSTQREGVDGVVEEPEPAELRPRFHRYVRL* |
| Ga0137374_105664961 | 3300012204 | Vadose Zone Soil | GDLVCYDGHIAFWLGDRRILHSTQREGVDGVVEEPEPAELKPRFHRYVRL* |
| Ga0137374_107763051 | 3300012204 | Vadose Zone Soil | DLLTYGDEREATHIAFWLGGGRILHATQREGVDGVIEEAEPAELRSRRRRFVRFASNNASG* |
| Ga0137377_102671182 | 3300012211 | Vadose Zone Soil | DGETKATHIAFWLGDGRILHSTQRNGVDGVIEEEEPAQLKAVRRCAIRI* |
| Ga0150985_1026979521 | 3300012212 | Avena Fatua Rhizosphere | KPADHVAFWLGDGRILHSTQREGANGVVEEDEPEYLRRRKRGTFRL* |
| Ga0150985_1058677111 | 3300012212 | Avena Fatua Rhizosphere | AFWLGGERILHATRRDGVDGGVEGVEPAGLRARRRKIVRL* |
| Ga0150985_1158950162 | 3300012212 | Avena Fatua Rhizosphere | GKDYATHVAFWLGDGRILHSTQRDDANGVVEEPEPEDLRARRRKLFRL* |
| Ga0137366_100549141 | 3300012354 | Vadose Zone Soil | RGDLITYGDAGRTTHIAFWLGGGRILHSTARDGASGVLEEPEPADLHARRRRFIRF* |
| Ga0137369_100146749 | 3300012355 | Vadose Zone Soil | DLVTYGTDVADHIAFWLGDGSILHAAGRDGVRAVLEEEEPTEYRARRRRFVRF* |
| Ga0137369_105344901 | 3300012355 | Vadose Zone Soil | TYGDDDAGSGGATHIAIWLGDGRNLHSAQRGETNGVVEEREPHDLRARRRRFIRF* |
| Ga0137368_100934942 | 3300012358 | Vadose Zone Soil | LDHIAFWLGDGSILHAAGRDGVRAVLEEEEPTEYRARRRRFVRF* |
| Ga0137368_109246492 | 3300012358 | Vadose Zone Soil | ATHIAFWLGDGRILHSTQRDETNGVVEEREPHDLRARRRRLIRF* |
| Ga0137375_110180052 | 3300012360 | Vadose Zone Soil | GDVEKDGATHIAFWLGDGRVLHSTQRDDADGVVEELEPDDLRARRRKLVRF* |
| Ga0134038_12805851 | 3300012382 | Grasslands Soil | DHVAFWLGEGRILHATQREGVNGVVEEHEPEYLKARRRGTFRF* |
| Ga0150984_1005297301 | 3300012469 | Avena Fatua Rhizosphere | AFWLGEDRILHATQREGVNGVVEEHEPEYLKARRRGMFRF* |
| Ga0137373_107466323 | 3300012532 | Vadose Zone Soil | WLGAGRILHSTGRDGGVGVVKEEEPESLRARRRKFVRL* |
| Ga0157284_101930002 | 3300012893 | Soil | RPGDLVCYEGHIAFWLGEGRILHSTQREGVNGVVEEPEPAELRPRFHRYVRL* |
| Ga0137395_104253142 | 3300012917 | Vadose Zone Soil | YGDETADHIAFWLGDGRILHSTQRDDANGVLEELEPKELHARRRRVFRL* |
| Ga0137404_110043472 | 3300012929 | Vadose Zone Soil | VDHIVFWLGAGRILHATGRENGIGVVEEFEPEYLFVRRHKLIRL* |
| Ga0137404_117386101 | 3300012929 | Vadose Zone Soil | FWLGGGRILHSTQRDGIDGVTEEDEPEELRHRRRSTFRL* |
| Ga0137407_105905031 | 3300012930 | Vadose Zone Soil | THIAFWLGDGRILHSAEREGVDGVVEEVEPDDLRAQRRRLIRL* |
| Ga0153915_106383501 | 3300012931 | Freshwater Wetlands | GKPADHVAFWLGAGRILHATQREGADGVLEEREPAELTARRRVIFRL* |
| Ga0126375_118627541 | 3300012948 | Tropical Forest Soil | DHATHIAFWIGDGRILHSTQREGVDGVVEEAEPEDLKEMRRRIIRL* |
| Ga0164300_110698692 | 3300012951 | Soil | VDHIAFWLGAGRILHATGRENGIGVIEELEPESLYARRHKLIRL* |
| Ga0164300_112042471 | 3300012951 | Soil | HHVAFWLGGGRILHATGREGVGRVVEEDEPAELRDGPQRTVRLPRR* |
| Ga0164301_106631821 | 3300012960 | Soil | ITYGAVDQATHIAFWVGEDRILHSTERDGVDGVVEEVEPDELRAQRRRLIRL* |
| Ga0164301_119003431 | 3300012960 | Soil | SYGDQAAGADHVAFWLGECRILHATGRDGVNRVLEEREPEELRRRRRQAFRL* |
| Ga0164302_105103461 | 3300012961 | Soil | QATHIAFWVGDGRILHSTEREGVDGVVEEVEPNELRAQRRRLIRL* |
| Ga0126369_123544112 | 3300012971 | Tropical Forest Soil | YSEEGETHATHIAFWLGKGRILHSTERDDVNGVVEEIEPEHLKEMRRRIIRL* |
| Ga0126369_127659392 | 3300012971 | Tropical Forest Soil | IAFWLGDGRILHATGREGVNRVLEESEPPELRARRRRTIRFARLD* |
| Ga0134110_105851941 | 3300012975 | Grasslands Soil | LLDDAVHVAFWVGGGRILHSTQRGGVDGVVEEEEPAELRARRRSTFRL* |
| Ga0164309_101711712 | 3300012984 | Soil | FWVGDGRILHATQRDGVSRVVEEIEPPELRARRRGAIRL* |
| Ga0164307_116428811 | 3300012987 | Soil | FWLGDGLILHSTERDDVARVLEEPEPADLRAHRRALVRLQ* |
| Ga0164306_111388291 | 3300012988 | Soil | GRILHATGREGVNRVVEEDEPAELRGGPRRTVRLP* |
| Ga0164305_106935351 | 3300012989 | Soil | HVAFWLGEGRILHSTERDDANGVVEELEPDELRSKRRRLIRLSTSPH* |
| Ga0164305_111779912 | 3300012989 | Soil | GEGRILHSTERDGVDGVVEEVEPDDLRAQRRRLIRL* |
| Ga0157373_108855081 | 3300013100 | Corn Rhizosphere | THIAFWVGEGRILHSTEREGVDGVVEEAEPDELRAQRRRLIRL* |
| Ga0157372_104483841 | 3300013307 | Corn Rhizosphere | LFSYGDPGKAAYHLAFWIGEGRILHSTSRGGADGVVEEAEPEELRARRRGVFRL* |
| Ga0157375_123448922 | 3300013308 | Miscanthus Rhizosphere | DLITYGEERTTHIAFWLGDGRILHSTERDDANGVVEEREPDELRAQRRRLIRLD* |
| Ga0120172_10229371 | 3300013765 | Permafrost | DHIAFWLGEGRILHSTGREDGIGVVEEPEPASLRARRRKLVRL* |
| Ga0120172_11210441 | 3300013765 | Permafrost | HIAFWVGEGRILHSTGRDDLGVVEEPEPESLRERRRGRIRL* |
| Ga0134081_102024511 | 3300014150 | Grasslands Soil | THVAFWLGGGRILHSTQREDANGVVEEAEPEELRVKRRCRVRLRA* |
| Ga0163163_114557492 | 3300014325 | Switchgrass Rhizosphere | DDRTTHIAFWLGEGRILHSTERDDANGVVEELEPDELRSKRRRLVRLSTSPH* |
| Ga0182024_129002831 | 3300014501 | Permafrost | GEERADHIAFWLGDGRILHSAGGQGVVAETEPESLRVRRRGFICF* |
| Ga0181519_104986731 | 3300014658 | Bog | YGRSDMPDHIAFWVGDGFILHATNRDRLGVVEEPEPAALCATRRQVIDL* |
| Ga0120171_11351531 | 3300014827 | Permafrost | GDGRADHIAFWVGEGRILHSTGRDDLGVVEEPEPESLRGRRRHVVRL* |
| Ga0120104_10385111 | 3300014829 | Permafrost | LEPGDLITYGGDEATHIAFWLGDRRILHSTEREGVDGGVEEVEPDDLLAQRRRLIRL* |
| Ga0157379_126682661 | 3300014968 | Switchgrass Rhizosphere | ADRATHIAFWLGDGRILHSTERDDANGVVEEREPADLRARRRRLVRL* |
| Ga0173483_103506442 | 3300015077 | Soil | FWLGDGRILHATQRDDVDGVVEETEPEDLRARRRRVIRF* |
| Ga0167650_10113981 | 3300015203 | Glacier Forefield Soil | GGGRILHSTGREHGIGVVEEDEPEYLRARRRKLVRL* |
| Ga0134073_100448323 | 3300015356 | Grasslands Soil | GDLITYGDETAVTHIAFWLGDGRVLHSTQREDANGVLEEAEPEDLRARRRRLVRLRA* |
| Ga0134085_105952692 | 3300015359 | Grasslands Soil | DADRADHVAFWVGGGRILHSTQRGGVDGVVEEEEPAELRARRRSTFRL* |
| Ga0132258_113805351 | 3300015371 | Arabidopsis Rhizosphere | DLRYGDLITYGDSEHTTHIAFSLGDDRILHSTERDDANGVVEEPEPDELKTKRRRFIRL* |
| Ga0132258_114935122 | 3300015371 | Arabidopsis Rhizosphere | ERETTHIAFWLGDGRILHATQRDGVDGVLEEPEPDELRTKRRAFVRLLA* |
| Ga0132256_1025137202 | 3300015372 | Arabidopsis Rhizosphere | TGDLITYGDDAGATHIAFWLGDGRILHSTERDDANGVVEEPEPADLRARRRCLVRF* |
| Ga0132256_1026496941 | 3300015372 | Arabidopsis Rhizosphere | HIAFWLGDGRILHSTDREGVSRVLDESEPDELRARRRRLIRL* |
| Ga0132257_1011252891 | 3300015373 | Arabidopsis Rhizosphere | GDLITYGEERTTHIAFWLGDGRILHSTERDDAYGVVEEREPDELRARRRLLIRLG* |
| Ga0132255_1040605472 | 3300015374 | Arabidopsis Rhizosphere | LGDGRILHSTERDDANGVVEEREPDELRARRRRLIRLG* |
| Ga0187785_101553901 | 3300017947 | Tropical Peatland | VAFWLGDGRILHATRREGVDGVVEEPEPSELRGRRRRAIRFIKPSPN |
| Ga0184605_103831252 | 3300018027 | Groundwater Sediment | ATHIAFWLRDGRILHSTEREGVDGVVEEAEPDDLRTQRRRLIRL |
| Ga0187788_102464142 | 3300018032 | Tropical Peatland | ERAADHVAFWLGDGRILHATRREGVDGVVEEPEPSELRGRRRRAIRFIKPSPN |
| Ga0184618_105069751 | 3300018071 | Groundwater Sediment | TYGAGDQATHVAFWLGEGRILHSTERDGVDGVVEEVEPDELRAQRRRLIRL |
| Ga0184635_102470731 | 3300018072 | Groundwater Sediment | TTHIAFWLGEGRILHSTDREDAKGVVEEPEPADLQSRRRKLVRL |
| Ga0184624_103690862 | 3300018073 | Groundwater Sediment | LGDGRILHSTEREGVDGVVEEAEPDDLRTQRRRLIRL |
| Ga0184609_102443672 | 3300018076 | Groundwater Sediment | FWLGGGRILHSTERDGVNGVLEEPEPADLRARRKRFIRF |
| Ga0184625_104010321 | 3300018081 | Groundwater Sediment | VCYEGHIAFWLGAGRILHSTQREGVNGVVEEPEPAELRRRFNRYVRLWTAAFKTGV |
| Ga0066655_105752461 | 3300018431 | Grasslands Soil | LISYGDAERADHVAFWLGNGRILHATARDGVNCVVEEPEPDELRVRRRRAFRF |
| Ga0190275_106287053 | 3300018432 | Soil | ADHIAFWVGEGSILHATGRDGVAAVVEEQEPLVLSAQRRRFVRL |
| Ga0066667_112034291 | 3300018433 | Grasslands Soil | FWLGDGRILHATERDGVDGVLQEEEPPELQERRRMLFRF |
| Ga0066662_115110121 | 3300018468 | Grasslands Soil | IAFWLGDGRILHSTERDDANGVLEEQEPEDLRARRRKLLRL |
| Ga0184644_14257273 | 3300019269 | Groundwater Sediment | DTATHIAFWLRDGRILHSTEREGVDGVVEEAEPDDLRTQRRRLIRL |
| Ga0193701_10429611 | 3300019875 | Soil | AFWLGDGRILHSAEREGVDGVVEEVEPDDLRAQRRRLIRL |
| Ga0193701_10482182 | 3300019875 | Soil | GNDTATHIAFWLGDGRILHSTEREGVDGVVEEPEPDHLRAQRRRLIRL |
| Ga0193728_13154041 | 3300019890 | Soil | HVAFWLGDGRILHSTQREDVNGVVEEREPEHLRAQRRRLVRLDA |
| Ga0193755_10299461 | 3300020004 | Soil | FWLGDGRILHSTEREGVDGVVEEAEPDDLRAQRRRLIRL |
| Ga0197907_101283911 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | DHVAFWLGDGRILHATGREGVDAVTEEVEPEELRARRRRTFRLE |
| Ga0206356_112214942 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | GDLITYGDPGKAADHVAFWVGEGRILHSTSRDGADGVVEEAEPEELRARRRGVFRL |
| Ga0206356_118332082 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | GRADHVAFWLGDCRILHATGREGVNGVTEEVEPEELRARRRRTFRL |
| Ga0206353_102204982 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | WAGEGRIVHSTGREGGIGVVEEPEPAALRARRHKLIRL |
| Ga0179594_100993702 | 3300020170 | Vadose Zone Soil | AATHIAFWLGDGRILHSTEREGVDGVVEEVEPDDLRVQRRRLIRL |
| Ga0193699_102372292 | 3300021363 | Soil | YGEPADHIAFWLGDGRILHSTQRDGIDGVVEEPEPEELRRRRHAVFRL |
| Ga0193750_10314551 | 3300021413 | Soil | ALVTYGDEESATHIAFWLGDGRILHSTERDGVNGVVEEAEPAHLRAQRRRLIRF |
| Ga0213871_102884321 | 3300021441 | Rhizosphere | AERAGHIAFWVGDGRLLHSRGGVGVVEEPEPAEYLARRRRTIRL |
| Ga0182009_107528852 | 3300021445 | Soil | NGETHATHVAFWLGDGRILHSTQRDDGVDGVVEEPEPEHLKKMRRRIFRL |
| Ga0222622_104595841 | 3300022756 | Groundwater Sediment | WLGDGRILHSTERDDANGVVEEVESDELKIKRRRLIRLSTSAH |
| Ga0207692_101097591 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | WLGDGRILHSTGRDDGLGVIEELEPESLRSRRRKLVRL |
| Ga0207642_106043861 | 3300025899 | Miscanthus Rhizosphere | YGEDNRTTHIAFWLGEGRILHSTERDDANGVVEEFEPAELRSKRRRLIRLSTSRH |
| Ga0207685_106482132 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | NETATHIAFWLGDGRILHSTEREGVDGVVEEAEPDDLRAQRRRLIRL |
| Ga0207699_101160041 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | AFWLGAGRILHSTQREGTDGVVEETEPEELAGMRRLIFRL |
| Ga0207699_109720232 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | AFWLGGGRILHATRRDDVDGVLEEPEPAELRARRRRLFRL |
| Ga0207684_105471932 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | PGDLITYGDDNATHIAFWLGEGRILHSTERDGANGVLEEREPRELRARRRKLVRL |
| Ga0207707_102454921 | 3300025912 | Corn Rhizosphere | VAFWLGDGRILHATGREGVDAVTEEVEPEELRARRRRTFRLE |
| Ga0207646_119326981 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | ITYGDGDRTTHIAFWLGDGRILHSTERDDANGVLEELEPADLHARRRSLIRL |
| Ga0207687_101847341 | 3300025927 | Miscanthus Rhizosphere | GDEATTHIAFWLGDGRILHSTERDDVACVLEEPEPADLRARRRALVRLR |
| Ga0207677_116021682 | 3300026023 | Miscanthus Rhizosphere | IAFWLGDGRILHSTGREDGIGVIEEIEPDSLRARRRKLVRL |
| Ga0207678_111106302 | 3300026067 | Corn Rhizosphere | IAFWLGGGRILHSTRRDGVDGVVDEPEPDELRLRRHAVFRL |
| Ga0207708_118886392 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VGDLITYGDANGATHIAFWLGDGRILHSTERAGVDGVVEEPEPDELRLQRRRVIRL |
| Ga0207708_119336472 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | GHVAFWLGEGRILHSTQRDGVNGVVEEPEPAELRPRFHRYVRL |
| Ga0207702_106818522 | 3300026078 | Corn Rhizosphere | DLITYGDETTTHIAFWLGEGRILHSTDRDDVACVLEEPEPGDLRTRRRGLVRLR |
| Ga0207702_118518242 | 3300026078 | Corn Rhizosphere | YAENGEAHATHIAFWLGDGRILHSTQRDGVDGVVEELEPEHLKEMRRRIIRL |
| Ga0209238_10429803 | 3300026301 | Grasslands Soil | PGDLITYGDERTTHIAFWLGDGRILHSTEREDLACVLEEPEPVDLRSRRRRCLRL |
| Ga0209154_10168191 | 3300026317 | Soil | TTHVAFWLGEARILHATQRDGVDGVVEEHEPGDLRAKRRRFVRLSA |
| Ga0209472_13081591 | 3300026323 | Soil | ADGRADHVAFWLGEGRILHATQRDGVDRVIEEEEPEELQERRRMLFRF |
| Ga0209801_10355294 | 3300026326 | Soil | GDLITYGEDDKATHIAFWVGDGRILHSTERNGVDGVVEELEPAELRAQRRRLIRL |
| Ga0209577_101231751 | 3300026552 | Soil | IAFWLGDGRILHSTGRENGIGVVEEGEPEDLRARRHKLIRL |
| Ga0209701_100325101 | 3300027862 | Vadose Zone Soil | YGDDKTTHIAFWLGDGRILHSTERDGANGVLEEREPDELRARRRKLVRI |
| Ga0209814_103937151 | 3300027873 | Populus Rhizosphere | TYGDDGQDHATHIAFWLGEDRILHSTQRAGVDGVLEELEPDDLRARRRKLVRF |
| Ga0265319_12045931 | 3300028563 | Rhizosphere | GDGRILHSTQREGADGVLEETEPPELRARRRAVVRL |
| Ga0265322_100295751 | 3300028654 | Rhizosphere | HIAFWLGDGRILHSTQREGAAGVLEETEPPELTARRRAVVRL |
| Ga0307313_100804361 | 3300028715 | Soil | TYGAGDQATHIAFWVGEGRILHSTEREGVDGVVEEAEPDELRAQRRRLIRL |
| Ga0307307_102262492 | 3300028718 | Soil | GDGRILHSTERDDVACVLEEPEPADLRASRRALVRLR |
| Ga0307301_100201392 | 3300028719 | Soil | SASSATHIAFWLGDGGILHSTEREGVDGVVEEAEPDHLRTQRRRLIRL |
| Ga0307319_100256232 | 3300028722 | Soil | VTYGDDQTTHIAFWLGEGRILHSTDREDAKGVVEEPEPADLQARRRKLVRL |
| Ga0307297_101417891 | 3300028754 | Soil | AFWLGDGRILHSTERDDVACVLEEPEPADLRASRRALVRLR |
| Ga0307282_100711921 | 3300028784 | Soil | ISYGEPADHVAFWLGGGRILHATQREGINGVIDEPEPEELRLRRHAVFRL |
| Ga0307323_101137912 | 3300028787 | Soil | DLVTYGAGDQATHIAFWVGEGRILHSTEREGVDGVVEEAEPDELRAQRRRLIRL |
| Ga0307323_101440021 | 3300028787 | Soil | FWLGEGRILHSTDREDAKGVVEEPEPADLQSRRRKLVRL |
| Ga0307290_102846412 | 3300028791 | Soil | FWLGDGRILHSAEREGVDGVVEEVEPDDLRAQRRRLIRL |
| Ga0307299_103545491 | 3300028793 | Soil | LGDGRILHSAEREGVDGVVEEVEPDDLRAQRRRLIRL |
| Ga0307287_100569091 | 3300028796 | Soil | IAFWLGEGRILHSTDREDAKGVVEEPEPADLQARRRKLVRL |
| Ga0307305_101929401 | 3300028807 | Soil | VAFWLGDGRILHSTQREDVNGVVEEREPEDLRAQRRRLVRLDA |
| Ga0307305_102231131 | 3300028807 | Soil | LRQGDLITYGAPEATHIAFWVGEGRILHSTEREGVDGVVEEVEPDELRAQRRRLIRL |
| Ga0307294_100847712 | 3300028810 | Soil | GDQATHIAFWVGEGRILHSTEREGVDGVVEEVEPDELRAQRRRLIRL |
| Ga0307296_100894681 | 3300028819 | Soil | YGGDEATHIAFWLGDGRILHSAEREGVDGVVEEVEPDDLRAQRRRLIRL |
| Ga0307312_105003582 | 3300028828 | Soil | GDVATHIAFWVGEGRILHSTDREGVDGVVEEVEPDSLRAQRRRLIRL |
| Ga0307312_107051521 | 3300028828 | Soil | THIAFWLGDGRILHSTERERVDGVVEEAEPDHLRAQRRRLIRL |
| Ga0307278_102681092 | 3300028878 | Soil | GGGRILHSTDRDGVNGVLEELEPADLRARRKRFIRF |
| Ga0307277_101400642 | 3300028881 | Soil | VTYGGERETTHVAFWLGGGRILHATQRDGVDGVVEEPEPDDLRAKRRAFIRFPV |
| Ga0307308_100319751 | 3300028884 | Soil | GEGRILHSTDREGFDGVVEEVEPDSLRAQRRRLIRL |
| Ga0268241_100483232 | 3300030511 | Soil | TYGDPGKPADHIGFWLGDGRILHSTQREGINGVVEEQEPDELRGRRRRAFRL |
| Ga0268241_101026651 | 3300030511 | Soil | DLVTYGDVEGGEATHIAFWLGEGRILHSTDRDGVHRVLEEPEPADLAARRRKLVRL |
| Ga0308189_104213691 | 3300031058 | Soil | HLVTYGDDQTTHIAFWLGEGRILHSTDREDAKGVVEEPEPADLQSRRRKLVRL |
| Ga0308204_100078732 | 3300031092 | Soil | EATHIAFWAGEGRILHSTEREGVDGVVEEIEPDDLKAQRRRLIRL |
| Ga0307496_100764342 | 3300031200 | Soil | EGADHVAFWVGGGRILHSTQRDGVDGVVEEEEPAELRESRRALVRLAPSGR |
| Ga0265329_102944121 | 3300031242 | Rhizosphere | AFWLGEGRILHSTGREDGIGVIEELEPRDLRRRRHKLIRL |
| Ga0311364_124195462 | 3300031521 | Fen | YGDPVDHIAFWLGDGRILHSTGREDGIGVVEEPEPEDLRGRRHRLIRL |
| Ga0318555_105954601 | 3300031640 | Soil | GRILHATGREGVDRVVEEPEPDELRARRRKTLRLDVSASHVF |
| Ga0307374_106713122 | 3300031670 | Soil | HIAFWVGDGRILHSTGREHGAGVVEEQEPDELRARRHKLIRL |
| Ga0310813_105321662 | 3300031716 | Soil | IAFWLGDGRILHSTQRDGVDGVVEEVEPEHLKEMRRRIIRL |
| Ga0308175_1015192802 | 3300031938 | Soil | LGGGRILHSTERDDANGVVEEVEPGDLKSKRKALIRLTTVSS |
| Ga0308175_1018055352 | 3300031938 | Soil | DHIAFWVGDGRILHSTGRDDGIGVVEEPEPENLRGRRHKLIRL |
| Ga0308175_1030198871 | 3300031938 | Soil | LITYGDERTTHIAFWLGDGRILHSTERDDANGVVEEREPEEHRARRRRLVRLP |
| Ga0308176_115176212 | 3300031996 | Soil | DGAADHVAFWLGDGRILHATGREGVDAVTEEVEPEELRARRRRTFRLE |
| Ga0307471_1040020041 | 3300032180 | Hardwood Forest Soil | DLVTYGPGERADHVAFWLGDGRILHSRGGVGVVEEPEPDELLARRRGTFRL |
| Ga0316628_1003034202 | 3300033513 | Soil | TYGDAGKPADHVAFWLGAGRILHATQREGADGVLEEREPGELAARRRVIFRL |
| Ga0247830_105072961 | 3300033551 | Soil | ITYGEADKEHATHIAFWLGDGRILHSTEREGVNGVVEEAEPAELRARRRAFLRL |
| Ga0314862_0087079_3_125 | 3300033803 | Peatland | GRILHSTRRDGVDGVVEEPEPAELLACRRRAIRFVKRSPN |
| Ga0372943_0063990_23_202 | 3300034268 | Soil | VTYGEGTADHVAFWLGDGRILHSTQREGVDGVTEEQEPGELAARRRGIFRLSQSDNSRF |
| ⦗Top⦘ |