Metagenome Family F013268

Overview

Basic Information

• Family ID: F013268
• Family Type: Metagenome
• Number of Sequences: 272
• Average Sequence Length: 38 residues
• Representative Sequence: VFIIGLEKELLIKTGLIMKKKATRENMFGRKANGVQEV
• Number of Associated Samples: 80
• Number of Associated Scaffolds: 272

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 53.92 %
• % of genes near scaffold ends (potentially truncated): 11.76 %
• % of genes from short scaffolds (< 2000 bps): 75.00 %
• Associated GOLD sequencing projects: 79
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (54.779 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (94.118 % of family members)
• Environment Ontology (ENVO): Unclassified (94.485 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (94.485 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 53.03%
  β-sheet: 0.00%
  Coil/Unstructured: 46.97%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 272 Family Scaffolds
PF13650	Asp_protease_2	2.57

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.78 %
All Organisms	root	All Organisms	45.22 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.78 %
cellular organisms	root	All Organisms → cellular organisms	45.22 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.78 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	44.49 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.74 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.78 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	44.49 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.74 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.78 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	44.49 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.74 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.78 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	44.49 %
Aeromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales	0.74 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.78 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	44.49 %
Aeromonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae	0.74 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.78 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	44.49 %
Aeromonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas	0.74 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.78 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	44.49 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.74 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.78 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	44.49 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.74 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.78 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	44.49 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.74 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.78 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	44.49 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.74 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.78 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	39.34 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	5.15 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.74 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.78 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	39.34 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	5.15 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.74 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.78 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	39.34 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	5.15 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.74 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.78 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	39.34 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	5.15 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.74 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.78 %
malvids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids	39.34 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	5.15 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.74 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.78 %
Malvales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales	39.34 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	5.15 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.74 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.78 %
Malvaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae	39.34 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	5.15 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.74 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.78 %
Malvoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae	39.34 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	5.15 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.74 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.78 %
Gossypium	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium	39.34 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	5.15 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.74 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.78 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	39.34 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	4.41 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.74 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.78 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	39.34 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	4.41 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.74 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.78 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	39.34 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	1.47 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1.84 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.74 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.78 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	39.34 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1.47 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1.84 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.74 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300009148|Ga0105243_12744818	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	533
3300011119|Ga0105246_12379340	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	519
3300013296|Ga0157374_11112141	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	811
3300013296|Ga0157374_12148979	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	585
3300013297|Ga0157378_11073309	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	841
3300013297|Ga0157378_12400652	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	579
3300014745|Ga0157377_10640712	Not Available	763
3300015267|Ga0182122_1052846	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	551
3300015268|Ga0182154_1011526	Not Available	828
3300015268|Ga0182154_1049412	Not Available	564
3300015268|Ga0182154_1054708	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	548
3300015269|Ga0182113_1031243	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	706
3300015269|Ga0182113_1086707	Not Available	521
3300015269|Ga0182113_1094529	Not Available	507
3300015274|Ga0182188_1020844	Not Available	669
3300015274|Ga0182188_1024739	Not Available	640
3300015274|Ga0182188_1060881	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	506
3300015275|Ga0182172_1057279	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	549
3300015276|Ga0182170_1022432	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	714
3300015276|Ga0182170_1054552	Not Available	558
3300015276|Ga0182170_1073109	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	512
3300015277|Ga0182128_1044906	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	594
3300015277|Ga0182128_1063376	Not Available	538
3300015279|Ga0182174_1030303	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	681
3300015281|Ga0182160_1052126	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	579
3300015282|Ga0182124_1024426	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	708
3300015282|Ga0182124_1056950	Not Available	561
3300015282|Ga0182124_1076001	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	515
3300015282|Ga0182124_1076222	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	515
3300015283|Ga0182156_1035302	Not Available	657
3300015283|Ga0182156_1052915	Not Available	586
3300015283|Ga0182156_1056240	Not Available	576
3300015283|Ga0182156_1069322	Not Available	540
3300015283|Ga0182156_1070729	Not Available	537
3300015283|Ga0182156_1083811	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	510
3300015285|Ga0182186_1042469	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	613
3300015285|Ga0182186_1057206	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	562
3300015285|Ga0182186_1070254	Not Available	529
3300015286|Ga0182176_1036236	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	659
3300015286|Ga0182176_1046220	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	612
3300015286|Ga0182176_1047607	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	606
3300015286|Ga0182176_1071339	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	533
3300015286|Ga0182176_1073443	Not Available	528
3300015288|Ga0182173_1054150	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	578
3300015289|Ga0182138_1018615	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	783
3300015289|Ga0182138_1027981	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	701
3300015289|Ga0182138_1030053	Not Available	688
3300015292|Ga0182141_1027115	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	722
3300015292|Ga0182141_1032563	Not Available	686
3300015292|Ga0182141_1091706	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	507
3300015294|Ga0182126_1069372	Not Available	555
3300015294|Ga0182126_1072880	Not Available	547
3300015295|Ga0182175_1042554	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	646
3300015295|Ga0182175_1089688	Not Available	517
3300015295|Ga0182175_1092184	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	513
3300015295|Ga0182175_1095760	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	507
3300015296|Ga0182157_1010632	Not Available	968
3300015296|Ga0182157_1050986	Not Available	623
3300015296|Ga0182157_1075218	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	554
3300015296|Ga0182157_1077898	Not Available	549
3300015298|Ga0182106_1046717	Not Available	639
3300015298|Ga0182106_1051903	Not Available	620
3300015298|Ga0182106_1059657	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	595
3300015298|Ga0182106_1102264	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	503
3300015299|Ga0182107_1019171	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	826
3300015299|Ga0182107_1021374	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	801
3300015299|Ga0182107_1024751	Not Available	769
3300015299|Ga0182107_1070609	Not Available	568
3300015299|Ga0182107_1086702	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	533
3300015300|Ga0182108_1058830	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	605
3300015300|Ga0182108_1060128	Not Available	601
3300015300|Ga0182108_1065089	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	586
3300015302|Ga0182143_1032244	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	712
3300015302|Ga0182143_1075625	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	556
3300015302|Ga0182143_1082247	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	542
3300015302|Ga0182143_1102137	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	506
3300015303|Ga0182123_1073829	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	549
3300015305|Ga0182158_1021245	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	798
3300015305|Ga0182158_1046879	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	640
3300015305|Ga0182158_1057936	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	602
3300015305|Ga0182158_1065261	Not Available	581
3300015305|Ga0182158_1100894	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	508
3300015307|Ga0182144_1050888	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	633
3300015307|Ga0182144_1102816	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	511
3300015308|Ga0182142_1015816	Not Available	902
3300015308|Ga0182142_1021337	Not Available	829
3300015308|Ga0182142_1063080	Not Available	606
3300015308|Ga0182142_1079337	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	565
3300015308|Ga0182142_1115609	Not Available	502
3300015314|Ga0182140_1007473	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	1106
3300015314|Ga0182140_1087025	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	551
3300015314|Ga0182140_1087886	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	549
3300015321|Ga0182127_1032157	Not Available	762
3300015322|Ga0182110_1072929	Not Available	596
3300015323|Ga0182129_1032012	Not Available	738
3300015323|Ga0182129_1069390	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	588
3300015323|Ga0182129_1112130	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	508
3300015341|Ga0182187_1102845	Not Available	639
3300015341|Ga0182187_1118103	Not Available	609
3300015341|Ga0182187_1125179	Not Available	597
3300015341|Ga0182187_1145605	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	565
3300015341|Ga0182187_1195046	Not Available	507
3300015342|Ga0182109_1095266	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	692
3300015342|Ga0182109_1141253	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	599
3300015342|Ga0182109_1191096	Not Available	534
3300015343|Ga0182155_1160064	Not Available	571
3300015343|Ga0182155_1176387	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	551
3300015343|Ga0182155_1204090	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	521
3300015344|Ga0182189_1110856	Not Available	660
3300015344|Ga0182189_1128374	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	626
3300015344|Ga0182189_1171541	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	562
3300015344|Ga0182189_1182968	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	548
3300015345|Ga0182111_1150811	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	607
3300015345|Ga0182111_1151961	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	606
3300015345|Ga0182111_1204138	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	540
3300015345|Ga0182111_1213757	Not Available	530
3300015345|Ga0182111_1230433	Not Available	514
3300015346|Ga0182139_1132512	Not Available	638
3300015346|Ga0182139_1223105	Not Available	522
3300015346|Ga0182139_1225143	Not Available	520
3300015347|Ga0182177_1220216	Not Available	527
3300015347|Ga0182177_1232463	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	516
3300015351|Ga0182161_1072349	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	838
3300015351|Ga0182161_1142891	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	646
3300015351|Ga0182161_1181978	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	587
3300015351|Ga0182161_1261591	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	506
3300015355|Ga0182159_1202678	Not Available	639
3300015355|Ga0182159_1222927	Not Available	613
3300015355|Ga0182159_1245759	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	588
3300015355|Ga0182159_1341716	Not Available	508
3300015361|Ga0182145_1059781	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	745
3300015361|Ga0182145_1190235	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	506
3300017404|Ga0182203_1056134	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	710
3300017404|Ga0182203_1110718	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	573
3300017404|Ga0182203_1111762	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	571
3300017404|Ga0182203_1123719	Not Available	552
3300017404|Ga0182203_1143424	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	525
3300017407|Ga0182220_1028410	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	727
3300017407|Ga0182220_1077854	Not Available	553
3300017407|Ga0182220_1092460	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	526
3300017409|Ga0182204_1081346	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	567
3300017409|Ga0182204_1083585	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	562
3300017411|Ga0182208_1092656	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	559
3300017411|Ga0182208_1107460	Not Available	534
3300017411|Ga0182208_1118756	Not Available	517
3300017413|Ga0182222_1019392	Not Available	781
3300017413|Ga0182222_1030074	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	701
3300017413|Ga0182222_1090600	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	527
3300017415|Ga0182202_1082614	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	596
3300017415|Ga0182202_1099521	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	561
3300017415|Ga0182202_1125776	Not Available	519
3300017415|Ga0182202_1133868	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	509
3300017415|Ga0182202_1136743	Not Available	505
3300017417|Ga0182230_1065890	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	644
3300017420|Ga0182228_1044604	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	747
3300017420|Ga0182228_1093537	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	565
3300017424|Ga0182219_1073361	Not Available	615
3300017424|Ga0182219_1137790	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	505
3300017425|Ga0182224_1038290	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	795
3300017425|Ga0182224_1043366	Not Available	766
3300017425|Ga0182224_1080468	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	634
3300017427|Ga0182190_1139122	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	533
3300017427|Ga0182190_1155829	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	512
3300017430|Ga0182192_1131543	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	554
3300017430|Ga0182192_1145356	Not Available	534
3300017433|Ga0182206_1074958	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	640
3300017433|Ga0182206_1075204	Not Available	639
3300017433|Ga0182206_1110544	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	566
3300017438|Ga0182191_1098078	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	621
3300017438|Ga0182191_1113098	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	592
3300017442|Ga0182221_1050551	Not Available	732
3300017442|Ga0182221_1073781	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	652
3300017442|Ga0182221_1133115	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	544
3300017442|Ga0182221_1134227	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	542
3300017443|Ga0182193_1048868	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	802
3300017443|Ga0182193_1127445	Not Available	586
3300017443|Ga0182193_1128733	Not Available	584
3300017680|Ga0182233_1101960	Not Available	532
3300017681|Ga0182226_1063271	Not Available	676
3300017682|Ga0182229_1077160	Not Available	577
3300017682|Ga0182229_1081789	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	562
3300017682|Ga0182229_1084580	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	554
3300017682|Ga0182229_1089332	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	540
3300017683|Ga0182218_1086582	Not Available	601
3300017683|Ga0182218_1088783	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	596
3300017684|Ga0182225_1060564	Not Available	658
3300017684|Ga0182225_1067049	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	638
3300017684|Ga0182225_1094362	Not Available	574
3300017685|Ga0182227_1057668	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	699
3300017685|Ga0182227_1100514	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	563
3300017685|Ga0182227_1128802	Not Available	513
3300017686|Ga0182205_1118011	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	572
3300017686|Ga0182205_1140310	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	538
3300017686|Ga0182205_1170149	Not Available	503
3300017689|Ga0182231_1079354	Not Available	625
3300017689|Ga0182231_1120040	Not Available	514
3300017689|Ga0182231_1126751	Not Available	501
3300017690|Ga0182223_1024992	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	778
3300017690|Ga0182223_1061784	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	611
3300021060|Ga0182232_1075972	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	547
3300025908|Ga0207643_10518768	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	763
3300026089|Ga0207648_10787283	Not Available	885
3300026089|Ga0207648_12166066	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	517
3300026118|Ga0207675_102072695	Not Available	586

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	94.49%
Rhizosphere	Host-Associated → Plants → Rhizosphere	4.04%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.47%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	94.49%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	4.04%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.47%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	94.49%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	4.04%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.47%

Habitat

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	94.12%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.21%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.84%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.10%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.37%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	0.37%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated
3300017681	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated
3300021060	Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG	Host-Associated
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0105245_122428751	3300009098	Miscanthus Rhizosphere	MIVFVSELLIKTRLIMKKRVMRKSMFGRKGNGVLEV*
Ga0105245_130417512	3300009098	Miscanthus Rhizosphere	MIDWKKELLTKTGLIMKKEATRKNAFGRKANGAPED*
Ga0105243_127448181	3300009148	Miscanthus Rhizosphere	MEVFIIGWEKELLTRTGLIMKGKATKENMFGRRANGV*
Ga0105243_130711681	3300009148	Miscanthus Rhizosphere	MIGWEKELLTKTGLIMKKKATRKNTFGRKANGALED*
Ga0105246_123793402	3300011119	Miscanthus Rhizosphere	IIGWENELSIKIGLIMKKKATRENMFGRKANGVQEV*
Ga0157374_111121411	3300013296	Miscanthus Rhizosphere	VFKIGLENELLNKTGLIMKKRAMRENIFGRKVNGVQEV*
Ga0157374_121489791	3300013296	Miscanthus Rhizosphere	MDWRLKMEVFMIGLEKELLIKTELILKATRENMFGRKANGVQEV*
Ga0157378_110733092	3300013297	Miscanthus Rhizosphere	MEVFIIGWEKELLTKIGLIMKEKAMGENMFGRKANGVQEV*
Ga0157378_124006521	3300013297	Miscanthus Rhizosphere	MEVFIIGLEKELLIKTELIMKKKATRENMFGRKTNGV*
Ga0157377_106407121	3300014745	Miscanthus Rhizosphere	MIGLENELLIKTGLIMKKKVMRKNMFGRKANGVQEV*
Ga0182122_10528461	3300015267	Miscanthus Phyllosphere	IKVFIIGLENELLTKTGLIMKKATRKDMFCKKANGV*
Ga0182122_10601601	3300015267	Miscanthus Phyllosphere	MIGWEKESLAKTGPIMKKKATRKNTFGRKANGALED*
Ga0182154_10115263	3300015268	Miscanthus Phyllosphere	MEVFIIGWEKELLTRTGPIMKKKATKENMFGRKANDVQED*
Ga0182154_10494122	3300015268	Miscanthus Phyllosphere	MEVFIIGWEKELLTKTGLIMKKKVMRENMSDKKANGAQEV*
Ga0182154_10547082	3300015268	Miscanthus Phyllosphere	MIGLEKELLARTRLIMKRKAMKENMFGRKANDVQEV*
Ga0182113_10312431	3300015269	Miscanthus Phyllosphere	MEVFIIGLEKELLIKTGLIMKKKVLKKNMFGRKANGVQGV*
Ga0182113_10867072	3300015269	Miscanthus Phyllosphere	MEVFMIGLESELLTKTGLIMEKKATKENMFDRKANGVQEV*
Ga0182113_10945291	3300015269	Miscanthus Phyllosphere	MIVLENEWLIRTGLIMKKKAMRENMFGKKASGVQEV*
Ga0182113_10970851	3300015269	Miscanthus Phyllosphere	IKVFMIGWERELLTKTRLIMKKETIRGNMFGRKANGAPEV*
Ga0182188_10009392	3300015274	Miscanthus Phyllosphere	MIGREKELLTKTGLIMKKEATRGNMFGRKANGAPEV*
Ga0182188_10067281	3300015274	Miscanthus Phyllosphere	MIDWEKELLTKTGLIMKKKAMRENMFGKKANGAQEV*
Ga0182188_10208442	3300015274	Miscanthus Phyllosphere	MIGLENELLIKTGLIMKVMKNDVFGRKANGVQEV*
Ga0182188_10247391	3300015274	Miscanthus Phyllosphere	MIGLENELLIKTRLIMKKNIMRENMFGRKTNGVQEV*
Ga0182188_10608812	3300015274	Miscanthus Phyllosphere	MIGWEKELLTRTGLIMKRKAMKENMFGRKASGAQEV*
Ga0182172_10572793	3300015275	Miscanthus Phyllosphere	MIGWEKELLTKTGLIIKKKATRKSTFGRKANGAPEE*
Ga0182172_10763361	3300015275	Miscanthus Phyllosphere	MIDWEKELLTKTGLIMKKEATRGNMSGRKANGAPED*
Ga0182170_10064742	3300015276	Miscanthus Phyllosphere	MIGWERELLTKTRLIMKKETTRGNMFGRKANGAPEV*
Ga0182170_10171132	3300015276	Miscanthus Phyllosphere	MIGWEKELLTKTGLIMKKEATRGNMSGRKANGASED*
Ga0182170_10224322	3300015276	Miscanthus Phyllosphere	MEVFIIGMEKELLIKTRLIMKKATRKDMFGRKANCVQEV*
Ga0182170_10545523	3300015276	Miscanthus Phyllosphere	MIGLGTELSIKTRLIMKKTVMKENMSDRKANGVQEV*
Ga0182170_10678652	3300015276	Miscanthus Phyllosphere	MIGWEKELLTKTGLIMEKEATKGSMSGRKANGVQEV*
Ga0182170_10731091	3300015276	Miscanthus Phyllosphere	MIGLENELLTKTGLIMKKRVMRKNTFGRKANGVQEV*
Ga0182170_10733441	3300015276	Miscanthus Phyllosphere	MIGWEKELLTKTGLIMKKEATRKNTFGRKANGAPED*
Ga0182128_10103631	3300015277	Miscanthus Phyllosphere	MISWEKELLTKTGLIMKKKATRKSTFGREANGAPED*
Ga0182128_10449063	3300015277	Miscanthus Phyllosphere	MDRRLKIEVFMIGLESELLIKTRLIMEKKIIKKNMFGRKVNGVQEV*
Ga0182128_10633762	3300015277	Miscanthus Phyllosphere	MIGWEKELLTKIGLIVKKEATRKNTFGRKANGAPEN
Ga0182174_10303031	3300015279	Miscanthus Phyllosphere	MEVFMIGLGNELLIKTGLIMKVMKKNVFGRKANGVQEV*
Ga0182174_10306782	3300015279	Miscanthus Phyllosphere	MIGGEKELWTKTGLIMKKKATRKSTFGRKANGAPED*
Ga0182160_10437313	3300015281	Miscanthus Phyllosphere	MEVFIIDWEKELLIKTGLIMKKRATRENMSGRKANGA*
Ga0182160_10521262	3300015281	Miscanthus Phyllosphere	MEVFIIGLEKELLIKTGLIMKKKVTRENMFGKKANGVQGV*
Ga0182160_10561462	3300015281	Miscanthus Phyllosphere	VFTIGWEKELLTKTRLIMKKAMRENMFGKKANGAQGV*
Ga0182124_10158592	3300015282	Miscanthus Phyllosphere	MIGWEKELLTKTGLIMKREATIGNMFGRKTNGAPEV*
Ga0182124_10244262	3300015282	Miscanthus Phyllosphere	MIGLEKELLIKTGLITKKEVMKENMFDRKANGVQKV*
Ga0182124_10569502	3300015282	Miscanthus Phyllosphere	FIIGLGNELLTKTRLIMKKNATRKDMFGRKANGVQEV*
Ga0182124_10760012	3300015282	Miscanthus Phyllosphere	MEMFIIGWEKEWLIKTRLIMKRRAMRENIFGRKANGV*
Ga0182124_10762222	3300015282	Miscanthus Phyllosphere	MDRRLKIEVFMIGLESELLIKTGLIMKKKVMRRSMFGRKGNGVKEV*
Ga0182156_10353022	3300015283	Miscanthus Phyllosphere	MIGWEKELLTKTELIMKKEATRGNMFGRKANGASED*
Ga0182156_10461683	3300015283	Miscanthus Phyllosphere	MIGWKKESLTKAGLIMKKKATRKNTFDRKANGALED*
Ga0182156_10529153	3300015283	Miscanthus Phyllosphere	MIGWEKELLTKSGLIMKKEATRGNMSGRKANGALED*
Ga0182156_10562401	3300015283	Miscanthus Phyllosphere	MEVFIIGWEKELLIKTGLIMKKKVMRENMFGRKANGVQKV*
Ga0182156_10693221	3300015283	Miscanthus Phyllosphere	MIGLESELIKTGLIMKKKVMRKNMFGRKANDIQEV*
Ga0182156_10707291	3300015283	Miscanthus Phyllosphere	MIGLESELLIKTGLIVRKKVMRKDMFGRKANGVQEV*
Ga0182156_10823301	3300015283	Miscanthus Phyllosphere	MIGWEKELLTKTGLIMKKKATRKRTFGRKANGDLAD*
Ga0182156_10838112	3300015283	Miscanthus Phyllosphere	MEVFIIGWEKELLIKTGLIMKKRATKENMFGRKANGVQ
Ga0182186_10210492	3300015285	Miscanthus Phyllosphere	MIGLGSELLIKTRPIMKKEVMRKSMFSRKGNGVQEV*
Ga0182186_10424692	3300015285	Miscanthus Phyllosphere	MEVFIIGMEKELLIKTRLIMKKKVTRENMFGKKANGVQEV*
Ga0182186_10572062	3300015285	Miscanthus Phyllosphere	MEALMISLEKELFTKTGTIMKKKATRGNMFGRKANGVQKV*
Ga0182186_10702541	3300015285	Miscanthus Phyllosphere	VFIIGWEKEWLIKTGLIMKKRATRENIFSRKANDVQEV*
Ga0182176_10362362	3300015286	Miscanthus Phyllosphere	MEVFVIGWEKELLTRTGLIMKRKAMKENMFGRKANGVPEV*
Ga0182176_10462202	3300015286	Miscanthus Phyllosphere	MLKKIEVFIIGWERELLTRTGLIMKKKATKENMFGRKANGV*
Ga0182176_10476072	3300015286	Miscanthus Phyllosphere	MEMFIIGLEKELLINTELIMKKKVTRKNTFGRKANGLQEV*
Ga0182176_10713392	3300015286	Miscanthus Phyllosphere	MDRRLKIEVFIIGLGSELLIKTKLIMKKKVMRKSMFGRKGNGA*
Ga0182176_10734432	3300015286	Miscanthus Phyllosphere	MIGLESELLIKTRLVMEKKIMKESMIGRKANDVQEV*
Ga0182171_10154561	3300015287	Miscanthus Phyllosphere	MIGWKRELLNKTGLIMKKETIRGNMFGRKANGAPEV
Ga0182173_10187131	3300015288	Miscanthus Phyllosphere	MIGWERELLTKTRLIMKKETIRGNMFGRKANGAPEV*
Ga0182173_10216642	3300015288	Miscanthus Phyllosphere	MIGWGKELLTKTGLIMKKEATKGNMSGRRANGALED*
Ga0182173_10398521	3300015288	Miscanthus Phyllosphere	MIGWEKELLTKTGLIMKREAMKENMFGKKANGIQED*
Ga0182173_10541501	3300015288	Miscanthus Phyllosphere	MDQRLKIEVFMIGLESELLIKTGLIMEKKIVKKNMFGKKGNGV*
Ga0182138_10186152	3300015289	Miscanthus Phyllosphere	MIGLENELWTKTGLIMKKKAMKENMFGRKANGVQEV*
Ga0182138_10279811	3300015289	Miscanthus Phyllosphere	MIGLGSELLIKTRLITKKKVMRKNMFGRKGNGVQEV
Ga0182138_10300531	3300015289	Miscanthus Phyllosphere	MIGLESELLIEIGLIMKKKVMMKNMFGRKANGVQEI*QEGTIDQ*
Ga0182141_10271153	3300015292	Miscanthus Phyllosphere	MIGWDKELLTKTGLIMKKQATRGSVSGRKANGAPED*
Ga0182141_10325633	3300015292	Miscanthus Phyllosphere	VFIIGSEKELLIKTGLIMKKKAMGENMFGRKANGV*
Ga0182141_10335742	3300015292	Miscanthus Phyllosphere	MIGWEKELLTKTGLIMKKETTRGNIFGRKANGAPEV*
Ga0182141_10917062	3300015292	Miscanthus Phyllosphere	MKVFMINMENELLTKTGLIMKKKAMRENMFGRKANGVQED*
Ga0182126_10693721	3300015294	Miscanthus Phyllosphere	MEVFIIGWEKELLIKTGLIMKKATRENMFDRKANGVQEV*
Ga0182126_10728803	3300015294	Miscanthus Phyllosphere	IGLESELLIKTGLIMEKKIMRKNMFGRKGNGVLEV*
Ga0182175_10425541	3300015295	Miscanthus Phyllosphere	MEVFIIGWEKELLTRTRLIMKKKAMRENIFGRKANGV*
Ga0182175_10896881	3300015295	Miscanthus Phyllosphere	MEVFIIGLKKELLIKTGLITKKEVMKEDMFGRKANDVREV*
Ga0182175_10921843	3300015295	Miscanthus Phyllosphere	MGVFIIGLEKELLIKTGLIMKKKVMRENMFGRKANGV*
Ga0182175_10957601	3300015295	Miscanthus Phyllosphere	MEVFIIGWEKELLIKTRLIMKKKAMIENMFDRKANGVQKV*
Ga0182157_10106322	3300015296	Miscanthus Phyllosphere	GLENELLTKTGLIMKKKAMRENMFGRKANGVQED*
Ga0182157_10509861	3300015296	Miscanthus Phyllosphere	MIGLENELLIKTGLIMKKKVMRKNMFGRKANGVQE
Ga0182157_10752182	3300015296	Miscanthus Phyllosphere	MIGWEKELLTKTRLIMKKEVARGNMSSRKANGALED*
Ga0182157_10778981	3300015296	Miscanthus Phyllosphere	MEVFIIGWEKESSIKIGRIMKKKATRENMFGRKANG
Ga0182157_11015131	3300015296	Miscanthus Phyllosphere	MIGWKKELLTKTGLIMKKEATRKNAFGRKANGASED*
Ga0182106_10467171	3300015298	Miscanthus Phyllosphere	MEVFIIGLEKELLIKTRLIMEKKVMKKNMFGRKANGVQEV*
Ga0182106_10519031	3300015298	Miscanthus Phyllosphere	MFMIGLGSELLIRTELIIKKRVMKKNMFGRKASGVQEV*
Ga0182106_10596571	3300015298	Miscanthus Phyllosphere	MIGWEKESLTKAGSIMKKKATREDAFGRKANGAPED*
Ga0182106_10820381	3300015298	Miscanthus Phyllosphere	MIGLGSEMLIKTGLIMKKKVMRKSMFGRKANGVQEV*
Ga0182106_10950121	3300015298	Miscanthus Phyllosphere	KVFMIGWEKELLTKTGLIMKKEATRGNMFGRKTNGAPED*
Ga0182106_11022642	3300015298	Miscanthus Phyllosphere	MEVFIIGWEKELFIKTGLIVKKTMKESIFSRKTNGAQEV*
Ga0182107_10191711	3300015299	Miscanthus Phyllosphere	MEVFIIGWEKELLTKTGLIMKKKATRENMFGKKTNGVQEV*
Ga0182107_10213741	3300015299	Miscanthus Phyllosphere	MEVFMIGLGKELFIKTGLIMKATRENMFGRKANGVQEV*
Ga0182107_10247512	3300015299	Miscanthus Phyllosphere	MEVFIIGLEKELLIKAGLIMKKKVMRENMFSRKAND
Ga0182107_10706092	3300015299	Miscanthus Phyllosphere	MISWEKELLTKTGLIMKKEATRGDMSGRRANGALKD*
Ga0182107_10867021	3300015299	Miscanthus Phyllosphere	MIGLGNELLIKIGLIMKKKVMRKNMFGRKANGIQEV*
Ga0182108_10588303	3300015300	Miscanthus Phyllosphere	MEVFIIGLEKELLIKTGLIMKKKATRENMFGRKANGVQEV*
Ga0182108_10601281	3300015300	Miscanthus Phyllosphere	MIGLENELLIKTRLIIKVMKENIFGRKANGVQEV*
Ga0182108_10650892	3300015300	Miscanthus Phyllosphere	VFIISWEKRELLTRTRLIIKKKATKENMFGRKANGVQEV*
Ga0182108_10675652	3300015300	Miscanthus Phyllosphere	MIGWEKGLLAKTGLIMKKKATKGSMSGRKANGAPED*
Ga0182108_10847861	3300015300	Miscanthus Phyllosphere	MIGWEKELLTKTRLIMKKEATRGNMSGRRANGAPED
Ga0182143_10322441	3300015302	Miscanthus Phyllosphere	KMEVFIIGLERELLIKTGLIKKKRATRKNTFGRKANGVHEV*
Ga0182143_10721532	3300015302	Miscanthus Phyllosphere	IGWEKELLTKTGLILKKEVTKGSMSDRKANGALEG*
Ga0182143_10756251	3300015302	Miscanthus Phyllosphere	MEVFIIGWEKELLTRTGLITKKKAMKENMFGRKANGV
Ga0182143_10822471	3300015302	Miscanthus Phyllosphere	MEVFIIGWEKELLTRTRLIMKRKATKENMFGRKANGVQEV*
Ga0182143_11021371	3300015302	Miscanthus Phyllosphere	MIGWEKELLTKTGLIMKKEATRKNTFGRKANGALED*
Ga0182123_10738292	3300015303	Miscanthus Phyllosphere	MISWEKELLTMTRVIMKKEVTRGNMFGRKANGVLEV*
Ga0182123_10997201	3300015303	Miscanthus Phyllosphere	MISWEKELLTKTGLIMKKEATRGNMFGRKANGALEV*
Ga0182112_10273522	3300015304	Miscanthus Phyllosphere	MIGWEKELLTKTGLIMKKEATRGNMFGRKANGALEV*
Ga0182112_10630851	3300015304	Miscanthus Phyllosphere	LKIEVFKIGWEKELWIKTGLIVKKRVIRENMFGRRANGALED*
Ga0182158_10212451	3300015305	Miscanthus Phyllosphere	MEVFIIGLEKELLIKTGLIMKKATRENMFGRKANGVQEV*
Ga0182158_10468793	3300015305	Miscanthus Phyllosphere	MEVFMIGWEKELLNKTRLIMKKREMRENMFGRKANGVQEV*
Ga0182158_10579363	3300015305	Miscanthus Phyllosphere	MIGLENELLTKTGLIMKKRAMRENIFGRKVNGVQEV*
Ga0182158_10652611	3300015305	Miscanthus Phyllosphere	MEVFIIGLEKELLIKTRLIMKKEATRENMFGRKANGVQKV*
Ga0182158_11008942	3300015305	Miscanthus Phyllosphere	MIGLENKLLIKTGLIMKREVMKKNMFGRKANGVQEV*
Ga0182144_10508881	3300015307	Miscanthus Phyllosphere	KIEVFMIGLENELLIKTGLLTKKKVMRKNMFGRKANGV*
Ga0182144_10579961	3300015307	Miscanthus Phyllosphere	MIDWEKELLTKTGLIMKKKATRKSTFGRKANGAPEE*
Ga0182144_10898231	3300015307	Miscanthus Phyllosphere	MIGWGKESLTKAGPIMNKKATREDTFGRKANGALEV*
Ga0182144_11028163	3300015307	Miscanthus Phyllosphere	GLESELLTKTGLIIKRKATKENMFGRKADGVKEV*
Ga0182142_10158161	3300015308	Miscanthus Phyllosphere	MIGWEKELLTKTGLIMKKEATRKNTFGRKANGAPKD*
Ga0182142_10213374	3300015308	Miscanthus Phyllosphere	MEVFIIGLEKELLIKTRLIMEKKVMKKNMFSRKANGVQEV*
Ga0182142_10630802	3300015308	Miscanthus Phyllosphere	MEVFIIGWEKGLLTRTRLIMKGKATKENMFGRRANGVQEV*
Ga0182142_10693711	3300015308	Miscanthus Phyllosphere	MEVFIIGWEKGLLTKTGLIMEKKAMRGNMFGRKANGVQEV*
Ga0182142_10793372	3300015308	Miscanthus Phyllosphere	MIILGSELLIKTGLIMKKKIMRKNMFGRKGNGVQEV*
Ga0182142_10950612	3300015308	Miscanthus Phyllosphere	MIGWEKELLTKTGLIMKNEATRGNMFGRKANGAPEV*
Ga0182142_11121581	3300015308	Miscanthus Phyllosphere	MIGLGSELLIKIGLLMKEKVMRKSMFGRRGNGVQEV*
Ga0182142_11156091	3300015308	Miscanthus Phyllosphere	MIGLESKLLIKTRLIMKRKVMKKNMFGRKANGAQEV*
Ga0182140_10074733	3300015314	Miscanthus Phyllosphere	MEVFKIGWEKELLTKTGLIMKKKATRKSTFGREANGAPED*
Ga0182140_10870251	3300015314	Miscanthus Phyllosphere	MEVFMIGLENELLIKTGLIMKKGVIRKNMFGREGNGVQEV*
Ga0182140_10878861	3300015314	Miscanthus Phyllosphere	MKVFIIGWEKELSIKIGLIMRKKATRENMFGRKVNGVQEV*
Ga0182127_10321571	3300015321	Miscanthus Phyllosphere	MIVLEKELFTKTGLIMKKEAIRENMFGRKANGVQEV*
Ga0182110_10729292	3300015322	Miscanthus Phyllosphere	MEMFIIGLEKELLIKTRLIMKKKATRENIFGRKVNGV*
Ga0182110_11074552	3300015322	Miscanthus Phyllosphere	IGLENELLTKTGLIMKKKAMRENMSGRKANGVQEV*
Ga0182129_10320121	3300015323	Miscanthus Phyllosphere	MEAFIIDWEKELLTRTRLIMKRKTMKENMFGRKANGVQEV*
Ga0182129_10693902	3300015323	Miscanthus Phyllosphere	MEVFIISWEKELSIKIGLIMKKKATRENMFGRKANGVQEV*
Ga0182129_11121302	3300015323	Miscanthus Phyllosphere	MIGLENELLTKTRLIMKKKATKEIMFGRKANGVQEV*
Ga0182187_11028451	3300015341	Miscanthus Phyllosphere	MIGLENELLIKTGLIMKKKVMKKNIFGRKANGVQEV*
Ga0182187_11181032	3300015341	Miscanthus Phyllosphere	MDRRLKIEMFIIGWEKELLVKTGWIMKKKVMKKNMFGRKANGVQEV*
Ga0182187_11251791	3300015341	Miscanthus Phyllosphere	MIGLESELLIKTRLIMKKKVIRKNMFGRKASGVQEV*
Ga0182187_11456052	3300015341	Miscanthus Phyllosphere	MEVFIIGWEKELSLKIGLIMKKKATRENMFGRKANGVQEV*
Ga0182187_11950462	3300015341	Miscanthus Phyllosphere	MIGWESELLIKTGLIMKKIVKKNTFGRKGNGVQEV*
Ga0182109_10952663	3300015342	Miscanthus Phyllosphere	MLGLENELLTKTRLIMRKKVMKKSMFGRKANGVQEV
Ga0182109_11412532	3300015342	Miscanthus Phyllosphere	MEVFIIGWEKELLTKTGLIMKKKATKENMFGRRANGVQEV*
Ga0182109_11599782	3300015342	Miscanthus Phyllosphere	MIGWEKELLTKTGLIIKKEATKGSMSGRKANGAPED*
Ga0182109_11808453	3300015342	Miscanthus Phyllosphere	MIGLENELLTKTGMIMKKKAMRKNMSGRKANGAQEV*QEARRE
Ga0182109_11910962	3300015342	Miscanthus Phyllosphere	MEVSIIGWEKEWLIKTRLIMKKRATRENTFGRKANGV*
Ga0182109_12184141	3300015342	Miscanthus Phyllosphere	FMIGWEKELLTKTGLIMKKEATRWNMSGRKANGAPED*
Ga0182155_11558081	3300015343	Miscanthus Phyllosphere	KIKVFMIGWEKELLTKTGLIMKKEATRKNTFGRKANGAPED*
Ga0182155_11600642	3300015343	Miscanthus Phyllosphere	MDQRLKIKVLMLGLENELLTKSGLIMKKKATKGNMFGSKANGVQEV*
Ga0182155_11763872	3300015343	Miscanthus Phyllosphere	MIGLESELLIKTGLIMKNKVMRKNMLGKKANGVQEV*
Ga0182155_12040902	3300015343	Miscanthus Phyllosphere	IGLEKELLIKTGLIMKKKVTRENMFGKKANGVQEV*
Ga0182189_11108561	3300015344	Miscanthus Phyllosphere	MIGLENELLIKTGLIMKKKVMRKNMFGRKANDIQEV*
Ga0182189_11283741	3300015344	Miscanthus Phyllosphere	MIGLEKELLTRTELITKRKAMKENMFGRRVNGVQEV*
Ga0182189_11611602	3300015344	Miscanthus Phyllosphere	MIGWEKELLTKTRLIMKKEATRENMSGRRANGAPED*
Ga0182189_11715412	3300015344	Miscanthus Phyllosphere	MKVFIISLEKELLIKTEQIMKKNATKENMFGRKANNV*
Ga0182189_11792841	3300015344	Miscanthus Phyllosphere	MISWEKELLTRTGLIMKKEATKGSMSGRKANGAPED*
Ga0182189_11829682	3300015344	Miscanthus Phyllosphere	MEVFIIGCEKELSIKIGLIMKKKTTRENMFGRKANGVQEG*
Ga0182111_11508112	3300015345	Miscanthus Phyllosphere	MEVFIIVLEKGLLIETGWIMKKKKATRENIFGRKANGVQEV*
Ga0182111_11519611	3300015345	Miscanthus Phyllosphere	MIGWEKELLTKTGLIMKKEATRGNMFGRKTNGAPED*
Ga0182111_12041381	3300015345	Miscanthus Phyllosphere	KMEVFMIGLENELLTKTRLVMRKKATRKNTFGRKANGAQEV*
Ga0182111_12066681	3300015345	Miscanthus Phyllosphere	MIGWEKELLTRTRLIMKKEATRGNMFGRKANGASEV*
Ga0182111_12137571	3300015345	Miscanthus Phyllosphere	MEVFIIGWKKELSVKIGLIMKKKATRENMFGRKANGVQEV*
Ga0182111_12304331	3300015345	Miscanthus Phyllosphere	MDRRLKMEVFIIGWEKELSIKIGLIMKKKATRENMF
Ga0182111_12438142	3300015345	Miscanthus Phyllosphere	MISWEKELLTKTGLIMKKEATRGNMSGRKANGAPED*
Ga0182139_10626022	3300015346	Miscanthus Phyllosphere	MKVFMIGWGKELLTKTGLIMKKEATKGSMSGRKANG
Ga0182139_11325121	3300015346	Miscanthus Phyllosphere	MEVFIIGLEKESLIKIGLIMKKKVTRENMFGRKANGVQEV*
Ga0182139_12231051	3300015346	Miscanthus Phyllosphere	MDRRLKMEVFMIGLKNELLTKTKLIMKKKTMRENMSGKKANGAQEV*
Ga0182139_12251431	3300015346	Miscanthus Phyllosphere	MEVFIIGLEKELLIKIGLIMKKKVMKKNMFGRKANGVQKV*
Ga0182177_11771882	3300015347	Miscanthus Phyllosphere	GWERELLTKIGLIIKKETIRGNMFGRKVNGAPEV*
Ga0182177_12202163	3300015347	Miscanthus Phyllosphere	MDQRLKIEVFMIVLGSNLLIQTGLIMKKKVMRKSMFGRKGNGVQ
Ga0182177_12324631	3300015347	Miscanthus Phyllosphere	MEVFIIGWEKELLTRTGLIMKKKAMRENMFGKKANGAQEV*
Ga0182161_10723492	3300015351	Miscanthus Phyllosphere	MEVFIISLEKELLIKTRLIMKKKATRENMFGRKANGV*
Ga0182161_11428911	3300015351	Miscanthus Phyllosphere	MIGLGRELLIKTRLIMKKRVMRKSIFGRKVNGVQEV*
Ga0182161_11819782	3300015351	Miscanthus Phyllosphere	MEVFIIGLEKELLIKTGLIMKKKVMRENMFGRKANGVQEV*
Ga0182161_12615912	3300015351	Miscanthus Phyllosphere	MEAYIIGWEKELLTRTRLIMKKKAMRENMFGRKTNGVQEV*
Ga0182159_12026782	3300015355	Miscanthus Phyllosphere	MIAWERELLTKTGLIMKKETIRENMFGRKANGALEV*
Ga0182159_12229271	3300015355	Miscanthus Phyllosphere	MEVFIISLEKELLIKTRLITKKKVMKKNKFGRKANGVHEV*
Ga0182159_12457591	3300015355	Miscanthus Phyllosphere	MDRRLKIEVFMIGLESELLIKTGLIMKKKVMRENMFGRKANGVQGV*
Ga0182159_12662292	3300015355	Miscanthus Phyllosphere	MIGWEKELLTKTGLIMRKEAARGNMSGRKANGAPED*
Ga0182159_13417162	3300015355	Miscanthus Phyllosphere	VFIIGWKKELLIRTGLIIKGKAIKENIFGRRANGV*
Ga0182145_10597812	3300015361	Miscanthus Phyllosphere	MIGLESELLIKTGLIVKKKVMRKDMFGGKGNGVLEV*
Ga0182145_11902351	3300015361	Miscanthus Phyllosphere	MEVFIIGWEKELLIRTGLIMKRETRENMFGRKANGVQEV*
Ga0182203_10561342	3300017404	Miscanthus Phyllosphere	MITRISASKMEVFIIGWEKELLTRTGLATKENMFGRRANGV
Ga0182203_11107182	3300017404	Miscanthus Phyllosphere	MEVFIIGCEKELSIKIGLIMKKKATRENLFGRKANGV
Ga0182203_11117623	3300017404	Miscanthus Phyllosphere	MIGLENELLTKTGLIMKKKAMRENMFGRKVNGVQEV
Ga0182203_11237191	3300017404	Miscanthus Phyllosphere	KMEVFIIGWEKELSIKIGLIMKKKATRENMFGRKANGV
Ga0182203_11434241	3300017404	Miscanthus Phyllosphere	MDRRLKMEVFIIGLEKELLIKTGLIMKKKATKENMFGRKANGV
Ga0182220_10284103	3300017407	Miscanthus Phyllosphere	MISLENELLTKTRLIMKKKAIRENMFGRKDNGVQEV
Ga0182220_10778543	3300017407	Miscanthus Phyllosphere	MEVFIISWEKELSTRTGLIMKKKATKEDMFGRKANGVQEV
Ga0182220_10924602	3300017407	Miscanthus Phyllosphere	MEVFMIGLEKELLIKTGLIIKATRENMFDRKANGVQEV
Ga0182204_10813462	3300017409	Miscanthus Phyllosphere	MTGLENELLTKTGLIMKKATKKNMFGRKANGVQEV
Ga0182204_10835852	3300017409	Miscanthus Phyllosphere	MEVFMIGLENELLIKTGLIMKKKVMKKNMFGRKANGVQEV
Ga0182204_10961181	3300017409	Miscanthus Phyllosphere	MIGWEKELLTKTGLIMKKEVTRANMFGRKANGAPEV
Ga0182207_10833502	3300017410	Miscanthus Phyllosphere	KVFMIGWEKELLTKTRLIMKKETTRGNMFGRKANGAPEV
Ga0182207_11359041	3300017410	Miscanthus Phyllosphere	MEVFIIGFEKELLIKTGLVMKKNAIRENMFGRKAN
Ga0182207_11449041	3300017410	Miscanthus Phyllosphere	IKVFMIGWEKELLTKTRLIMKKEATRGNMSGKRANGAPED
Ga0182208_10926563	3300017411	Miscanthus Phyllosphere	ALIIDWRSELLIKTGLIMKKKVMRKNMFGRKVNGV
Ga0182208_11074602	3300017411	Miscanthus Phyllosphere	MKVFMIGLENELLIKTRLIMKVMKKDVFGRKANGVQEV
Ga0182208_11187562	3300017411	Miscanthus Phyllosphere	MEVFIIGLEKELLIMTGLIMKKKATRENMFGRKANGVQEV
Ga0182222_10193921	3300017413	Miscanthus Phyllosphere	MEIFIIGLEKELLIKTRLIMKKRVTRENMFGRKANVVQEV
Ga0182222_10300742	3300017413	Miscanthus Phyllosphere	MIVLENELLTKTGLIMKKKAIRENVSGRKANGAQEV
Ga0182222_10382821	3300017413	Miscanthus Phyllosphere	MIGLENELLTKTGLIMKKKATKENMFGRKAYGVQEV
Ga0182222_10536522	3300017413	Miscanthus Phyllosphere	MIGWEKELLTKTGLIMKKEATKGSMSGRKVNGALED
Ga0182222_10906003	3300017413	Miscanthus Phyllosphere	MFIIGLEKELLIKTGLIMKKKVMRENMFGRKANGVQKV
Ga0182202_10826141	3300017415	Miscanthus Phyllosphere	EVSMIGLESELLIKTRLIMKKRVMRKNIFGRKGNGVQEV
Ga0182202_10995211	3300017415	Miscanthus Phyllosphere	MDRRLKIEVFMIGLESELLIKIGLIMKKKVMRKSMFGRKGNGVQEG
Ga0182202_11162961	3300017415	Miscanthus Phyllosphere	MIGWEKELLTKTGLIMKKEATRGNMFGMKANGALEV
Ga0182202_11257761	3300017415	Miscanthus Phyllosphere	MIGLENELLIKTGLIMKKKVMRKNMFGRKANDIQEV
Ga0182202_11338681	3300017415	Miscanthus Phyllosphere	MIGLENELLTKTRLIMKKRVTKKDMFGRKDNGAQEV
Ga0182202_11367431	3300017415	Miscanthus Phyllosphere	MEVSIIDWEKELLTRTRLIMKGKATKENIFGRRANGVQEV
Ga0182230_10658902	3300017417	Miscanthus Phyllosphere	VFIIGLEKELLIKTGWIMKKKVMKKNMFGRKANGVQEV
Ga0182228_10446042	3300017420	Miscanthus Phyllosphere	MIGLESELLIKTGLIMKKKVMKKNMFGRKANGVQEV
Ga0182228_10814631	3300017420	Miscanthus Phyllosphere	MIGWEKGLLAKTGLIMKKEAIKGSMSGRKANGAPED
Ga0182228_10935372	3300017420	Miscanthus Phyllosphere	MEVFMIGLEKELLIKSGLIMKATRENMFARKANGVQEV
Ga0182219_10733611	3300017424	Miscanthus Phyllosphere	MEVFIISWEKEWLIKTRLIMKKRATRENMFGRKVNGVQEV
Ga0182219_11377901	3300017424	Miscanthus Phyllosphere	MEVFMIGLENELLTKTRLVMKKKATKENMYGRKANGVQDV
Ga0182224_10382901	3300017425	Miscanthus Phyllosphere	VFIIGLEKELLIKTGLIMKKKATRENMFGRKANGVQEV
Ga0182224_10433662	3300017425	Miscanthus Phyllosphere	MDWCLKNKVFIIGLENELLTKTGLIMKKKATKEIMFGRKANGVQEA
Ga0182224_10804682	3300017425	Miscanthus Phyllosphere	MEVFIIGLEKELLIKTGLITKKEVMKENMFGRRANGVQEV
Ga0182224_11402371	3300017425	Miscanthus Phyllosphere	MIGLGSELLIKTRLIMKKKVMRKSMFGRKANGVQEV
Ga0182190_11391221	3300017427	Miscanthus Phyllosphere	MDRRLKMEVFIISLEKELLIKTGLITKKEVMKENMFGRKANGVQEV
Ga0182190_11558292	3300017427	Miscanthus Phyllosphere	MEMFIIGFEKELLIKTGLIMKKKVMNKNVFGRKANGVQEV
Ga0182192_11315431	3300017430	Miscanthus Phyllosphere	MDRRLKIEVFLIDLGNELLIKIGLIMKKKVMRKNMFDKKANGVQEV
Ga0182192_11453562	3300017430	Miscanthus Phyllosphere	VFIIGLEKELLIKTGLIMKKKATRKNMFGRKANDVREVWQEAKREG
Ga0182206_10749582	3300017433	Miscanthus Phyllosphere	VFIIGWEKVLLTKTGLIMKKKAMRENMFGKKANGAQEV
Ga0182206_10752042	3300017433	Miscanthus Phyllosphere	MEVFMIGLENELLIKTGLIMKKKVMRKNMFGRKANGVQEV
Ga0182206_11105442	3300017433	Miscanthus Phyllosphere	MEVFIIGLEKELLIKTGLITKKEVMKEDMFGRKDSGV
Ga0182191_10653592	3300017438	Miscanthus Phyllosphere	MIGWEKELLTKTELIMKKEATKGNMSSRKANGALED
Ga0182191_10980782	3300017438	Miscanthus Phyllosphere	MIGLENELLIKTGLIMKKKVMKKDVFGKKANGVQEV
Ga0182191_10990001	3300017438	Miscanthus Phyllosphere	MIGWEKELLTKIGLIMKKETTKGSMSSRKANGAPED
Ga0182191_11130982	3300017438	Miscanthus Phyllosphere	MEVFIISWEKELSIKIGLIMKKKATRENMFVRKANGVQEV
Ga0182221_10505513	3300017442	Miscanthus Phyllosphere	MIDWEKELLTKTGLIMKKEATRGNMSGRKANGSPED
Ga0182221_10737811	3300017442	Miscanthus Phyllosphere	MDRRLKIEVFMIGLESEMLIKTGLIMKKKVMRKNMFARKANGV
Ga0182221_11331151	3300017442	Miscanthus Phyllosphere	MEVFIIGLEKELLIKTGLITEKKSMRENMFGRKASGVQEV
Ga0182221_11342272	3300017442	Miscanthus Phyllosphere	MIGLENELLIKTVLIMKKKVIRKNMFGRKANDVQEV
Ga0182193_10488683	3300017443	Miscanthus Phyllosphere	MEVFIIGCEKELSIKIGLIMKKKAMKENRFGRKANGV
Ga0182193_11274451	3300017443	Miscanthus Phyllosphere	MEVFIIGWEKELLTKIGLIMKKATKENMFGRKANGVQEV
Ga0182193_11287332	3300017443	Miscanthus Phyllosphere	FIIGLEKELLIKAGLIMKKKVMRENMFSRKANDVQEV
Ga0182233_10854722	3300017680	Miscanthus Phyllosphere	MIGWEKELLTKTGLIMKKEATRGNMFGRRVNGALEV
Ga0182233_11019602	3300017680	Miscanthus Phyllosphere	MEVFMIVLENELLIKTGLIMKVMKKNVFGRKANGVQEV
Ga0182226_10632712	3300017681	Miscanthus Phyllosphere	MDRRLKIEVFMIGLESELLIKTELIMKKKVMRKNMFGRKANGVQEV
Ga0182229_10463391	3300017682	Miscanthus Phyllosphere	MIGLESELLIKTRLIMKKKVMGKSMFGRKGNGVQEV
Ga0182229_10771602	3300017682	Miscanthus Phyllosphere	MEVFIIGWEKELLTRTGLIMKRKATKENMFGRKANGVQKV
Ga0182229_10817892	3300017682	Miscanthus Phyllosphere	VFIIGLEKELLIKIGLIMKKKVMKKNMFGRKANGVQEV
Ga0182229_10845802	3300017682	Miscanthus Phyllosphere	MIGLENELLTKTGLIMKKKATRENMFDRKANGVQEV
Ga0182229_10893321	3300017682	Miscanthus Phyllosphere	VFMIGLEKELLTKTGLIMKRKATKENMFGRRANGV
Ga0182218_10865821	3300017683	Miscanthus Phyllosphere	VFIIGWEKELLTRTGLIIKKKAMKENMFGRKANGVQEV
Ga0182218_10887832	3300017683	Miscanthus Phyllosphere	MISWEKELLTKTGLIMKKEATRGNMFGRKANGALEV
Ga0182218_10923361	3300017683	Miscanthus Phyllosphere	MEVFIIGWEKGLLTKTGLIMEKKAMRGNMFGRKANGVQEV
Ga0182218_11184191	3300017683	Miscanthus Phyllosphere	MDRRLKIKVFIIGLEKESLIRTGLIMKKKAMKEDMCGKKASGAQEV
Ga0182225_10605642	3300017684	Miscanthus Phyllosphere	MIGWEKELLTKTGLTMKKEATKGSMSGRKANGALED
Ga0182225_10670491	3300017684	Miscanthus Phyllosphere	MEMFIIGLEKELLIKTRLIMKKKVTRENMFGTKANGVQEV
Ga0182225_10943621	3300017684	Miscanthus Phyllosphere	MEAYIIGWEKELLTRTRLIMKKKAMRENMFGRKTNGVQEV
Ga0182227_10576681	3300017685	Miscanthus Phyllosphere	MEVFIIGWEKELSIKNGLIMKKKATRENMFGRKANGVQEV
Ga0182227_11005141	3300017685	Miscanthus Phyllosphere	MEVFMIGLESELLTRTRLIMEKKATKEHMFGRKANGVQEV
Ga0182227_11288021	3300017685	Miscanthus Phyllosphere	MIGWERELLTKTGLITKKETTRGNMFGKKANGALEV
Ga0182205_11180111	3300017686	Miscanthus Phyllosphere	MKVFIIGWEKELLTRTGPIMKKKATKENMFGRKANGVQDV
Ga0182205_11403101	3300017686	Miscanthus Phyllosphere	MDRRLKIEVFMIGLESELLIKTGLIMKKKVMRKNMFDRKANGVQEV
Ga0182205_11701492	3300017686	Miscanthus Phyllosphere	KVFMIGLENELLTKTALIMKKRVVKKDMFGRKANGAQEV
Ga0182231_10793541	3300017689	Miscanthus Phyllosphere	MDQHLKMEVFIIGLEKELLIKTGLIMKKVMRENMFGRKANGVQDV
Ga0182231_11200402	3300017689	Miscanthus Phyllosphere	MIGLESELLTKTGLIIEKKATKENMFGRKANGVQEV
Ga0182231_11267511	3300017689	Miscanthus Phyllosphere	MIDLEKELLTRTRLIMKRKATKENIFGRKANDVQEV
Ga0182223_10249921	3300017690	Miscanthus Phyllosphere	MIGLENELLIKTELIMKVMKKDVFGRKANGVQEVXQEARREG
Ga0182223_10617842	3300017690	Miscanthus Phyllosphere	MEVFIIGWEKELSIKIGLIMKKAMRENIFGRKANGIQEV
Ga0182223_10935031	3300017690	Miscanthus Phyllosphere	MIGLENELLTKIGLIMKKAMRENMFGRKANGAQEI
Ga0182232_10759721	3300021060	Phyllosphere	MEVFIIGWEKELSIKIGQIMKKKATRENMFGRKANSVQEV
Ga0207643_105187681	3300025908	Miscanthus Rhizosphere	MEVFMIGLESELLTKTGLIMEKKAIKENMFGRKANGV
Ga0207709_112152302	3300025935	Miscanthus Rhizosphere	MIGWEKELLTKTGLIMKKKATRKNTFGRKANGALED
Ga0207648_107872832	3300026089	Miscanthus Rhizosphere	MIGLGKELLTKTELIMKKKATEESIFDTKANGVQEV
Ga0207648_121660662	3300026089	Miscanthus Rhizosphere	MEAFIIVLEKELLIKTGLIMKKKVMKKNMFGRKVNGV
Ga0207675_1020726952	3300026118	Switchgrass Rhizosphere	MEVFMIGLENELLIKTGLIMKKKVMKKDVFGRKANGVQEV