| Basic Information | |
|---|---|
| Family ID | F013237 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 273 |
| Average Sequence Length | 39 residues |
| Representative Sequence | ASIYDILQRGFTHAHLEKVRIEETMMNSFEYAGGNEIRK |
| Number of Associated Samples | 233 |
| Number of Associated Scaffolds | 273 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.37 % |
| % of genes near scaffold ends (potentially truncated) | 98.90 % |
| % of genes from short scaffolds (< 2000 bps) | 93.04 % |
| Associated GOLD sequencing projects | 219 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (58.608 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.821 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.513 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.747 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.43% β-sheet: 0.00% Coil/Unstructured: 86.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 273 Family Scaffolds |
|---|---|---|
| PF01227 | GTP_cyclohydroI | 81.32 |
| PF00106 | adh_short | 8.42 |
| PF01694 | Rhomboid | 2.56 |
| PF01242 | PTPS | 0.73 |
| PF12867 | DinB_2 | 0.73 |
| PF01872 | RibD_C | 0.73 |
| PF01791 | DeoC | 0.73 |
| PF08068 | DKCLD | 0.37 |
| PF06764 | DUF1223 | 0.37 |
| PF13521 | AAA_28 | 0.37 |
| PF04055 | Radical_SAM | 0.37 |
| PF03795 | YCII | 0.37 |
| PF01436 | NHL | 0.37 |
| PF03544 | TonB_C | 0.37 |
| PF13561 | adh_short_C2 | 0.37 |
| PF00441 | Acyl-CoA_dh_1 | 0.37 |
| PF00704 | Glyco_hydro_18 | 0.37 |
| PF02771 | Acyl-CoA_dh_N | 0.37 |
| COG ID | Name | Functional Category | % Frequency in 273 Family Scaffolds |
|---|---|---|---|
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 2.56 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.73 |
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.73 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.73 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.73 |
| COG0130 | tRNA U55 pseudouridine synthase TruB, may also work on U342 of tmRNA | Translation, ribosomal structure and biogenesis [J] | 0.37 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.37 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.37 |
| COG5429 | Uncharacterized conserved protein, DUF1223 domain | Function unknown [S] | 0.37 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 58.61 % |
| All Organisms | root | All Organisms | 41.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2032320006|FACEOR_FYWIORV02GDQRL | Not Available | 510 | Open in IMG/M |
| 3300000955|JGI1027J12803_103311529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 646 | Open in IMG/M |
| 3300001356|JGI12269J14319_10149064 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300001686|C688J18823_10301085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1053 | Open in IMG/M |
| 3300003368|JGI26340J50214_10134417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 623 | Open in IMG/M |
| 3300004092|Ga0062389_101294921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 914 | Open in IMG/M |
| 3300004477|Ga0068971_1519838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 515 | Open in IMG/M |
| 3300004479|Ga0062595_101103737 | Not Available | 694 | Open in IMG/M |
| 3300004631|Ga0058899_12224507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1081 | Open in IMG/M |
| 3300005186|Ga0066676_11105796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 522 | Open in IMG/M |
| 3300005295|Ga0065707_11068513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 523 | Open in IMG/M |
| 3300005353|Ga0070669_100887629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 761 | Open in IMG/M |
| 3300005355|Ga0070671_101389815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 620 | Open in IMG/M |
| 3300005450|Ga0066682_10838699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 552 | Open in IMG/M |
| 3300005529|Ga0070741_11280025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 614 | Open in IMG/M |
| 3300005532|Ga0070739_10464681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 577 | Open in IMG/M |
| 3300005533|Ga0070734_10412107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 771 | Open in IMG/M |
| 3300005534|Ga0070735_10515093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 712 | Open in IMG/M |
| 3300005534|Ga0070735_10575755 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300005542|Ga0070732_10405024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 823 | Open in IMG/M |
| 3300005547|Ga0070693_101143163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 595 | Open in IMG/M |
| 3300005561|Ga0066699_10840935 | Not Available | 644 | Open in IMG/M |
| 3300005575|Ga0066702_10052589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2194 | Open in IMG/M |
| 3300005602|Ga0070762_10606966 | Not Available | 727 | Open in IMG/M |
| 3300005610|Ga0070763_10735806 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300005712|Ga0070764_10369230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 842 | Open in IMG/M |
| 3300005718|Ga0068866_11328112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 523 | Open in IMG/M |
| 3300005764|Ga0066903_100065060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 4602 | Open in IMG/M |
| 3300005764|Ga0066903_101903934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1139 | Open in IMG/M |
| 3300005764|Ga0066903_102229299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1057 | Open in IMG/M |
| 3300005844|Ga0068862_102151503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 569 | Open in IMG/M |
| 3300005921|Ga0070766_10632603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 721 | Open in IMG/M |
| 3300005950|Ga0066787_10107603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 599 | Open in IMG/M |
| 3300006047|Ga0075024_100886592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 506 | Open in IMG/M |
| 3300006050|Ga0075028_100273686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 934 | Open in IMG/M |
| 3300006052|Ga0075029_100393522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 900 | Open in IMG/M |
| 3300006086|Ga0075019_10643959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 667 | Open in IMG/M |
| 3300006102|Ga0075015_100831571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 556 | Open in IMG/M |
| 3300006162|Ga0075030_100661271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 827 | Open in IMG/M |
| 3300006162|Ga0075030_101124324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 618 | Open in IMG/M |
| 3300006163|Ga0070715_11042854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 512 | Open in IMG/M |
| 3300006172|Ga0075018_10583151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 593 | Open in IMG/M |
| 3300006173|Ga0070716_100236145 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300006174|Ga0075014_100141667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1166 | Open in IMG/M |
| 3300006642|Ga0075521_10536089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 574 | Open in IMG/M |
| 3300006755|Ga0079222_10349205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 998 | Open in IMG/M |
| 3300006806|Ga0079220_11098646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 644 | Open in IMG/M |
| 3300006806|Ga0079220_12133456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 502 | Open in IMG/M |
| 3300006893|Ga0073928_10286113 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1244 | Open in IMG/M |
| 3300006893|Ga0073928_11022799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 562 | Open in IMG/M |
| 3300006954|Ga0079219_11082451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 677 | Open in IMG/M |
| 3300007255|Ga0099791_10687849 | Not Available | 503 | Open in IMG/M |
| 3300007258|Ga0099793_10143254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1129 | Open in IMG/M |
| 3300009012|Ga0066710_100121474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3559 | Open in IMG/M |
| 3300009038|Ga0099829_10280826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1362 | Open in IMG/M |
| 3300009038|Ga0099829_11553925 | Not Available | 546 | Open in IMG/M |
| 3300009089|Ga0099828_11999868 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300009162|Ga0075423_10358507 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
| 3300009523|Ga0116221_1180230 | Not Available | 917 | Open in IMG/M |
| 3300009524|Ga0116225_1451947 | Not Available | 571 | Open in IMG/M |
| 3300009545|Ga0105237_10340810 | Not Available | 1503 | Open in IMG/M |
| 3300009545|Ga0105237_12524227 | Not Available | 524 | Open in IMG/M |
| 3300009635|Ga0116117_1046032 | Not Available | 1074 | Open in IMG/M |
| 3300009637|Ga0116118_1083783 | Not Available | 1087 | Open in IMG/M |
| 3300009645|Ga0116106_1048971 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
| 3300009665|Ga0116135_1360490 | Not Available | 584 | Open in IMG/M |
| 3300009698|Ga0116216_10241402 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300009764|Ga0116134_1358553 | Not Available | 500 | Open in IMG/M |
| 3300009824|Ga0116219_10661439 | Not Available | 572 | Open in IMG/M |
| 3300010043|Ga0126380_11416708 | Not Available | 611 | Open in IMG/M |
| 3300010043|Ga0126380_12069207 | Not Available | 523 | Open in IMG/M |
| 3300010048|Ga0126373_12163136 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300010048|Ga0126373_12758779 | Not Available | 548 | Open in IMG/M |
| 3300010159|Ga0099796_10496880 | Not Available | 546 | Open in IMG/M |
| 3300010339|Ga0074046_10054743 | All Organisms → cellular organisms → Bacteria | 2638 | Open in IMG/M |
| 3300010341|Ga0074045_10999055 | Not Available | 526 | Open in IMG/M |
| 3300010371|Ga0134125_10975609 | Not Available | 930 | Open in IMG/M |
| 3300010396|Ga0134126_12084833 | Not Available | 619 | Open in IMG/M |
| 3300010396|Ga0134126_12987046 | Not Available | 511 | Open in IMG/M |
| 3300010397|Ga0134124_11796865 | Not Available | 647 | Open in IMG/M |
| 3300010398|Ga0126383_10429111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1366 | Open in IMG/M |
| 3300010398|Ga0126383_10964184 | Not Available | 940 | Open in IMG/M |
| 3300010403|Ga0134123_10656168 | Not Available | 1018 | Open in IMG/M |
| 3300011090|Ga0138579_1311962 | Not Available | 520 | Open in IMG/M |
| 3300011120|Ga0150983_14172748 | Not Available | 629 | Open in IMG/M |
| 3300011120|Ga0150983_16204510 | Not Available | 588 | Open in IMG/M |
| 3300011270|Ga0137391_10745935 | Not Available | 810 | Open in IMG/M |
| 3300012189|Ga0137388_10025278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4539 | Open in IMG/M |
| 3300012205|Ga0137362_11469020 | Not Available | 568 | Open in IMG/M |
| 3300012208|Ga0137376_10252017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1531 | Open in IMG/M |
| 3300012917|Ga0137395_10458931 | Not Available | 915 | Open in IMG/M |
| 3300012927|Ga0137416_11388290 | Not Available | 636 | Open in IMG/M |
| 3300012930|Ga0137407_11716941 | Not Available | 598 | Open in IMG/M |
| 3300012971|Ga0126369_12033332 | Not Available | 662 | Open in IMG/M |
| 3300012975|Ga0134110_10171737 | Not Available | 902 | Open in IMG/M |
| 3300012986|Ga0164304_11065706 | Not Available | 644 | Open in IMG/M |
| 3300013105|Ga0157369_12050786 | Not Available | 580 | Open in IMG/M |
| 3300014151|Ga0181539_1109729 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300014160|Ga0181517_10239436 | Not Available | 975 | Open in IMG/M |
| 3300014498|Ga0182019_10302567 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300014498|Ga0182019_10450406 | Not Available | 885 | Open in IMG/M |
| 3300014658|Ga0181519_10741553 | Not Available | 606 | Open in IMG/M |
| 3300015241|Ga0137418_10892249 | Not Available | 655 | Open in IMG/M |
| 3300015242|Ga0137412_11189456 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300015373|Ga0132257_101905107 | Not Available | 765 | Open in IMG/M |
| 3300016294|Ga0182041_10951232 | Not Available | 774 | Open in IMG/M |
| 3300016319|Ga0182033_10724370 | Not Available | 872 | Open in IMG/M |
| 3300016357|Ga0182032_10890310 | Not Available | 756 | Open in IMG/M |
| 3300016371|Ga0182034_10625031 | Not Available | 911 | Open in IMG/M |
| 3300016404|Ga0182037_11094439 | Not Available | 697 | Open in IMG/M |
| 3300016404|Ga0182037_11554659 | Not Available | 588 | Open in IMG/M |
| 3300016445|Ga0182038_10317918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1279 | Open in IMG/M |
| 3300017822|Ga0187802_10142529 | Not Available | 914 | Open in IMG/M |
| 3300017925|Ga0187856_1107055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1103 | Open in IMG/M |
| 3300017930|Ga0187825_10120119 | Not Available | 917 | Open in IMG/M |
| 3300017932|Ga0187814_10231004 | Not Available | 699 | Open in IMG/M |
| 3300017942|Ga0187808_10300760 | Not Available | 723 | Open in IMG/M |
| 3300017955|Ga0187817_10436544 | Not Available | 835 | Open in IMG/M |
| 3300017955|Ga0187817_10800115 | Not Available | 602 | Open in IMG/M |
| 3300017961|Ga0187778_10806925 | Not Available | 640 | Open in IMG/M |
| 3300017961|Ga0187778_10900118 | Not Available | 608 | Open in IMG/M |
| 3300017961|Ga0187778_10965769 | Not Available | 588 | Open in IMG/M |
| 3300017966|Ga0187776_10033006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2887 | Open in IMG/M |
| 3300017973|Ga0187780_10774108 | Not Available | 694 | Open in IMG/M |
| 3300017975|Ga0187782_10929891 | Not Available | 675 | Open in IMG/M |
| 3300017994|Ga0187822_10089755 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300017994|Ga0187822_10144305 | Not Available | 760 | Open in IMG/M |
| 3300017995|Ga0187816_10297521 | Not Available | 708 | Open in IMG/M |
| 3300018017|Ga0187872_10123220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1270 | Open in IMG/M |
| 3300018020|Ga0187861_10385841 | Not Available | 588 | Open in IMG/M |
| 3300018023|Ga0187889_10280336 | Not Available | 742 | Open in IMG/M |
| 3300018035|Ga0187875_10387453 | Not Available | 748 | Open in IMG/M |
| 3300018085|Ga0187772_11487096 | Not Available | 504 | Open in IMG/M |
| 3300018086|Ga0187769_10712150 | Not Available | 759 | Open in IMG/M |
| 3300018088|Ga0187771_11084201 | Not Available | 679 | Open in IMG/M |
| 3300018090|Ga0187770_10789917 | Not Available | 760 | Open in IMG/M |
| 3300018090|Ga0187770_11588073 | Not Available | 533 | Open in IMG/M |
| 3300019258|Ga0181504_1368965 | Not Available | 814 | Open in IMG/M |
| 3300019787|Ga0182031_1055613 | Not Available | 787 | Open in IMG/M |
| 3300019787|Ga0182031_1296240 | Not Available | 1441 | Open in IMG/M |
| 3300019887|Ga0193729_1101126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1097 | Open in IMG/M |
| 3300020006|Ga0193735_1064807 | Not Available | 1064 | Open in IMG/M |
| 3300020022|Ga0193733_1122856 | Not Available | 716 | Open in IMG/M |
| 3300020579|Ga0210407_10751945 | Not Available | 754 | Open in IMG/M |
| 3300020581|Ga0210399_10348437 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300020582|Ga0210395_10300708 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300020582|Ga0210395_10673163 | Not Available | 775 | Open in IMG/M |
| 3300021088|Ga0210404_10428846 | Not Available | 742 | Open in IMG/M |
| 3300021088|Ga0210404_10687430 | Not Available | 583 | Open in IMG/M |
| 3300021171|Ga0210405_10704151 | Not Available | 780 | Open in IMG/M |
| 3300021402|Ga0210385_11133472 | Not Available | 600 | Open in IMG/M |
| 3300021403|Ga0210397_10146710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1645 | Open in IMG/M |
| 3300021403|Ga0210397_10845207 | Not Available | 707 | Open in IMG/M |
| 3300021405|Ga0210387_11039939 | Not Available | 716 | Open in IMG/M |
| 3300021405|Ga0210387_11378761 | Not Available | 607 | Open in IMG/M |
| 3300021406|Ga0210386_11264275 | Not Available | 622 | Open in IMG/M |
| 3300021406|Ga0210386_11265113 | Not Available | 622 | Open in IMG/M |
| 3300021407|Ga0210383_10315259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1346 | Open in IMG/M |
| 3300021407|Ga0210383_10412383 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300021407|Ga0210383_10648951 | Not Available | 909 | Open in IMG/M |
| 3300021420|Ga0210394_10675129 | Not Available | 906 | Open in IMG/M |
| 3300021432|Ga0210384_11382607 | Not Available | 609 | Open in IMG/M |
| 3300021474|Ga0210390_10965763 | Not Available | 698 | Open in IMG/M |
| 3300021477|Ga0210398_10502566 | Not Available | 987 | Open in IMG/M |
| 3300021477|Ga0210398_11586958 | Not Available | 507 | Open in IMG/M |
| 3300021478|Ga0210402_11141218 | Not Available | 707 | Open in IMG/M |
| 3300021478|Ga0210402_11395818 | Not Available | 628 | Open in IMG/M |
| 3300021479|Ga0210410_11691823 | Not Available | 526 | Open in IMG/M |
| 3300021559|Ga0210409_10001733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 27601 | Open in IMG/M |
| 3300022528|Ga0242669_1113467 | Not Available | 537 | Open in IMG/M |
| 3300022531|Ga0242660_1031082 | Not Available | 1076 | Open in IMG/M |
| 3300022557|Ga0212123_10809038 | Not Available | 562 | Open in IMG/M |
| 3300022722|Ga0242657_1077679 | Not Available | 782 | Open in IMG/M |
| 3300023090|Ga0224558_1237197 | Not Available | 529 | Open in IMG/M |
| 3300023259|Ga0224551_1039613 | Not Available | 817 | Open in IMG/M |
| 3300025320|Ga0209171_10178382 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1218 | Open in IMG/M |
| 3300025442|Ga0208034_1064415 | Not Available | 707 | Open in IMG/M |
| 3300025581|Ga0208355_1028661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1543 | Open in IMG/M |
| 3300025627|Ga0208220_1178518 | Not Available | 528 | Open in IMG/M |
| 3300025905|Ga0207685_10121994 | Not Available | 1145 | Open in IMG/M |
| 3300025907|Ga0207645_10403041 | Not Available | 920 | Open in IMG/M |
| 3300025912|Ga0207707_11136704 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300025914|Ga0207671_10786074 | Not Available | 755 | Open in IMG/M |
| 3300025922|Ga0207646_11027877 | Not Available | 727 | Open in IMG/M |
| 3300025927|Ga0207687_10349216 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300025938|Ga0207704_11244808 | Not Available | 635 | Open in IMG/M |
| 3300025939|Ga0207665_10440613 | Not Available | 998 | Open in IMG/M |
| 3300025944|Ga0207661_11584786 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300025949|Ga0207667_10165584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2273 | Open in IMG/M |
| 3300026332|Ga0209803_1153497 | Not Available | 889 | Open in IMG/M |
| 3300026446|Ga0257178_1006701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1200 | Open in IMG/M |
| 3300026496|Ga0257157_1091396 | Not Available | 530 | Open in IMG/M |
| 3300026538|Ga0209056_10240157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1294 | Open in IMG/M |
| 3300026542|Ga0209805_1423483 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300026547|Ga0209156_10289082 | Not Available | 744 | Open in IMG/M |
| 3300026990|Ga0207824_1037109 | Not Available | 518 | Open in IMG/M |
| 3300027164|Ga0208994_1065688 | Not Available | 544 | Open in IMG/M |
| 3300027583|Ga0209527_1137769 | Not Available | 542 | Open in IMG/M |
| 3300027587|Ga0209220_1156805 | Not Available | 588 | Open in IMG/M |
| 3300027629|Ga0209422_1048411 | Not Available | 1023 | Open in IMG/M |
| 3300027635|Ga0209625_1003875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3249 | Open in IMG/M |
| 3300027643|Ga0209076_1134494 | Not Available | 695 | Open in IMG/M |
| 3300027676|Ga0209333_1053885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1109 | Open in IMG/M |
| 3300027846|Ga0209180_10148274 | Not Available | 1351 | Open in IMG/M |
| 3300027853|Ga0209274_10299484 | Not Available | 826 | Open in IMG/M |
| 3300027855|Ga0209693_10206730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 966 | Open in IMG/M |
| 3300027855|Ga0209693_10636780 | Not Available | 501 | Open in IMG/M |
| 3300027882|Ga0209590_10439849 | Not Available | 843 | Open in IMG/M |
| 3300027884|Ga0209275_10160012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1198 | Open in IMG/M |
| 3300027889|Ga0209380_10345134 | Not Available | 874 | Open in IMG/M |
| 3300027895|Ga0209624_10439695 | Not Available | 869 | Open in IMG/M |
| 3300027911|Ga0209698_10191035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1661 | Open in IMG/M |
| 3300027986|Ga0209168_10344648 | Not Available | 728 | Open in IMG/M |
| 3300028731|Ga0302301_1146511 | Not Available | 588 | Open in IMG/M |
| 3300028762|Ga0302202_10211868 | Not Available | 984 | Open in IMG/M |
| 3300028766|Ga0302269_1193773 | Not Available | 572 | Open in IMG/M |
| 3300028776|Ga0302303_10181446 | Not Available | 734 | Open in IMG/M |
| 3300028807|Ga0307305_10356431 | Not Available | 663 | Open in IMG/M |
| 3300028828|Ga0307312_10148543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1486 | Open in IMG/M |
| 3300028866|Ga0302278_10434528 | Not Available | 573 | Open in IMG/M |
| 3300029889|Ga0246001_1061824 | Not Available | 767 | Open in IMG/M |
| 3300029987|Ga0311334_10396393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1095 | Open in IMG/M |
| 3300030007|Ga0311338_10669108 | Not Available | 1055 | Open in IMG/M |
| 3300030053|Ga0302177_10434006 | Not Available | 684 | Open in IMG/M |
| 3300030494|Ga0310037_10314582 | Not Available | 664 | Open in IMG/M |
| 3300030518|Ga0302275_10242045 | Not Available | 1033 | Open in IMG/M |
| 3300030580|Ga0311355_11524803 | Not Available | 576 | Open in IMG/M |
| 3300031018|Ga0265773_1037807 | Not Available | 543 | Open in IMG/M |
| 3300031057|Ga0170834_104384819 | Not Available | 552 | Open in IMG/M |
| 3300031057|Ga0170834_107095552 | All Organisms → cellular organisms → Bacteria | 2968 | Open in IMG/M |
| 3300031231|Ga0170824_117409510 | Not Available | 582 | Open in IMG/M |
| 3300031235|Ga0265330_10026861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2602 | Open in IMG/M |
| 3300031239|Ga0265328_10060620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1389 | Open in IMG/M |
| 3300031241|Ga0265325_10077253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1660 | Open in IMG/M |
| 3300031241|Ga0265325_10118790 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300031708|Ga0310686_100839840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1221 | Open in IMG/M |
| 3300031715|Ga0307476_10096412 | All Organisms → cellular organisms → Bacteria | 2083 | Open in IMG/M |
| 3300031715|Ga0307476_10314229 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300031715|Ga0307476_10410893 | Not Available | 1000 | Open in IMG/M |
| 3300031720|Ga0307469_12155267 | Not Available | 542 | Open in IMG/M |
| 3300031754|Ga0307475_10009707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6345 | Open in IMG/M |
| 3300031795|Ga0318557_10569947 | Not Available | 520 | Open in IMG/M |
| 3300031820|Ga0307473_10689404 | Not Available | 716 | Open in IMG/M |
| 3300031823|Ga0307478_11687043 | Not Available | 522 | Open in IMG/M |
| 3300031824|Ga0307413_11806864 | Not Available | 547 | Open in IMG/M |
| 3300031938|Ga0308175_101906871 | Not Available | 666 | Open in IMG/M |
| 3300031946|Ga0310910_10147493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1797 | Open in IMG/M |
| 3300031954|Ga0306926_12091229 | Not Available | 634 | Open in IMG/M |
| 3300031996|Ga0308176_10688387 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300032064|Ga0318510_10037793 | All Organisms → cellular organisms → Bacteria | 1654 | Open in IMG/M |
| 3300032067|Ga0318524_10125405 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
| 3300032174|Ga0307470_11613555 | Not Available | 543 | Open in IMG/M |
| 3300032180|Ga0307471_100846020 | Not Available | 1082 | Open in IMG/M |
| 3300032180|Ga0307471_103031863 | Not Available | 596 | Open in IMG/M |
| 3300032205|Ga0307472_100425997 | Not Available | 1119 | Open in IMG/M |
| 3300032770|Ga0335085_10496809 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300032783|Ga0335079_10208048 | All Organisms → cellular organisms → Bacteria | 2168 | Open in IMG/M |
| 3300032805|Ga0335078_10187988 | All Organisms → cellular organisms → Bacteria | 2883 | Open in IMG/M |
| 3300032828|Ga0335080_10176856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2355 | Open in IMG/M |
| 3300032892|Ga0335081_10344767 | All Organisms → cellular organisms → Bacteria | 1945 | Open in IMG/M |
| 3300032892|Ga0335081_10877025 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300032954|Ga0335083_10978832 | Not Available | 667 | Open in IMG/M |
| 3300032954|Ga0335083_11163194 | Not Available | 600 | Open in IMG/M |
| 3300032955|Ga0335076_10017775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7136 | Open in IMG/M |
| 3300033134|Ga0335073_10370341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1688 | Open in IMG/M |
| 3300033158|Ga0335077_10243586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1996 | Open in IMG/M |
| 3300033158|Ga0335077_10731561 | Not Available | 1015 | Open in IMG/M |
| 3300033433|Ga0326726_12089892 | Not Available | 551 | Open in IMG/M |
| 3300033561|Ga0371490_1094320 | Not Available | 801 | Open in IMG/M |
| 3300033755|Ga0371489_0459255 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300033806|Ga0314865_101651 | Not Available | 755 | Open in IMG/M |
| 3300034163|Ga0370515_0039896 | Not Available | 2097 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.82% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.40% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.03% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.03% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.30% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.30% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.66% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.93% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.93% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.56% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.20% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.20% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.20% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.83% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.83% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.47% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.47% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.47% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.47% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.47% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.10% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.10% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.10% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.10% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.10% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.73% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.73% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.73% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.73% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.73% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.37% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.37% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.37% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.37% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.37% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.37% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.37% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.37% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.37% |
| Peat | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat | 0.37% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.37% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.37% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.37% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2032320006 | Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004477 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011090 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019258 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025442 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025581 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026990 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 73 (SPAdes) | Environmental | Open in IMG/M |
| 3300027164 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028762 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028766 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300029889 | Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cm | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| 3300033806 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACEORE_2948790 | 2032320006 | Soil | TIYEIMRRGFTPAHLEKVRIEETMMNSFEYAGDREALR |
| JGI1027J12803_1033115292 | 3300000955 | Soil | RVLQEKFSLAKIEKVRIEETMMNSFEYAGQTIHG* |
| JGI12269J14319_101490641 | 3300001356 | Peatlands Soil | LSIEIFEILQRGFQKAHLEGVRLEETMMNSFEYAGAAEPRK* |
| C688J18823_103010851 | 3300001686 | Soil | NLSTAIYDILQRGFSKAHLEKVRLEETMMNSFEYAGGGEIRR* |
| JGI26340J50214_101344172 | 3300003368 | Bog Forest Soil | LSEVIFNILKQSFTAAHLEKVRLEETMMNSFEYAGGVELRP* |
| Ga0062389_1012949211 | 3300004092 | Bog Forest Soil | LSIAVYDILQRGFRLAHLERVRFEETLMNSFEYAGEERR* |
| Ga0068971_15198381 | 3300004477 | Peatlands Soil | TTENLSVEIFEILQRGFHMAHLEGVRLEETMLNSFEYNGGEEKVLRR* |
| Ga0062595_1011037372 | 3300004479 | Soil | NLCIQIFEIMQRGFSQAHLERVRLEETMMNAFEYAGGQEDGKRN* |
| Ga0058899_122245073 | 3300004631 | Forest Soil | TTENLCIRIYEILQRGFHYAHLEKVRMEETMMNSFAYAGGKDLRD* |
| Ga0066676_111057961 | 3300005186 | Soil | CASIYEIVQEGFRHARLEKVRLEETMMNSFEYAGGAEIWR* |
| Ga0065707_110685132 | 3300005295 | Switchgrass Rhizosphere | CISIYEIVQRGFRVAHLEKVRIEETLMNSFEYWGAEQGRI* |
| Ga0070669_1008876292 | 3300005353 | Switchgrass Rhizosphere | NLCQEIYDILRREFSYAHLEKVRIEETMMNSFEYAGNAEMLH* |
| Ga0070671_1013898152 | 3300005355 | Switchgrass Rhizosphere | LCTVLHEILQRGFTEAHLEKVRLEETMMNSFEYTGGNERIW* |
| Ga0066682_108386992 | 3300005450 | Soil | TENLSVSIYDILQRGFTHAHLEKVRIQETMMNSFEYAGANEIRK* |
| Ga0070741_112800252 | 3300005529 | Surface Soil | VIYDILQRNFRPANLEKVRLEETMMNSFEYAGGKEIFDL* |
| Ga0070739_104646812 | 3300005532 | Surface Soil | AIFHILKREFHAAHLEKVRIEETRNNSFEYCGEGPLS* |
| Ga0070734_104121071 | 3300005533 | Surface Soil | IFEILQRGFQKAHLERVRLEETMMNSFEYAGAGKEVPPR* |
| Ga0070735_105150931 | 3300005534 | Surface Soil | IYDILQRGFEHAHLERVRFEETMMNAFEYWGENRVIE* |
| Ga0070735_105757551 | 3300005534 | Surface Soil | TTENLCIVTYDILQRGFRHAHLLRVRLEETMMNSFEYWGKNRVIE* |
| Ga0070732_104050241 | 3300005542 | Surface Soil | YEIVQRGFTQAHLEKVRLEETMMNSFEYAGGRELKI* |
| Ga0070693_1011431631 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | CTAIYDILQRGFTLAHLDKVRIEETMMNSFEYAGDAEIGP* |
| Ga0066699_108409352 | 3300005561 | Soil | YEIVQRGFRPGHMEKVRLEETMMNSFEYGGSAEVRK* |
| Ga0066702_100525891 | 3300005575 | Soil | IYRRLRNGFRPAQVEKVRMEETMMNSFEYAGDAELRH* |
| Ga0070762_106069662 | 3300005602 | Soil | DILQRGFRLAHLDRVRFEETLMNSFEYAGDEQKL* |
| Ga0070763_107358061 | 3300005610 | Soil | YDILQRGFRHAHLEKVRFEETMMNSFEYWGENRVIE* |
| Ga0070764_103692302 | 3300005712 | Soil | QIYEIVHRGFHHAHLERVRLEETMMNSFEYAGEGS* |
| Ga0068866_113281122 | 3300005718 | Miscanthus Rhizosphere | IYDILQRGFTQAHLEKVRIEETMMNSFEYTGAAQIKPW* |
| Ga0066903_1000650601 | 3300005764 | Tropical Forest Soil | NLCALVYETLRQGFHHAHVEKVRLEETMMNSFEYGELRH* |
| Ga0066903_1019039343 | 3300005764 | Tropical Forest Soil | ILQRSFSYAHLDKVKLEETMMNSFEYAGDGELKA* |
| Ga0066903_1022292991 | 3300005764 | Tropical Forest Soil | ENLALVIYDILKRSFNAAHLEKVRIEETLMNSFEYAGDAEVHR* |
| Ga0068862_1021515031 | 3300005844 | Switchgrass Rhizosphere | ENLCQEIYDILRREFSYAHLEKVRIEETMMNSFEYAGNAEMLH* |
| Ga0070766_106326031 | 3300005921 | Soil | NLCIQIYEIVHRGFRFAHLEKVRLEETMMNSFEYAGEGS* |
| Ga0066787_101076031 | 3300005950 | Soil | LCIAIYEIVKRGFRKAHLEKIRIEETMMNSFEYSGEESR* |
| Ga0075024_1008865922 | 3300006047 | Watersheds | LCTAIYDILQRGFTHAHLEKVRIEETMMNSFEYAGAAEITP* |
| Ga0075028_1002736861 | 3300006050 | Watersheds | IYEILQRGFRFAHLERVRLEETLMNSFEYAGGREPNR* |
| Ga0075029_1003935221 | 3300006052 | Watersheds | EIFEILQRTFRHAHLERVRLEETMMNSFEYTGNNGAPR* |
| Ga0075019_106439591 | 3300006086 | Watersheds | IVQRGFTLAHLEKVRLEETMMNSFEYAGGQESRI* |
| Ga0075015_1008315712 | 3300006102 | Watersheds | LSVEIFEILQRGFRHAHLERVRLEETMMNSFEYAGGSEPRH* |
| Ga0075030_1006612711 | 3300006162 | Watersheds | ILQRGFQKAHLDRVRLEETLMNSFEYAGGNEPRT* |
| Ga0075030_1011243242 | 3300006162 | Watersheds | AIFEILKRGFHKAHLEKIRIEETMMNSFEYAGEK* |
| Ga0070715_110428541 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | NLCIQIFDILQRRFPHAHLEKVRLEETMMNSFEYAGGKELIILACLPA* |
| Ga0075018_105831512 | 3300006172 | Watersheds | YKIVKGGFTLAHLERVRIEETMMNSFEYSGGAAPLR* |
| Ga0070716_1002361451 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LCEAIYDILQRTFHFAHLEKVRIEETMLNSFEYAGGRALKS* |
| Ga0075014_1001416673 | 3300006174 | Watersheds | EILQRDFRDAHLERVRLEETMMNSFEYTGNNGALW* |
| Ga0075521_105360892 | 3300006642 | Arctic Peat Soil | FNILKQSFTAAHLEKVRLEETMMNSFEYAGGAELRV* |
| Ga0079222_103492052 | 3300006755 | Agricultural Soil | FEIVQRGFRPAHLEKVRLEETMMNSFEYYGDNEVRL* |
| Ga0079220_110986461 | 3300006806 | Agricultural Soil | LAEEIFHILRRDFRAAHLEKVRLEETMLNSFEYAGGEEIRR* |
| Ga0079220_121334561 | 3300006806 | Agricultural Soil | TENLCRRIYENLQQNFRQAHLEKVRIEETMMNSFEYGNANKL* |
| Ga0073928_102861131 | 3300006893 | Iron-Sulfur Acid Spring | SIEIFEILQRGFAQAHLDRVRLEETMMNSFEYAGASEPRH* |
| Ga0073928_110227991 | 3300006893 | Iron-Sulfur Acid Spring | TENLCVEIFEILQRGFHQAHLERVRIEETMMNAFEYSGTAELRK* |
| Ga0079219_110824511 | 3300006954 | Agricultural Soil | DILQRGFTLAHLDKVRIEESMMNSFEYAGDAEIGP* |
| Ga0099791_106878492 | 3300007255 | Vadose Zone Soil | ILQRGFTHAHLEKVRIDETMMNSFEYAGAAEIQPQ* |
| Ga0099793_101432543 | 3300007258 | Vadose Zone Soil | SASIYDILQRGFSHAHLEKVRIEETMMNSFEYAGGNEVRR* |
| Ga0066710_1001214741 | 3300009012 | Grasslands Soil | ASIYDILQRGFTHAHLEKVRIEETMMNSFEYAGGNEIRK |
| Ga0099829_102808261 | 3300009038 | Vadose Zone Soil | TAIYDILRRGFTQAHLEKVRMEETMMNSFEYAGGAEIRR* |
| Ga0099829_115539251 | 3300009038 | Vadose Zone Soil | NLCVEIFEILQRGFPHAHLERVRLEETMMNSFEYAGGAEHRK* |
| Ga0099828_119998681 | 3300009089 | Vadose Zone Soil | AVPTTENLIASIYDILQRGFIHAHLDKVHIQETMMNSFEYAGANEIPK* |
| Ga0075423_103585071 | 3300009162 | Populus Rhizosphere | TAIYDILQRGFTQAHLEKVRIEETMMNSFEYTGAAQIKPW* |
| Ga0116221_11802302 | 3300009523 | Peatlands Soil | FEILQRSFPHAHLDRIRLEETMMNSFEYAGGREVPH* |
| Ga0116225_14519471 | 3300009524 | Peatlands Soil | LCIAIYEIVKRGFRKAHLEKVRIEETMMNSFEYSGESSR* |
| Ga0105237_103408101 | 3300009545 | Corn Rhizosphere | ENLCIQIFDILQRRFPHAHLETVRLEETMMNSFEYAGGKELIILACLPA* |
| Ga0105237_125242272 | 3300009545 | Corn Rhizosphere | NLCTAIYDILQRGFTLAHLDKVRIEETMMNSFEYAGDAEIGP* |
| Ga0116117_10460323 | 3300009635 | Peatland | CIAIYEILKRGFEKAHLQKVRIEETMMNSFEYAGDDSR* |
| Ga0116118_10837833 | 3300009637 | Peatland | IYEIVKRGFRQAHLEKVRIEETMMNSFEYSGEGNL* |
| Ga0116106_10489713 | 3300009645 | Peatland | CIAIYDIVKRAFGKAHLEKVRIEETMMNSFEYCGENGR* |
| Ga0116135_13604902 | 3300009665 | Peatland | CIVVYDILQRGFRHAHLEKVRFEETMMNSFEYWGGNRVIE* |
| Ga0116216_102414021 | 3300009698 | Peatlands Soil | ILQQGFRAAHLEKVRIEETLMNSFEYAGGDDLRC* |
| Ga0116134_13585531 | 3300009764 | Peatland | NILKQSFKAAHLEKVRLEETIMNSFEYAGGAELRI* |
| Ga0116219_106614391 | 3300009824 | Peatlands Soil | ILQRGFRHAHLQKVRFEETMMNSFEYWGENRVIE* |
| Ga0126380_114167081 | 3300010043 | Tropical Forest Soil | IYDILQRGFQHAHLEKVGMEETMMNSFEYAGGSEIRR* |
| Ga0126380_120692071 | 3300010043 | Tropical Forest Soil | IEIFEILKRGFPRAHLERVRLEETMMNSFEYTGL* |
| Ga0126373_118933602 | 3300010048 | Tropical Forest Soil | VVIYDILRRAFRAAHLEKVRLEETLMNAFEYGGERESL* |
| Ga0126373_121631361 | 3300010048 | Tropical Forest Soil | EIFEILQRGFREARLERERLEETVMNSFEYRKENIRK* |
| Ga0126373_127587791 | 3300010048 | Tropical Forest Soil | IFEILQRTFSYAHLDKVKLEETMMNSFEYAGGRELTPA* |
| Ga0099796_104968802 | 3300010159 | Vadose Zone Soil | LCIAIYEIVERGFGKAHLEKVRIEETVMNSFEYSGEGASLVAGR* |
| Ga0074046_100547431 | 3300010339 | Bog Forest Soil | LAEVIYNILKQGFRSAHLEKVRIEETLMNSFEYAGGGAPRH* |
| Ga0074045_109990551 | 3300010341 | Bog Forest Soil | NLCISIYEIVKREFKGAHLEKVRIEETMMNSFEYAGENSR* |
| Ga0134125_109756092 | 3300010371 | Terrestrial Soil | CTAIYDILQRGFTLAHLDKVRIEETMMNSFEYAGGAEIGP* |
| Ga0134126_120848332 | 3300010396 | Terrestrial Soil | IALYDILQRGFTGAHLERVRLEETMMNAFEFYGSDRDGHD* |
| Ga0134126_129870461 | 3300010396 | Terrestrial Soil | TAIYDILQRGFTLAHLDKVRIEETMMNSFEYAGDAEIGP* |
| Ga0134124_117968651 | 3300010397 | Terrestrial Soil | ENLCAEIYEILNRGFRLAHLEKIRLEETASNSFEYAGGVEPRH* |
| Ga0126383_104291111 | 3300010398 | Tropical Forest Soil | NLCTTIYEIVQRGFKLAHLEKVRLEETMMNSFEYAGDGELKA* |
| Ga0126383_109641843 | 3300010398 | Tropical Forest Soil | ENLSEVIFKILKQNFKAAHLEKVRLEETVMNSFEYAGGAELQR* |
| Ga0134123_106561681 | 3300010403 | Terrestrial Soil | TENLCISIYEIVQRGFRLAHLEKVRIEETLMNSFEYWGAEQARI* |
| Ga0138579_13119621 | 3300011090 | Peatlands Soil | LCIAIYEIMKRGFNKAHLEKVRIEETMLNSFEYSGESSR* |
| Ga0150983_141727482 | 3300011120 | Forest Soil | LCIVIYDILQRGFRHAHLERVRFEETMMNSFEYWGENRVIE* |
| Ga0150983_162045102 | 3300011120 | Forest Soil | CMVIYDILQREFQQPHLEKVRFEETMMNAFEYWGENRVIL* |
| Ga0137391_107459352 | 3300011270 | Vadose Zone Soil | EIYELLHRGLQKAHLDKVRIEETMMNSFEYSGESQP* |
| Ga0137388_100252786 | 3300012189 | Vadose Zone Soil | CIKLFEKVQRGFHQAHLERVRLEETMLNSFEYRGGNEDRRIL* |
| Ga0137362_114690201 | 3300012205 | Vadose Zone Soil | IYEIVKRGFRKAHLEKVRIEETRLNSFEYSGENSR* |
| Ga0137376_102520171 | 3300012208 | Vadose Zone Soil | ILQRGFTHAHLEKVRIEETMMNSFEYAGGNEVRR* |
| Ga0137395_104589311 | 3300012917 | Vadose Zone Soil | IYEIVKRGFSKAHLEKVRIEETMMNSFEYAGENDR* |
| Ga0137416_113882902 | 3300012927 | Vadose Zone Soil | ERGFGKAHLEKVRIEETMMNSFEYSGEGASLVAGR* |
| Ga0137407_117169411 | 3300012930 | Vadose Zone Soil | MVIYEIMQRGFRLAHLLKVRIEETMMNSFEYAGGAELVR* |
| Ga0126369_120333322 | 3300012971 | Tropical Forest Soil | ENLCQLIYDILQRTFHHAHLEMVRIEETMLNSFAYAGGEEALR* |
| Ga0134110_101717371 | 3300012975 | Grasslands Soil | AIYDILRRGFTQAHLEKVRMEETMMNSFEYAGGAEVRR* |
| Ga0164304_110657061 | 3300012986 | Soil | TESLSIVIYEIMQRGFRFAHLEKVRIEETMMNSFEYAGEAGLAI* |
| Ga0157369_120507861 | 3300013105 | Corn Rhizosphere | ENLCIQIFDILQRRFPHAHLETVRLEETMMNSFEYAGGKELIS* |
| Ga0181539_11097293 | 3300014151 | Bog | LCIAIYEIVTRGFRHAHLEKVRIEETMMNSFEYRGEE* |
| Ga0181517_102394361 | 3300014160 | Bog | CISIYEIVKRGFKHAHLDKVRIEETMMNSFEYWGEQDVPEF* |
| Ga0182019_103025673 | 3300014498 | Fen | EIFEILQRGFQKVHLDKVRLEETMMNSFEYTGGAESMR* |
| Ga0182019_104504062 | 3300014498 | Fen | LTEIIYDILKQRFQSAHLEKVRIEETLNNSFEYAGGAELRH* |
| Ga0181519_107415531 | 3300014658 | Bog | TENLCLKIYEIVHRGFPLAHLERVRIEETLMNSFEYTGENAARF* |
| Ga0137418_108922491 | 3300015241 | Vadose Zone Soil | TEKLSASIYDILQRGFSHAHLEKVRIEETMMNSFEYAGGNEVRR* |
| Ga0137412_111894561 | 3300015242 | Vadose Zone Soil | AIYEIVKRGFDKAHLERVRIEETMKNSFEYRREGR* |
| Ga0132257_1019051072 | 3300015373 | Arabidopsis Rhizosphere | LCQEIYEILRREFSYAHLEKVRIEETMMNSFEYAGNAEMPH* |
| Ga0182041_109512322 | 3300016294 | Soil | ENLATVIYDILKRSFTAAHLERVRIEETLMNSFEYAGGREVPR |
| Ga0182033_107243701 | 3300016319 | Soil | LAEVVYEILKRRFTAAHLEKVRIEETLMNSFEYAGGAEVLR |
| Ga0182032_108903101 | 3300016357 | Soil | ELVFNILKQSFKAAHLEKVRIEETMMNSFEYSGDAALKA |
| Ga0182034_106250312 | 3300016371 | Soil | IEIFEILQRSFPHAHLERVRLEETMMNSFEYMGNNGARP |
| Ga0182037_110944391 | 3300016404 | Soil | DILKRSFAAAHLEKVRIEETLMNSFEYAGGAEVFR |
| Ga0182037_115546591 | 3300016404 | Soil | TENLCVAIHDILRRGFRHAHLEKVRMEETMMNSFAYAGGGELRD |
| Ga0182038_103179183 | 3300016445 | Soil | ENLAAVIYDILKRDFTAAHLERVRIEETAMNSFEYSGGSEASR |
| Ga0187802_101425292 | 3300017822 | Freshwater Sediment | IAIYDILQRGFHQAHLERVRFEETMMNSFEYRGETATSH |
| Ga0187856_11070553 | 3300017925 | Peatland | LCIAIYEIVTRGFRHAHLEKVRIEETMMNSFEYRGEE |
| Ga0187825_101201193 | 3300017930 | Freshwater Sediment | ENLCTAIYDILQRGFTYAHLEKVRIEETMMNSFEYAGAAEMQT |
| Ga0187814_102310042 | 3300017932 | Freshwater Sediment | CVAIFEILQRGFPHAHLEKVRLEETMMNSFEYAGAAEPRK |
| Ga0187808_103007601 | 3300017942 | Freshwater Sediment | FEILQRGFQKAHLERVRLEETMMNSFEYAAGSELRY |
| Ga0187817_104365441 | 3300017955 | Freshwater Sediment | NLCIVIYDILQRGFRYAHLEKVRFEETMMNSFEYAGGGQLCK |
| Ga0187817_108001151 | 3300017955 | Freshwater Sediment | TENLCMLIYDILQRGFRPAHLEKVRFEETMMNSFEYAGGQEKIG |
| Ga0187778_108069252 | 3300017961 | Tropical Peatland | AIYDILQRGFAYAHLEKVRFEETMMNSFEYAGGRELCN |
| Ga0187778_109001181 | 3300017961 | Tropical Peatland | IFEILQRSFPHAHLEKVRLEETMMNSFEYTGANGFRR |
| Ga0187778_109657691 | 3300017961 | Tropical Peatland | ENLCISIYEIVKRRFSAAHLEKVRIEETMMNSFEYAGEFGR |
| Ga0187776_100330065 | 3300017966 | Tropical Peatland | IEIYKILQRGFRRAHLEKVRMEETMMNSFEYAGGSELRS |
| Ga0187780_107741082 | 3300017973 | Tropical Peatland | LCIAIFEILQRGFSHAHLDRVRLEETMMNSFEYAGRAEPAK |
| Ga0187782_109298912 | 3300017975 | Tropical Peatland | ENLCISIFNIVKQQIVKRGFDKAHLEKVRIEETMLNSFEYAGEEGRSSVVDSR |
| Ga0187822_100897553 | 3300017994 | Freshwater Sediment | FEIVQRGFAPAHLEKVRLEETMMNSFEYWGDNAVRN |
| Ga0187822_101443051 | 3300017994 | Freshwater Sediment | IYEILRQGFHLAHLEKVRMEETMMNSFAYAGGKELRE |
| Ga0187816_102975212 | 3300017995 | Freshwater Sediment | CVAIYEIVKRGFGHAHLEKVRIEETMMNSFEYAGEGENL |
| Ga0187872_101232201 | 3300018017 | Peatland | CIAIYEIVTRGFRHAHLEKVRIEETMMNSFEYRGEE |
| Ga0187861_103858411 | 3300018020 | Peatland | IAIYEIVKRGFHRAHLEKIRIEETMMNSFEYSGKR |
| Ga0187889_102803362 | 3300018023 | Peatland | LCIAIYENVKRGFRKAHLEKVRIEETVMNSFEYSGER |
| Ga0187875_103874531 | 3300018035 | Peatland | NLCIAIYEIVKRGFYKAHLEKVRIEETMMNSFEYSGESSR |
| Ga0187772_114870961 | 3300018085 | Tropical Peatland | NLCVRIFDILQRGFGLAHLEKVRFEETMMNSFEYAGEGKNLVIV |
| Ga0187769_107121501 | 3300018086 | Tropical Peatland | AIYEILQRGFAEAHLERVRLEETMMNSFEYSGVNEPRR |
| Ga0187771_110842012 | 3300018088 | Tropical Peatland | VAIYEILQRGFPNAHLEKVKLEETMMNSFEYTGGNPPRR |
| Ga0187770_107899172 | 3300018090 | Tropical Peatland | IAIYDILQRGFRPAHLEKVRFEETMMNSFEYAGGRELIV |
| Ga0187770_115880731 | 3300018090 | Tropical Peatland | VEIYRRLERGFRAAAVEKVRLEETMMNSFEYCGGSGERQIGR |
| Ga0181504_13689651 | 3300019258 | Peatland | EHLCVAIFEILRRGYHQAHLEKVRIEETMMNSFEYAGGEEICC |
| Ga0182031_10556131 | 3300019787 | Bog | ENLCISMIYEIVKRGFKAAHLEKVRIEETMMNSFEYMGENRR |
| Ga0182031_12962403 | 3300019787 | Bog | IAIYEIVKRGFHNAHLEKIRIEETMMNSFEYAGEDSC |
| Ga0193729_11011263 | 3300019887 | Soil | LCTAIYDILRRGFTCAHLERVRIEETVMNSFEYAGGK |
| Ga0193735_10648073 | 3300020006 | Soil | YEILQRGFRHAHLERVRMEETMMNSFAYAGGAEIHD |
| Ga0193733_11228562 | 3300020022 | Soil | TENLCTTIYDILQRGFSHAHLERVRIEETMMNSFEYAGGK |
| Ga0210407_107519452 | 3300020579 | Soil | IEVFEILQRGFRKAHLEKVRLEETMMNSFEYAGGAEPRH |
| Ga0210399_103484371 | 3300020581 | Soil | VAIYEIVRRGFRQAHLEKVRMEETMMNSFAYAGGAELRD |
| Ga0210395_103007083 | 3300020582 | Soil | TENLCIQIYEIVQRGFHYAHLERVRLEETMMNSFEYAGKSEPLR |
| Ga0210395_106731631 | 3300020582 | Soil | PTTESLCVVVYDILQRGFRFAHLEKVRFDETMMNSFEYWGGNPVIE |
| Ga0210404_104288461 | 3300021088 | Soil | LSLEIYEILQRGFPQSHLERVRLEETMMNSFEYTGGNEPRR |
| Ga0210404_106874302 | 3300021088 | Soil | RIYEILQRGFRPAHLEKVRMEETMMNSFEYAGGAETRES |
| Ga0210405_107041512 | 3300021171 | Soil | KNLCIRIYEILQRGFHHAHLERVRMEETMMNSFAYAGGKDLRD |
| Ga0210385_111334722 | 3300021402 | Soil | KATLQYFENLSVEIFEILQRGFQMAHLDGVRLEETMMNSFEYVGSAEPRK |
| Ga0210397_101467101 | 3300021403 | Soil | IYEILQRGFRPAHLEKVRIEETMMNSFAYAGGAEIRD |
| Ga0210397_108452072 | 3300021403 | Soil | ENLCVVIYDILQRGFRHAHLEKVRFEETMMNSFEYWGENRVIE |
| Ga0210387_110399391 | 3300021405 | Soil | DILQRGFRNAHLEKVRFEETMMNSFEYWGENRVIV |
| Ga0210387_113787611 | 3300021405 | Soil | AVYDILQRGFRHAHLEKVRFEETMMNSFEYWGENRVLE |
| Ga0210386_112642752 | 3300021406 | Soil | DILQRGFQQAHLERVRFEETMMNAFEYWRENRVIE |
| Ga0210386_112651131 | 3300021406 | Soil | TENLSMAVYDILQRGFRLGHLERVRFEETLMNSFEYAGEKL |
| Ga0210383_103152591 | 3300021407 | Soil | IAIYEIVKRGFDKAHLDKVRIEETMMNSFEYRGESGG |
| Ga0210383_104123833 | 3300021407 | Soil | ENLCIAVYDILQRGFRHAHLEKVRFEETMMNSFEFWGENRVIE |
| Ga0210383_106489511 | 3300021407 | Soil | TTENLSVEIYEILQRGFQKAHLEGVRLEETMMNSFEYTGANEPRK |
| Ga0210394_106751291 | 3300021420 | Soil | LCIRIYEILQRGFRPAHLEKVRIEETMMNSFAYAGGAEIRD |
| Ga0210384_113826072 | 3300021432 | Soil | IENLCVEIFEILHRGFQNAHLERVRLEETMMNSFEYAGGAEIRK |
| Ga0210390_109657631 | 3300021474 | Soil | LCTAIYDILQRGFTCAHLEKVRIEETMMNSFEYAGASNIEHRL |
| Ga0210398_105025661 | 3300021477 | Soil | EILQRGFHHAHLERVRIEETMMNSFEYSGAAVLQK |
| Ga0210398_115869582 | 3300021477 | Soil | LCIVVYDILQRGFRHAHLEKVRFEETMMNSFEYWGVNRVIE |
| Ga0210402_111412181 | 3300021478 | Soil | FEILQRSFGHAHLERVRLEETMMNSFEYTGNNGGPS |
| Ga0210402_113958181 | 3300021478 | Soil | LCLVIYDILKRSFAQAHLEKVRLEETMMNSFEYEGN |
| Ga0210410_116918231 | 3300021479 | Soil | QLFEKVQRGFPHAHLERVRLEETMLNSFEYRGGREDHRIL |
| Ga0210409_1000173330 | 3300021559 | Soil | DILQRGFRHAHLEKVRFEETMMNSFEYWGENRVIE |
| Ga0242669_11134671 | 3300022528 | Soil | IYEILQRGFHHAHLEKVRMEETMMNSFAYAGGKDLRD |
| Ga0242660_10310822 | 3300022531 | Soil | LCIRIYEILQRGFHLAHLEKVRMEETMMNSFAYAGGKALRD |
| Ga0212123_108090382 | 3300022557 | Iron-Sulfur Acid Spring | TENLCVEIFEILQRGFHQAHLERVRIEETMMNAFEYSGTAELRK |
| Ga0242657_10776791 | 3300022722 | Soil | NLSVEIFEILQRRFPQAHLERVRLEETMMNSFEYAG |
| Ga0224558_12371971 | 3300023090 | Soil | TENLCIQIYEIVHRGFRKAHLERVRLEETMMNSFEYAGGEASH |
| Ga0224551_10396131 | 3300023259 | Soil | TENLCIQIYEIVHRGFPRAHLERVRLEETMMNSFEYTG |
| Ga0209171_101783823 | 3300025320 | Iron-Sulfur Acid Spring | EIFEILQRGFAQAHLDRVRLEETMMNSFEYAGASEPRH |
| Ga0208034_10644152 | 3300025442 | Peatland | NLCIAIYEIVTRGFRHAHLEKVRIEETMMNSFEYRGEE |
| Ga0208355_10286611 | 3300025581 | Arctic Peat Soil | FNILKQSFTAAHLEKVRLEETMMNSFEYAGGAELRV |
| Ga0208220_11785182 | 3300025627 | Arctic Peat Soil | TTENLCTVIYDILHRGFDLAHLEKVRIEETMMNSFEYAGGGELRK |
| Ga0207685_101219941 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | YEILQQGFHQAHLEKVRMEETMMNSFAYAGGKNIRD |
| Ga0207645_104030412 | 3300025907 | Miscanthus Rhizosphere | LCISVYDIVQRGFPLAHLVKVRIEETLMNSFEYWGSEPALT |
| Ga0207707_111367042 | 3300025912 | Corn Rhizosphere | LCTAIYDILQRGFTLAHLDKVRIEETMMNSFEYAGGAEIRP |
| Ga0207671_107860742 | 3300025914 | Corn Rhizosphere | ILQRGFTYAHLEKVRIEETMMNSFEYGGENEFVIE |
| Ga0207646_110278771 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | EIFEILQRGFAHAHLERVRLEETMMNSFEYAGGNEPQH |
| Ga0207687_103492163 | 3300025927 | Miscanthus Rhizosphere | IYEIVQRGFRLAHLEKVRIEETLMNSFEYWGAEQARI |
| Ga0207704_112448081 | 3300025938 | Miscanthus Rhizosphere | IYDILQRGFTLAHLDKVRIEETMMNSFEYAGDEEIRP |
| Ga0207665_104406132 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | KILQRSFGHAHLEKVRLEETMMNSFEYTGNNGGPS |
| Ga0207661_115847861 | 3300025944 | Corn Rhizosphere | DILQRGFTYAHLEKVRIEETMMNSFEYGGENEFVIE |
| Ga0207667_101655841 | 3300025949 | Corn Rhizosphere | IYDILRREFSCAHLEKVRIEETMMNSFEYAGNAEMLH |
| Ga0209803_11534971 | 3300026332 | Soil | AIYDILRRGFTQAHLEKIRMEETMMNSFEYAGGGEMRR |
| Ga0257178_10067011 | 3300026446 | Soil | LCIAVYEIVKRGFSKAHLEKVRIEETMMNSFEYAGENDR |
| Ga0257157_10913962 | 3300026496 | Soil | TENLCIVIYDILQRGFRHAHLEKVRFEETMMNSFEYWGENQVIE |
| Ga0209056_102401571 | 3300026538 | Soil | SACIYEIVQRGFDHAHLEKVRLEETMMNSFEYAGSEEVRK |
| Ga0209805_14234832 | 3300026542 | Soil | SIYEIVQEGFRHARLEKVRLEETMMNSFEYAGGAEIWR |
| Ga0209156_102890821 | 3300026547 | Soil | TENLCMEIYRRLRNGFHSAQVEKVRMEETMMNSFEYAGDAELRH |
| Ga0207824_10371092 | 3300026990 | Tropical Forest Soil | AEVVYNILKQSFHAAHLEQIRIEETLMNSFEYAGGNEPRR |
| Ga0208994_10656882 | 3300027164 | Forest Soil | FEILHRTFDKAHLEKVRIEETMLNSFEYAGANELRG |
| Ga0209527_11377692 | 3300027583 | Forest Soil | ENLCIRIYEIVQRGFGSAHLERVRLEETMMNSFEYSG |
| Ga0209220_11568052 | 3300027587 | Forest Soil | NLCIAIYDIVKRGFHKAHLEKIRIEETMMNSFEYSGEKGR |
| Ga0209422_10484111 | 3300027629 | Forest Soil | NLCIRIYEIVQRGFTHAHLERVRLEETMMNSFDYAGAEAGQ |
| Ga0209625_10038756 | 3300027635 | Forest Soil | YEIVKRGFRKAHLEKIRIEETMMNSFEYSGENGRTTSG |
| Ga0209076_11344941 | 3300027643 | Vadose Zone Soil | AIYDILWRGFRQAHLEKVRMEETMMNSFAYAGGAELRD |
| Ga0209333_10538851 | 3300027676 | Forest Soil | LCIHIYEIVQRGFPQAHLERVRIEETMMNSFEYAGEGS |
| Ga0209180_101482743 | 3300027846 | Vadose Zone Soil | TAIYDILRRGFTQAHLEKVRMEETMMNSFEYAGGAEIRR |
| Ga0209274_102994842 | 3300027853 | Soil | LCVSIYEIVKRGFNKAHLDKVRIEETMMNSFEYLGENGR |
| Ga0209693_102067301 | 3300027855 | Soil | IVVYDILQRGFRHAHLEKVRFEETMMNSFEYWGVNRVIE |
| Ga0209693_106367801 | 3300027855 | Soil | ENLCTAIYDILQRGFTQAHLEKVRIEETLMNSFEYAGEGKVIG |
| Ga0209590_104398491 | 3300027882 | Vadose Zone Soil | NLCATIYDILRRGFRNAHLEKVRMEETMMNSFEYAGGAEIRR |
| Ga0209275_101600121 | 3300027884 | Soil | IFEILQRGFYHAHLERVRLEETMMNSFEYAGTAEPKH |
| Ga0209380_103451342 | 3300027889 | Soil | IFEILQRGFHHAHLETVRIEETMMNSFEYSGAAELQK |
| Ga0209624_104396951 | 3300027895 | Forest Soil | IHNILQRGFTRAHLEKVRLDETMMNSFEFAGESELRK |
| Ga0209698_101910353 | 3300027911 | Watersheds | CIAIYEIVQRGFGRAHLEKVRIEETMMNSFEYAGEGEKL |
| Ga0209168_103446482 | 3300027986 | Surface Soil | NLCMVIYDILQRGFEHAHLERVRFEETMMNAFEYWGENRVIE |
| Ga0302301_11465111 | 3300028731 | Palsa | LCIQIYEIVQRGFHEAHLERVRLEETMMNSFEYAGRAESAGSFDREPGQ |
| Ga0302202_102118683 | 3300028762 | Bog | LCIAIYEIVSRGFHEAHLDKVRIEETMMNSFEYAGEDL |
| Ga0302269_11937732 | 3300028766 | Bog | ENLCIQIYEIVQRGFLHAHLERVRLEETMMNSFEYRG |
| Ga0302303_101814461 | 3300028776 | Palsa | FEILQRGFQHAHLEKVRIEETMMNSFEYSGTAQLQK |
| Ga0307305_103564311 | 3300028807 | Soil | TAIYDILQRGFTHAHLEKVRIEETMMNSFEYAGAAEIQPR |
| Ga0307312_101485431 | 3300028828 | Soil | ENLCTAIYDILQRGFTHAHLEKVRIEETMMNSFEYAGAAEIQPR |
| Ga0302278_104345282 | 3300028866 | Bog | ENVCILIYEVLQRQFHAAHLEKVRIEETMMNSFEYAGDAELKH |
| Ga0246001_10618241 | 3300029889 | Peat | LCIAIYEIVKRGFRKAHLEKIRIEETMMNSFEYSGENGR |
| Ga0311334_103963933 | 3300029987 | Fen | TENLSTAIYDILQRGFREAHLEKVRLEETMMNSFEYAGGGETRR |
| Ga0311338_106691081 | 3300030007 | Palsa | ENLCVEIFQIMQQGFHLAHLERVWIGETMMNSFEYAGGAELRR |
| Ga0302177_104340062 | 3300030053 | Palsa | ENLCIQIYEIVQRGFPHAHLERVRLEETMMNSFAYAGKGVQS |
| Ga0310037_103145821 | 3300030494 | Peatlands Soil | LCIAIYEIVKRGFNKAHLEKVRIEETMMNSFEYWGER |
| Ga0302275_102420452 | 3300030518 | Bog | CIHIYEIVQRSFHQAHLERVVIDETMMNSFEYAGEGR |
| Ga0311355_115248032 | 3300030580 | Palsa | IEIYEILQRGFSHAHLEKVRMEETMLNSFEYTGENEPRH |
| Ga0265773_10378071 | 3300031018 | Soil | SEVIYDLLKQNFKAAHLEKVRLEETAMNSFEYDGN |
| Ga0170834_1043848191 | 3300031057 | Forest Soil | EILSIEIYEILQRGFEKAHLDRVRLEETMMNSFEYTGSAEPRK |
| Ga0170834_1070955521 | 3300031057 | Forest Soil | LSIEIFEILHRSFSQAHLERVRLEETMMNSFEYTGNNGAPR |
| Ga0170824_1174095101 | 3300031231 | Forest Soil | EILQRGFQKAHLERVRLEETMMNSFEYAGGNEPRR |
| Ga0265330_100268615 | 3300031235 | Rhizosphere | TEKLCIAIYKIVKRGFDKAHLEKVRIEETMMNSFEYAGDM |
| Ga0265328_100606201 | 3300031239 | Rhizosphere | IFQILKQTFKAAHLEKVRLEETMMNSFEYAGGAELRR |
| Ga0265325_100772531 | 3300031241 | Rhizosphere | IFEILQRGFQKAHLEGVRLEETMMNSFEYAGTNELRR |
| Ga0265325_101187903 | 3300031241 | Rhizosphere | IFEILQRAFRHAHLERVRLEETMMNSFEYAGVKEAERPR |
| Ga0310686_1008398403 | 3300031708 | Soil | YDILQRGFRHAHLEKVRFEETMMNSFEYWGENRLIE |
| Ga0307476_100964121 | 3300031715 | Hardwood Forest Soil | IYEILRRGFPLAHLDKVRIEETMLNSFEYAGEAEPPK |
| Ga0307476_103142291 | 3300031715 | Hardwood Forest Soil | TENLCIQIYEIVHRGFPHAHLERVRLEETMMNSFEYTG |
| Ga0307476_104108932 | 3300031715 | Hardwood Forest Soil | LSVEIFEILQRGFHQAHLERVRLEETMMNSFEYAGGNEPRH |
| Ga0307469_121552672 | 3300031720 | Hardwood Forest Soil | YEILQRGFRHAHLEKVRMEETMMNSFVYAGGKALRD |
| Ga0307475_100097071 | 3300031754 | Hardwood Forest Soil | CVTIYEILRRGFRDAHLEKVRMEETMMNSFEYAGDAELRT |
| Ga0318557_105699472 | 3300031795 | Soil | VIYDILKRSFTAAHLERVRIEETLMNSFEYAGGREVHP |
| Ga0307473_106894042 | 3300031820 | Hardwood Forest Soil | LSASIYDILHRGFTHAHLEKIRIQETMMNSFEYAGGNEIRK |
| Ga0307478_116870432 | 3300031823 | Hardwood Forest Soil | ENLCIAIYEIMNRGFNRAHLEKVRIEETMMNSFEYSGES |
| Ga0307413_118068642 | 3300031824 | Rhizosphere | EGIYDIVNYGFKAAHLEKVKLQETSQNSFEYAGGAEIRA |
| Ga0308175_1019068712 | 3300031938 | Soil | CKFIFEILQRSFSKAHLERVRIEETMLNSFEYAGVSEIRP |
| Ga0310910_101474931 | 3300031946 | Soil | ENLASVIYDILKRSFTAAHLERVRIEETLMNSFEYAGGREVHP |
| Ga0306926_120912292 | 3300031954 | Soil | FEILQRSFAQAHLERVRLEETMMNSFEYTGENGSPR |
| Ga0308176_106883873 | 3300031996 | Soil | YEILKREFQHAHLERVRIEETMMNSFEYAGGVEPRR |
| Ga0318510_100377931 | 3300032064 | Soil | IYDILRRGFRHAHLEKVRMEETMMNSFEYAGGADIRH |
| Ga0318524_101254051 | 3300032067 | Soil | LCVHIYDILRRGFRHAHLEKVRMEETMMNSFEYAGGADIRH |
| Ga0307470_116135551 | 3300032174 | Hardwood Forest Soil | IYEILQRGFHHAHLERVRMEETMMNSFAYAGGKDLRD |
| Ga0307471_1008460202 | 3300032180 | Hardwood Forest Soil | NLCTAIYDILRRGFRHAHLEKVRMEETMMNSFEYAGGAEIRR |
| Ga0307471_1030318632 | 3300032180 | Hardwood Forest Soil | CIRIYEILQQGFHQAHLEKVRMEETMMNSFAYAGGKNIRD |
| Ga0307472_1004259973 | 3300032205 | Hardwood Forest Soil | EILQQGFHQAHLEKVRMEETMMNSFAYAGGKNIRD |
| Ga0335085_104968091 | 3300032770 | Soil | IYQILKREFRAAHLEKIRIEETANNSFEYYGEAQSS |
| Ga0335079_102080481 | 3300032783 | Soil | ENLCIAIYDILQRRFRHAHLEKVRFEETMMNSFEYAGGRELRP |
| Ga0335078_101879881 | 3300032805 | Soil | FEILQRSFPYAHLEKVRLEETMMNSFEYAGGNDPRH |
| Ga0335080_101768561 | 3300032828 | Soil | EILQRRFPHAHLEKVRLEETMMNAFEYAGGNELRP |
| Ga0335081_103447671 | 3300032892 | Soil | ENLCIGIFERLQRGFPHAHLERVRLEETMMNSFEYTGNGNAMRG |
| Ga0335081_108770253 | 3300032892 | Soil | LCIVIYDILQRGFREAHLEKVRFEETMMNSFEYAG |
| Ga0335083_109788322 | 3300032954 | Soil | IFEILQRAFRGAHLERVRLEETMMNSFEYAGGRDLAPLH |
| Ga0335083_111631941 | 3300032954 | Soil | NLSEVIFNILKQSFKSAHLEKVRLEETMMNSFEYAGGAELKT |
| Ga0335076_100177759 | 3300032955 | Soil | CMQIFEILQRGFPHAHLDKVRLEETMMNSFEYAGAQQLRY |
| Ga0335073_103703414 | 3300033134 | Soil | ISIFDILQRGFSKAHLEKVRFEETMMNSFEYAGGRELKVL |
| Ga0335077_102435861 | 3300033158 | Soil | RIYEILRRGFGLAHLEKVRMEETMMNSFEYSGGAEVHY |
| Ga0335077_107315611 | 3300033158 | Soil | VYDILQREFAGAHLKKVRFEETMMNSFEYAGDEEPPR |
| Ga0326726_120898921 | 3300033433 | Peat Soil | CIAIYEIVERGFGKAHLDKVRIEETMMNSFEYSGENGR |
| Ga0371490_10943201 | 3300033561 | Peat Soil | CIAIYKIVKRGFHHAHLEKVRIEETMMNSFEYTGER |
| Ga0371489_0459255_402_527 | 3300033755 | Peat Soil | MAVFDILQRGFRLAHLERVRFEETMMNSFEYAGDGKNLVIV |
| Ga0314865_101651_622_753 | 3300033806 | Peatland | ENLCARIHDILRRGFAHAHLEKVRIEETMMNSFEYAGGDEVRH |
| Ga0370515_0039896_1976_2095 | 3300034163 | Untreated Peat Soil | IYEILQRGFQKAHLEGVRLEETMMNSFEYTGPNEPRKVS |
| ⦗Top⦘ |