Metagenome / Metatranscriptome Family F013223

Basic Information
Family ID	F013223
Family Type	Metagenome / Metatranscriptome
Number of Sequences	273
Average Sequence Length	46 residues
Representative Sequence	PRDQKLEIIKQRCLQAAQVKYICVYPPQLPRYRELREQILGPAADLV
Number of Associated Samples	235
Number of Associated Scaffolds	273

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.73 %
% of genes near scaffold ends (potentially truncated)	99.27 %
% of genes from short scaffolds (< 2000 bps)	92.67 %
Associated GOLD sequencing projects	218
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.37

Most Common Taxonomy
Group	Bacteria (84.615 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (7.326 % of family members)
Environment Ontology (ENVO)	Unclassified (39.560 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (45.421 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 46.67% β-sheet: 0.00% Coil/Unstructured: 53.33%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 273 Family Scaffolds
PF00892	EamA	21.61
PF04226	Transgly_assoc	15.75
PF00171	Aldedh	15.02
PF00291	PALP	8.06
PF06764	DUF1223	6.23
PF01035	DNA_binding_1	4.03
PF02803	Thiolase_C	3.66
PF01717	Meth_synt_2	2.93
PF13458	Peripla_BP_6	2.56
PF12833	HTH_18	2.20
PF05787	DUF839	1.47
PF00072	Response_reg	1.10
PF00528	BPD_transp_1	1.10
PF00486	Trans_reg_C	0.73
PF08521	2CSK_N	0.73
PF03009	GDPD	0.37
PF00083	Sugar_tr	0.37
PF00884	Sulfatase	0.37
PF00691	OmpA	0.37
PF01594	AI-2E_transport	0.37
PF10881	DUF2726	0.37
PF00005	ABC_tran	0.37
PF01494	FAD_binding_3	0.37
PF13620	CarboxypepD_reg	0.37
PF01326	PPDK_N	0.37
PF05137	PilN	0.37
PF08770	SoxZ	0.37
PF12399	BCA_ABC_TP_C	0.37
PF00775	Dioxygenase_C	0.37
PF04392	ABC_sub_bind	0.37
PF00582	Usp	0.37

COG ID	Name	Functional Category	% Frequency in 273 Family Scaffolds
COG2261	Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family	General function prediction only [R]	15.75
COG0014	Gamma-glutamyl phosphate reductase	Amino acid transport and metabolism [E]	15.02
COG4230	Delta 1-pyrroline-5-carboxylate dehydrogenase	Amino acid transport and metabolism [E]	15.02
COG1012	Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase	Lipid transport and metabolism [I]	15.02
COG5429	Uncharacterized conserved protein, DUF1223 domain	Function unknown [S]	6.23
COG0350	DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase)	Replication, recombination and repair [L]	4.03
COG3695	Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain	Transcription [K]	4.03
COG0183	Acetyl-CoA acetyltransferase	Lipid transport and metabolism [I]	3.66
COG0620	Methionine synthase II (cobalamin-independent)	Amino acid transport and metabolism [E]	2.93
COG3211	Secreted phosphatase, PhoX family	General function prediction only [R]	1.47
COG0642	Signal transduction histidine kinase	Signal transduction mechanisms [T]	0.73
COG0654	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases	Energy production and conversion [C]	0.73
COG3166	Type IV pilus assembly protein PilN	Cell motility [N]	0.73
COG0644	Dehydrogenase (flavoprotein)	Energy production and conversion [C]	0.37
COG0665	Glycine/D-amino acid oxidase (deaminating)	Amino acid transport and metabolism [E]	0.37
COG0628	Predicted PurR-regulated permease PerM	General function prediction only [R]	0.37
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	0.37
COG3485	Protocatechuate 3,4-dioxygenase beta subunit	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.37
COG0584	Glycerophosphoryl diester phosphodiesterase	Lipid transport and metabolism [I]	0.37
COG0578	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.37
COG0574	Phosphoenolpyruvate synthase/pyruvate phosphate dikinase	Carbohydrate transport and metabolism [G]	0.37

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	84.62 %
Unclassified	root	N/A	15.38 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	84.62 %
Unclassified	root	N/A	15.38 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	84.62 %
Unclassified	root	N/A	15.38 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	56.04 %
Unclassified	root	N/A	15.38 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	3.66 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.37 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.37 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	39.56 %
Unclassified	root	N/A	15.38 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	3.30 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2.20 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.37 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.37 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.37 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.37 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.37 %

Name	Rank	Taxonomy	Distribution
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	21.25 %
Unclassified	root	N/A	15.38 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	4.40 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	3.30 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	1.47 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	1.10 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.37 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.37 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.37 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.37 %
Gemmatimonadetes	class	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes	0.37 %
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	0.37 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	21.25 %
Unclassified	root	N/A	15.38 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	3.30 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	1.10 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	1.10 %
Rhodanobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae	0.73 %
Gemmatimonadales	order	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales	0.37 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.37 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	0.37 %
unclassified Burkholderiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales	0.37 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.37 %
Streptosporangiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales	0.37 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	0.37 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.37 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.37 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	21.25 %
Unclassified	root	N/A	15.38 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	3.30 %
Aromatoleum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum	1.10 %
Herbaspirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum	1.10 %
Dyella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella	0.73 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.37 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.37 %
Gemmatimonadaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	0.37 %
Variovorax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax	0.37 %
Lysobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter	0.37 %
Thermomonosporaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae	0.37 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.37 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.37 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.37 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	21.25 %
Unclassified	root	N/A	15.38 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	3.30 %
Herbaspirillum chlorophenolicum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → Herbaspirillum chlorophenolicum	1.10 %
unclassified Aromatoleum	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum	1.10 %
Dyella caseinilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella → Dyella caseinilytica	0.73 %
unclassified Gemmatimonadaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae	0.37 %
unclassified Variovorax	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax	0.37 %
unclassified Lysobacter	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter	0.37 %
Actinomadura	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura	0.37 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.37 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.37 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.37 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.37 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.37 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	21.25 %
Unclassified	root	N/A	15.38 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	3.30 %
Aromatoleum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	1.10 %
Herbaspirillum chlorophenolicum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → Herbaspirillum chlorophenolicum	1.10 %
Dyella caseinilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella → Dyella caseinilytica	0.73 %
Gemmatimonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	0.37 %
Variovorax sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp.	0.37 %
Actinomadura madurae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae	0.37 %
Lysobacter sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp.	0.37 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.37 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.37 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.37 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.37 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.37 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300001213\|JGIcombinedJ13530_101624478	Not Available	988	Open in IMG/M
3300001213\|JGIcombinedJ13530_105755446	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	500	Open in IMG/M
3300004051\|Ga0055492_10004811	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1836	Open in IMG/M
3300004067\|Ga0055485_10211045	All Organisms → cellular organisms → Bacteria	556	Open in IMG/M
3300004082\|Ga0062384_101280603	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	536	Open in IMG/M
3300004152\|Ga0062386_100448652	All Organisms → cellular organisms → Bacteria	1043	Open in IMG/M
3300004156\|Ga0062589_100170398	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1526	Open in IMG/M
3300004156\|Ga0062589_100846378	Not Available	835	Open in IMG/M
3300004643\|Ga0062591_100753636	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	890	Open in IMG/M
3300004778\|Ga0062383_10373161	Not Available	698	Open in IMG/M
3300004781\|Ga0062379_10086038	Not Available	706	Open in IMG/M
3300005187\|Ga0066675_10116083	All Organisms → cellular organisms → Bacteria	1792	Open in IMG/M
3300005328\|Ga0070676_10086019	All Organisms → cellular organisms → Bacteria	1917	Open in IMG/M
3300005330\|Ga0070690_100026959	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	3549	Open in IMG/M
3300005330\|Ga0070690_101231067	All Organisms → cellular organisms → Bacteria	598	Open in IMG/M
3300005334\|Ga0068869_100189704	All Organisms → cellular organisms → Bacteria → Proteobacteria	1616	Open in IMG/M
3300005338\|Ga0068868_101943959	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	558	Open in IMG/M
3300005339\|Ga0070660_101943450	All Organisms → cellular organisms → Bacteria	502	Open in IMG/M
3300005340\|Ga0070689_100645702	Not Available	920	Open in IMG/M
3300005343\|Ga0070687_100071342	All Organisms → cellular organisms → Bacteria → Proteobacteria	1866	Open in IMG/M
3300005344\|Ga0070661_100001963	All Organisms → cellular organisms → Bacteria	14208	Open in IMG/M
3300005345\|Ga0070692_11086298	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp.	564	Open in IMG/M
3300005347\|Ga0070668_100411886	All Organisms → cellular organisms → Bacteria → Proteobacteria	1156	Open in IMG/M
3300005354\|Ga0070675_100504081	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1091	Open in IMG/M
3300005355\|Ga0070671_101487569	All Organisms → cellular organisms → Bacteria	599	Open in IMG/M
3300005356\|Ga0070674_100195193	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1559	Open in IMG/M
3300005364\|Ga0070673_102260167	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	517	Open in IMG/M
3300005366\|Ga0070659_100869538	All Organisms → cellular organisms → Bacteria → Proteobacteria	787	Open in IMG/M
3300005435\|Ga0070714_100143806	All Organisms → cellular organisms → Bacteria	2143	Open in IMG/M
3300005456\|Ga0070678_100254792	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1473	Open in IMG/M
3300005457\|Ga0070662_100128813	All Organisms → cellular organisms → Bacteria → Proteobacteria	1949	Open in IMG/M
3300005457\|Ga0070662_100150105	All Organisms → cellular organisms → Bacteria	1813	Open in IMG/M
3300005459\|Ga0068867_100445135	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1102	Open in IMG/M
3300005530\|Ga0070679_100733437	All Organisms → cellular organisms → Bacteria → Proteobacteria	931	Open in IMG/M
3300005536\|Ga0070697_100605776	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	963	Open in IMG/M
3300005543\|Ga0070672_100751317	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	856	Open in IMG/M
3300005543\|Ga0070672_101218099	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	671	Open in IMG/M
3300005548\|Ga0070665_100466044	All Organisms → cellular organisms → Bacteria → Proteobacteria	1274	Open in IMG/M
3300005553\|Ga0066695_10366021	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	901	Open in IMG/M
3300005554\|Ga0066661_10656741	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	618	Open in IMG/M
3300005555\|Ga0066692_10764393	Not Available	596	Open in IMG/M
3300005563\|Ga0068855_100001032	All Organisms → cellular organisms → Bacteria → Proteobacteria	34674	Open in IMG/M
3300005563\|Ga0068855_100377847	All Organisms → cellular organisms → Bacteria	1556	Open in IMG/M
3300005563\|Ga0068855_101918973	All Organisms → cellular organisms → Bacteria	599	Open in IMG/M
3300005564\|Ga0070664_101600791	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella → Dyella caseinilytica	617	Open in IMG/M
3300005577\|Ga0068857_100980685	All Organisms → cellular organisms → Bacteria	813	Open in IMG/M
3300005578\|Ga0068854_101265029	Not Available	663	Open in IMG/M
3300005578\|Ga0068854_101614344	All Organisms → cellular organisms → Bacteria	591	Open in IMG/M
3300005578\|Ga0068854_101875167	All Organisms → cellular organisms → Bacteria	551	Open in IMG/M
3300005598\|Ga0066706_10708333	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	800	Open in IMG/M
3300005598\|Ga0066706_10964494	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	659	Open in IMG/M
3300005719\|Ga0068861_100256923	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1494	Open in IMG/M
3300005719\|Ga0068861_100432962	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1174	Open in IMG/M
3300005719\|Ga0068861_101755609	All Organisms → cellular organisms → Bacteria	615	Open in IMG/M
3300005830\|Ga0074473_10221767	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1212	Open in IMG/M
3300005841\|Ga0068863_102726603	All Organisms → cellular organisms → Bacteria	503	Open in IMG/M
3300005885\|Ga0075284_1069046	All Organisms → cellular organisms → Bacteria	519	Open in IMG/M
3300005995\|Ga0066790_10241835	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	770	Open in IMG/M
3300006031\|Ga0066651_10169709	All Organisms → cellular organisms → Bacteria	1149	Open in IMG/M
3300006049\|Ga0075417_10366296	All Organisms → cellular organisms → Bacteria	708	Open in IMG/M
3300006050\|Ga0075028_100594402	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	656	Open in IMG/M
3300006056\|Ga0075163_10674880	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1104	Open in IMG/M
3300006172\|Ga0075018_10241616	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	871	Open in IMG/M
3300006173\|Ga0070716_100047711	All Organisms → cellular organisms → Bacteria	2418	Open in IMG/M
3300006173\|Ga0070716_101535890	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	545	Open in IMG/M
3300006237\|Ga0097621_100775907	All Organisms → cellular organisms → Bacteria → Proteobacteria	887	Open in IMG/M
3300006358\|Ga0068871_101515097	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → Herbaspirillum chlorophenolicum	634	Open in IMG/M
3300006358\|Ga0068871_102211756	Not Available	524	Open in IMG/M
3300006796\|Ga0066665_10118569	All Organisms → cellular organisms → Bacteria	1968	Open in IMG/M
3300006797\|Ga0066659_10180077	All Organisms → cellular organisms → Bacteria	1530	Open in IMG/M
3300006806\|Ga0079220_11992904	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	517	Open in IMG/M
3300006844\|Ga0075428_100976091	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	897	Open in IMG/M
3300006854\|Ga0075425_101630325	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	727	Open in IMG/M
3300006871\|Ga0075434_101513574	All Organisms → cellular organisms → Bacteria → Proteobacteria	680	Open in IMG/M
3300006871\|Ga0075434_102142637	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	563	Open in IMG/M
3300006903\|Ga0075426_10153815	All Organisms → cellular organisms → Bacteria	1660	Open in IMG/M
3300006903\|Ga0075426_10949834	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	649	Open in IMG/M
3300006914\|Ga0075436_100697251	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	752	Open in IMG/M
3300006954\|Ga0079219_10001611	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	5739	Open in IMG/M
3300007521\|Ga0105044_10762621	All Organisms → cellular organisms → Bacteria	775	Open in IMG/M
3300009075\|Ga0105090_10487694	All Organisms → cellular organisms → Bacteria	749	Open in IMG/M
3300009075\|Ga0105090_10680426	All Organisms → cellular organisms → Bacteria	625	Open in IMG/M
3300009085\|Ga0105103_10693529	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	585	Open in IMG/M
3300009100\|Ga0075418_12832410	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	529	Open in IMG/M
3300009111\|Ga0115026_10129719	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1591	Open in IMG/M
3300009143\|Ga0099792_11061095	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	544	Open in IMG/M
3300009147\|Ga0114129_11401284	Not Available	862	Open in IMG/M
3300009167\|Ga0113563_12473759	All Organisms → cellular organisms → Bacteria	626	Open in IMG/M
3300009177\|Ga0105248_10859125	All Organisms → cellular organisms → Bacteria → Proteobacteria	1024	Open in IMG/M
3300009545\|Ga0105237_12776871	All Organisms → cellular organisms → Bacteria	501	Open in IMG/M
3300009553\|Ga0105249_10861510	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	972	Open in IMG/M
3300009792\|Ga0126374_11428369	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	565	Open in IMG/M
3300010051\|Ga0133939_1003579	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	10863	Open in IMG/M
3300010304\|Ga0134088_10606608	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	545	Open in IMG/M
3300010320\|Ga0134109_10103153	All Organisms → cellular organisms → Bacteria	994	Open in IMG/M
3300010343\|Ga0074044_10887037	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	583	Open in IMG/M
3300010373\|Ga0134128_10134766	All Organisms → cellular organisms → Bacteria → Proteobacteria	2795	Open in IMG/M
3300010396\|Ga0134126_12738458	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	535	Open in IMG/M
3300011106\|Ga0151489_1522661	Not Available	632	Open in IMG/M
3300011119\|Ga0105246_12199503	Not Available	537	Open in IMG/M
3300011429\|Ga0137455_1090028	Not Available	893	Open in IMG/M
3300012200\|Ga0137382_10147396	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1593	Open in IMG/M
3300012212\|Ga0150985_120994958	All Organisms → cellular organisms → Bacteria	524	Open in IMG/M
3300012285\|Ga0137370_10898685	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	548	Open in IMG/M
3300012357\|Ga0137384_11276846	Not Available	581	Open in IMG/M
3300012469\|Ga0150984_122169251	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	585	Open in IMG/M
3300012501\|Ga0157351_1046901	All Organisms → cellular organisms → Bacteria	557	Open in IMG/M
3300012582\|Ga0137358_10823113	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	615	Open in IMG/M
3300012892\|Ga0157294_10294851	Not Available	516	Open in IMG/M
3300012922\|Ga0137394_10323543	Not Available	1317	Open in IMG/M
3300012986\|Ga0164304_10411753	All Organisms → cellular organisms → Bacteria	963	Open in IMG/M
3300012986\|Ga0164304_10854343	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	707	Open in IMG/M
3300012988\|Ga0164306_11858472	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	524	Open in IMG/M
3300013102\|Ga0157371_10844922	All Organisms → cellular organisms → Bacteria	692	Open in IMG/M
3300013297\|Ga0157378_12673171	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	552	Open in IMG/M
3300013306\|Ga0163162_11501033	All Organisms → cellular organisms → Bacteria → Proteobacteria	768	Open in IMG/M
3300013306\|Ga0163162_12396115	All Organisms → cellular organisms → Bacteria	607	Open in IMG/M
3300013307\|Ga0157372_11056848	All Organisms → cellular organisms → Bacteria → Proteobacteria	940	Open in IMG/M
3300013308\|Ga0157375_11690166	Not Available	749	Open in IMG/M
3300014150\|Ga0134081_10361671	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	535	Open in IMG/M
3300014266\|Ga0075359_1020451	Not Available	970	Open in IMG/M
3300014325\|Ga0163163_10007799	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	9462	Open in IMG/M
3300014325\|Ga0163163_11169444	Not Available	832	Open in IMG/M
3300014325\|Ga0163163_12405442	Not Available	585	Open in IMG/M
3300014326\|Ga0157380_11554382	Not Available	716	Open in IMG/M
3300014502\|Ga0182021_11400714	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	842	Open in IMG/M
3300014745\|Ga0157377_10455214	All Organisms → cellular organisms → Bacteria → Proteobacteria	884	Open in IMG/M
3300014968\|Ga0157379_11459721	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → Herbaspirillum chlorophenolicum	664	Open in IMG/M
3300014968\|Ga0157379_11956856	Not Available	578	Open in IMG/M
3300015087\|Ga0167637_1008089	All Organisms → cellular organisms → Bacteria	1568	Open in IMG/M
3300015162\|Ga0167653_1083351	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	513	Open in IMG/M
3300015201\|Ga0173478_10502967	Not Available	607	Open in IMG/M
3300015371\|Ga0132258_12353390	All Organisms → cellular organisms → Bacteria → Proteobacteria	1335	Open in IMG/M
3300015372\|Ga0132256_103539963	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	525	Open in IMG/M
3300015373\|Ga0132257_104119649	All Organisms → cellular organisms → Bacteria	529	Open in IMG/M
3300015373\|Ga0132257_104636618	All Organisms → cellular organisms → Bacteria → Proteobacteria	500	Open in IMG/M
3300015374\|Ga0132255_101736395	All Organisms → cellular organisms → Bacteria → Proteobacteria	947	Open in IMG/M
3300016341\|Ga0182035_10256941	All Organisms → cellular organisms → Bacteria	1413	Open in IMG/M
3300016422\|Ga0182039_10875927	Not Available	801	Open in IMG/M
3300017927\|Ga0187824_10306384	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	563	Open in IMG/M
3300017959\|Ga0187779_10189482	All Organisms → cellular organisms → Bacteria	1283	Open in IMG/M
3300017961\|Ga0187778_10848270	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	625	Open in IMG/M
3300017974\|Ga0187777_11401532	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	516	Open in IMG/M
3300018075\|Ga0184632_10323776	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	664	Open in IMG/M
3300018081\|Ga0184625_10087042	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	1603	Open in IMG/M
3300018469\|Ga0190270_10983011	Not Available	869	Open in IMG/M
3300018476\|Ga0190274_10709970	All Organisms → cellular organisms → Bacteria → Proteobacteria	1051	Open in IMG/M
3300018476\|Ga0190274_11608475	Not Available	743	Open in IMG/M
3300018476\|Ga0190274_13694896	All Organisms → cellular organisms → Bacteria	517	Open in IMG/M
3300018481\|Ga0190271_10350409	All Organisms → cellular organisms → Bacteria → Proteobacteria	1557	Open in IMG/M
3300018482\|Ga0066669_12339495	All Organisms → cellular organisms → Bacteria	510	Open in IMG/M
3300018920\|Ga0190273_12368921	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	504	Open in IMG/M
3300019879\|Ga0193723_1109550	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	774	Open in IMG/M
3300019888\|Ga0193751_1143283	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	865	Open in IMG/M
3300020082\|Ga0206353_11873453	All Organisms → cellular organisms → Bacteria	551	Open in IMG/M
3300021081\|Ga0210379_10581406	All Organisms → cellular organisms → Bacteria	500	Open in IMG/M
3300021082\|Ga0210380_10306034	Not Available	724	Open in IMG/M
3300021344\|Ga0193719_10054612	All Organisms → cellular organisms → Bacteria → Proteobacteria	1731	Open in IMG/M
3300025321\|Ga0207656_10176272	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1024	Open in IMG/M
3300025461\|Ga0208851_1074938	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	568	Open in IMG/M
3300025872\|Ga0208783_10309859	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	626	Open in IMG/M
3300025901\|Ga0207688_10110683	All Organisms → cellular organisms → Bacteria → Proteobacteria	1594	Open in IMG/M
3300025906\|Ga0207699_10233213	All Organisms → cellular organisms → Bacteria	1261	Open in IMG/M
3300025907\|Ga0207645_10455724	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	864	Open in IMG/M
3300025907\|Ga0207645_10624946	Not Available	732	Open in IMG/M
3300025912\|Ga0207707_10120793	All Organisms → cellular organisms → Bacteria → Proteobacteria	2291	Open in IMG/M
3300025919\|Ga0207657_11226048	All Organisms → cellular organisms → Bacteria	569	Open in IMG/M
3300025921\|Ga0207652_10671243	All Organisms → cellular organisms → Bacteria → Proteobacteria	926	Open in IMG/M
3300025921\|Ga0207652_10694660	All Organisms → cellular organisms → Bacteria → Proteobacteria	908	Open in IMG/M
3300025925\|Ga0207650_11103344	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	675	Open in IMG/M
3300025926\|Ga0207659_11016654	Not Available	713	Open in IMG/M
3300025927\|Ga0207687_11511334	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	577	Open in IMG/M
3300025931\|Ga0207644_11443227	All Organisms → cellular organisms → Bacteria → Proteobacteria	578	Open in IMG/M
3300025933\|Ga0207706_10066110	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	3182	Open in IMG/M
3300025938\|Ga0207704_10462119	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1015	Open in IMG/M
3300025940\|Ga0207691_10806328	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	789	Open in IMG/M
3300025940\|Ga0207691_11231505	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	620	Open in IMG/M
3300025942\|Ga0207689_10361418	All Organisms → cellular organisms → Bacteria	1207	Open in IMG/M
3300025944\|Ga0207661_10255871	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1558	Open in IMG/M
3300025949\|Ga0207667_11689885	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	600	Open in IMG/M
3300025964\|Ga0210127_1031657	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → Herbaspirillum chlorophenolicum	628	Open in IMG/M
3300025972\|Ga0207668_10841930	Not Available	814	Open in IMG/M
3300025981\|Ga0207640_11643909	All Organisms → cellular organisms → Bacteria	579	Open in IMG/M
3300025986\|Ga0207658_10049231	All Organisms → cellular organisms → Bacteria	3095	Open in IMG/M
3300026035\|Ga0207703_10301458	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1462	Open in IMG/M
3300026067\|Ga0207678_10029797	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	4765	Open in IMG/M
3300026088\|Ga0207641_12622282	All Organisms → cellular organisms → Bacteria	502	Open in IMG/M
3300026095\|Ga0207676_11116609	All Organisms → cellular organisms → Bacteria → Proteobacteria	780	Open in IMG/M
3300026121\|Ga0207683_10274154	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1541	Open in IMG/M
3300026217\|Ga0209871_1004279	All Organisms → cellular organisms → Bacteria	2815	Open in IMG/M
3300026550\|Ga0209474_10387288	All Organisms → cellular organisms → Bacteria → Proteobacteria	741	Open in IMG/M
3300026552\|Ga0209577_10638751	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	619	Open in IMG/M
3300027310\|Ga0207983_1021003	Not Available	791	Open in IMG/M
3300027471\|Ga0209995_1067634	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	610	Open in IMG/M
3300027683\|Ga0209392_1146990	All Organisms → cellular organisms → Bacteria	734	Open in IMG/M
3300027725\|Ga0209178_1168028	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp.	765	Open in IMG/M
3300027885\|Ga0209450_10166195	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1537	Open in IMG/M
3300027897\|Ga0209254_10957894	All Organisms → cellular organisms → Bacteria	562	Open in IMG/M
3300027948\|Ga0209858_1024860	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	555	Open in IMG/M
3300027955\|Ga0209078_1138123	All Organisms → cellular organisms → Bacteria	683	Open in IMG/M
3300027972\|Ga0209079_10301118	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	543	Open in IMG/M
3300028380\|Ga0268265_10255903	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1554	Open in IMG/M
3300028380\|Ga0268265_10698866	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	979	Open in IMG/M
3300028380\|Ga0268265_12666567	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	505	Open in IMG/M
3300028381\|Ga0268264_12491133	All Organisms → cellular organisms → Bacteria	523	Open in IMG/M
3300028665\|Ga0302160_10029005	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1053	Open in IMG/M
3300028665\|Ga0302160_10170853	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	515	Open in IMG/M
3300028679\|Ga0302169_10189314	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	529	Open in IMG/M
3300028739\|Ga0302205_10208341	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	502	Open in IMG/M
3300028777\|Ga0302290_10208185	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	524	Open in IMG/M
3300028802\|Ga0307503_10262072	Not Available	850	Open in IMG/M
3300028868\|Ga0302163_10075337	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	831	Open in IMG/M
3300028869\|Ga0302263_10310144	Not Available	626	Open in IMG/M
3300028869\|Ga0302263_10459101	All Organisms → cellular organisms → Bacteria	501	Open in IMG/M
3300028889\|Ga0247827_10100859	All Organisms → cellular organisms → Bacteria → Proteobacteria	1447	Open in IMG/M
3300029944\|Ga0311352_10927209	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	674	Open in IMG/M
3300029980\|Ga0302298_10021711	All Organisms → cellular organisms → Bacteria	1789	Open in IMG/M
3300029984\|Ga0311332_11329674	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	581	Open in IMG/M
3300030003\|Ga0302172_10262852	Not Available	552	Open in IMG/M
3300030047\|Ga0302286_10018459	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4092	Open in IMG/M
3300030050\|Ga0302255_1008517	All Organisms → cellular organisms → Bacteria	1800	Open in IMG/M
3300030491\|Ga0302211_10022030	All Organisms → cellular organisms → Bacteria	1802	Open in IMG/M
3300030838\|Ga0311335_10760896	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	684	Open in IMG/M
3300030943\|Ga0311366_10268087	All Organisms → cellular organisms → Bacteria → Proteobacteria	1478	Open in IMG/M
3300030943\|Ga0311366_11886677	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae	509	Open in IMG/M
3300031232\|Ga0302323_100769457	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1056	Open in IMG/M
3300031521\|Ga0311364_11378052	All Organisms → cellular organisms → Bacteria	698	Open in IMG/M
3300031549\|Ga0318571_10130235	Not Available	852	Open in IMG/M
3300031668\|Ga0318542_10034026	All Organisms → cellular organisms → Bacteria → Proteobacteria	2218	Open in IMG/M
3300031722\|Ga0311351_11199998	Not Available	582	Open in IMG/M
3300031771\|Ga0318546_11140870	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	548	Open in IMG/M
3300031778\|Ga0318498_10345549	Not Available	664	Open in IMG/M
3300031794\|Ga0318503_10172945	Not Available	699	Open in IMG/M
3300031796\|Ga0318576_10483352	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	585	Open in IMG/M
3300031798\|Ga0318523_10613290	All Organisms → cellular organisms → Bacteria → Proteobacteria	535	Open in IMG/M
3300031834\|Ga0315290_11675126	All Organisms → cellular organisms → Bacteria	511	Open in IMG/M
3300031852\|Ga0307410_10099782	All Organisms → cellular organisms → Bacteria	2079	Open in IMG/M
3300031901\|Ga0307406_10189878	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1503	Open in IMG/M
3300031910\|Ga0306923_12322300	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	534	Open in IMG/M
3300031913\|Ga0310891_10309242	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	559	Open in IMG/M
3300031939\|Ga0308174_10139078	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1795	Open in IMG/M
3300031939\|Ga0308174_10224501	All Organisms → cellular organisms → Bacteria → Proteobacteria	1445	Open in IMG/M
3300031995\|Ga0307409_100128911	All Organisms → cellular organisms → Bacteria	2157	Open in IMG/M
3300032012\|Ga0310902_11042532	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella → Dyella caseinilytica	570	Open in IMG/M
3300032059\|Ga0318533_11173352	All Organisms → cellular organisms → Bacteria → Proteobacteria	562	Open in IMG/M
3300032074\|Ga0308173_10393099	All Organisms → cellular organisms → Bacteria → Proteobacteria	1218	Open in IMG/M
3300032076\|Ga0306924_10074650	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3791	Open in IMG/M
3300032118\|Ga0315277_11592187	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	554	Open in IMG/M
3300032143\|Ga0315292_10275665	All Organisms → cellular organisms → Bacteria	1396	Open in IMG/M
3300032144\|Ga0315910_10400655	Not Available	1051	Open in IMG/M
3300032164\|Ga0315283_11136451	Not Available	819	Open in IMG/M
3300032174\|Ga0307470_10101649	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1648	Open in IMG/M
3300032180\|Ga0307471_100678086	Not Available	1194	Open in IMG/M
3300032180\|Ga0307471_104001241	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	521	Open in IMG/M
3300032205\|Ga0307472_101414116	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	675	Open in IMG/M
3300032256\|Ga0315271_10517841	Not Available	1013	Open in IMG/M
3300032397\|Ga0315287_10352525	All Organisms → cellular organisms → Bacteria	1740	Open in IMG/M
3300032397\|Ga0315287_10631735	All Organisms → cellular organisms → Bacteria → Proteobacteria	1267	Open in IMG/M
3300032397\|Ga0315287_12821031	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	514	Open in IMG/M
3300032893\|Ga0335069_10332907	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1798	Open in IMG/M
3300033004\|Ga0335084_10857497	All Organisms → cellular organisms → Bacteria → Proteobacteria	920	Open in IMG/M
3300033408\|Ga0316605_11725232	All Organisms → cellular organisms → Bacteria	609	Open in IMG/M
3300033413\|Ga0316603_11645570	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	608	Open in IMG/M
3300033414\|Ga0316619_10477269	Not Available	1009	Open in IMG/M
3300033419\|Ga0316601_100295544	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1479	Open in IMG/M
3300033419\|Ga0316601_101655887	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	645	Open in IMG/M
3300033433\|Ga0326726_10140259	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2197	Open in IMG/M
3300033482\|Ga0316627_102764243	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	521	Open in IMG/M
3300033488\|Ga0316621_11021061	All Organisms → cellular organisms → Bacteria	617	Open in IMG/M
3300033521\|Ga0316616_104156410	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	545	Open in IMG/M
3300033557\|Ga0316617_102132279	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	577	Open in IMG/M
3300034090\|Ga0326723_0450170	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	588	Open in IMG/M
3300034127\|Ga0370489_0220818	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	565	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	63.37%
Host-Associated	Host-Associated	35.90%
Engineered	Engineered	0.73%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	49.45%
Plants	Host-Associated → Plants	35.90%
Aquatic	Environmental → Aquatic	13.92%
Wastewater	Engineered → Wastewater	0.73%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	41.03%
Rhizosphere	Host-Associated → Plants → Rhizosphere	20.15%
Rhizoplane	Host-Associated → Plants → Rhizoplane	13.55%
Freshwater	Environmental → Aquatic → Freshwater	9.52%
Peat	Environmental → Terrestrial → Peat	8.42%
Marine	Environmental → Aquatic → Marine	2.20%
Sediment	Environmental → Aquatic → Sediment	2.20%
Roots	Host-Associated → Plants → Roots	2.20%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	0.37%
Nutrient Removal	Engineered → Wastewater → Nutrient Removal	0.37%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	27.47%
Soil	Host-Associated → Plants → Rhizosphere → Soil	10.62%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	10.99%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	9.52%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	8.42%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	7.69%
Loam	Environmental → Terrestrial → Soil → Loam	5.49%
Sediment	Environmental → Aquatic → Freshwater → Sediment	3.30%
Lake	Environmental → Aquatic → Freshwater → Lake	2.93%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	2.20%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.20%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	2.20%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.83%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.83%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.73%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.73%
Ice	Environmental → Aquatic → Freshwater → Ice	0.37%
Coastal	Environmental → Aquatic → Marine → Coastal	0.37%
Sand	Environmental → Terrestrial → Soil → Sand	0.37%
Petrochemical	Engineered → Wastewater → Industrial Wastewater → Petrochemical	0.37%
Unclassified	Engineered → Wastewater → Nutrient Removal → Unclassified	0.37%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	12.45%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	10.62%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	10.99%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	9.52%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	8.42%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	6.59%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	5.86%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.49%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.40%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	3.30%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	2.93%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.20%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.20%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	2.20%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	2.20%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.83%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	1.10%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.10%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	1.10%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	0.73%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.73%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	0.73%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.73%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.37%
Glacial Lake	Environmental → Aquatic → Freshwater → Ice → Glacial Lake	0.37%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	0.37%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.37%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.37%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified	0.37%
Unclassified	Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified	0.37%

Habitat	Taxonomy	Distribution
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	7.33%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	5.86%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	4.03%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	4.03%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	4.03%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	3.30%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	3.66%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.66%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	3.66%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	2.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.93%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.93%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	2.20%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	2.20%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	2.20%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.83%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.83%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.47%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.47%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.47%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.47%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.10%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.10%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.10%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.10%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.10%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	1.10%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	1.10%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.10%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.10%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.10%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.73%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	0.73%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.73%
Wetland Sediment	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment	0.73%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	0.73%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.73%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.73%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.73%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.73%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.73%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.73%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.73%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.73%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.73%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.73%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.73%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	0.37%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.37%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.37%
Freshwater	Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater	0.37%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	0.37%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.37%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.37%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.37%
Unplanted Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil	0.37%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.37%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	0.37%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.37%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.37%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.37%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.37%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	0.37%
Permafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil	0.37%
Fen	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen	0.37%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	0.37%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.37%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.37%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	0.37%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.37%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.37%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.37%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.37%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.37%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.37%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Industrial Wastewater	0.37%
Wastewater Effluent	Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent	0.37%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300001213	Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)	Environmental	Open in IMG/M
3300004051	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2	Environmental	Open in IMG/M
3300004067	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2	Environmental	Open in IMG/M
3300004082	Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3	Environmental	Open in IMG/M
3300004152	Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300004778	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh	Environmental	Open in IMG/M
3300004781	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh	Environmental	Open in IMG/M
3300005187	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124	Environmental	Open in IMG/M
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Host-Associated	Open in IMG/M
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental	Open in IMG/M
3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Environmental	Open in IMG/M
3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Host-Associated	Open in IMG/M
3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Environmental	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Host-Associated	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Host-Associated	Open in IMG/M
3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Host-Associated	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005553	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144	Environmental	Open in IMG/M
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental	Open in IMG/M
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005830	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM	Environmental	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005885	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401	Environmental	Open in IMG/M
3300005995	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050	Environmental	Open in IMG/M
3300006031	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100	Environmental	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental	Open in IMG/M
3300006056	Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNA	Engineered	Open in IMG/M
3300006172	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300007521	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01	Environmental	Open in IMG/M
3300009075	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015	Environmental	Open in IMG/M
3300009085	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015	Environmental	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009111	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1	Environmental	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009167	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)	Environmental	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010051	Industrial wastewater microbial communities from reactors of effluent treatment plant in South Killingholme, Immingham, England. Combined Assembly of Gp0151195, Gp0151196	Engineered	Open in IMG/M
3300010304	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015	Environmental	Open in IMG/M
3300010320	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015	Environmental	Open in IMG/M
3300010343	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300011106	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300011429	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012501	Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610	Environmental	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012892	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014150	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300014266	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleB_D1	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014502	Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015087	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6A, Proglacial plain, adjacent to northern proglacial tributary)	Environmental	Open in IMG/M
3300015162	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4c, rock/ice/stream interface)	Environmental	Open in IMG/M
3300015201	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016341	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170	Environmental	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300017927	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4	Environmental	Open in IMG/M
3300017959	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG	Environmental	Open in IMG/M
3300017961	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG	Environmental	Open in IMG/M
3300017974	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG	Environmental	Open in IMG/M
3300018075	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1	Environmental	Open in IMG/M
3300018081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300018920	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS	Environmental	Open in IMG/M
3300019879	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2	Environmental	Open in IMG/M
3300019888	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2	Environmental	Open in IMG/M
3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300021081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo	Environmental	Open in IMG/M
3300021082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo	Environmental	Open in IMG/M
3300021344	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2	Environmental	Open in IMG/M
3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025461	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-092012 (SPAdes)	Environmental	Open in IMG/M
3300025872	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated	Open in IMG/M
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025964	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2 (SPAdes)	Environmental	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026217	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes)	Environmental	Open in IMG/M
3300026550	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)	Environmental	Open in IMG/M
3300026552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)	Environmental	Open in IMG/M
3300027310	Soil and rhizosphere microbial communities from Laval, Canada - mgHMB (SPAdes)	Environmental	Open in IMG/M
3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes)	Host-Associated	Open in IMG/M
3300027683	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300027725	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)	Environmental	Open in IMG/M
3300027885	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)	Environmental	Open in IMG/M
3300027897	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)	Environmental	Open in IMG/M
3300027948	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 (SPAdes)	Environmental	Open in IMG/M
3300027955	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300027972	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028665	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3	Environmental	Open in IMG/M
3300028679	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_3	Environmental	Open in IMG/M
3300028739	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E1_3	Environmental	Open in IMG/M
3300028777	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_3	Environmental	Open in IMG/M
3300028802	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S	Environmental	Open in IMG/M
3300028868	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3	Environmental	Open in IMG/M
3300028869	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4	Environmental	Open in IMG/M
3300028889	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2	Environmental	Open in IMG/M
3300029944	II_Palsa_E1 coassembly	Environmental	Open in IMG/M
3300029980	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3	Environmental	Open in IMG/M
3300029984	I_Fen_E1 coassembly	Environmental	Open in IMG/M
3300030003	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3	Environmental	Open in IMG/M
3300030047	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3	Environmental	Open in IMG/M
3300030050	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_4	Environmental	Open in IMG/M
3300030491	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_3	Environmental	Open in IMG/M
3300030838	I_Fen_N1 coassembly	Environmental	Open in IMG/M
3300030943	III_Fen_N2 coassembly	Environmental	Open in IMG/M
3300031232	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3	Environmental	Open in IMG/M
3300031521	III_Fen_E2 coassembly	Environmental	Open in IMG/M
3300031549	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24	Environmental	Open in IMG/M
3300031668	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23	Environmental	Open in IMG/M
3300031722	II_Fen_N3 coassembly	Environmental	Open in IMG/M
3300031771	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19	Environmental	Open in IMG/M
3300031778	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24	Environmental	Open in IMG/M
3300031794	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23	Environmental	Open in IMG/M
3300031796	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24	Environmental	Open in IMG/M
3300031798	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19	Environmental	Open in IMG/M
3300031834	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0	Environmental	Open in IMG/M
3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Host-Associated	Open in IMG/M
3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Host-Associated	Open in IMG/M
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental	Open in IMG/M
3300031913	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4	Environmental	Open in IMG/M
3300031939	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2	Environmental	Open in IMG/M
3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Host-Associated	Open in IMG/M
3300032012	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3	Environmental	Open in IMG/M
3300032059	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27	Environmental	Open in IMG/M
3300032074	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1	Environmental	Open in IMG/M
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental	Open in IMG/M
3300032118	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15	Environmental	Open in IMG/M
3300032143	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0	Environmental	Open in IMG/M
3300032144	Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil	Environmental	Open in IMG/M
3300032164	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032256	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top	Environmental	Open in IMG/M
3300032397	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0	Environmental	Open in IMG/M
3300032893	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1	Environmental	Open in IMG/M
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental	Open in IMG/M
3300033408	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT	Environmental	Open in IMG/M
3300033413	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT	Environmental	Open in IMG/M
3300033414	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B	Environmental	Open in IMG/M
3300033419	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033482	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C	Environmental	Open in IMG/M
3300033488	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C	Environmental	Open in IMG/M
3300033521	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B	Environmental	Open in IMG/M
3300033557	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B	Environmental	Open in IMG/M
3300034090	Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N	Environmental	Open in IMG/M
3300034127	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_16	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.37
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.37
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F013223

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign