NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F013116

Metagenome / Metatranscriptome Family F013116

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F013116
Family Type Metagenome / Metatranscriptome
Number of Sequences 274
Average Sequence Length 43 residues
Representative Sequence VDYIHVLRYRDGLHVSFNLMFDRLLMLEQLGLIPAPAPAG
Number of Associated Samples 216
Number of Associated Scaffolds 274

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.82 %
% of genes near scaffold ends (potentially truncated) 90.88 %
% of genes from short scaffolds (< 2000 bps) 94.16 %
Associated GOLD sequencing projects 205
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.577 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(29.927 % of family members)
Environment Ontology (ENVO) Unclassified
(36.496 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.336 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 10.29%    β-sheet: 20.59%    Coil/Unstructured: 69.12%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 274 Family Scaffolds
PF00196GerE 4.74
PF13472Lipase_GDSL_2 3.28
PF13561adh_short_C2 2.55
PF05988DUF899 2.55
PF02909TetR_C_1 2.55
PF00583Acetyltransf_1 2.55
PF01266DAO 2.19
PF07883Cupin_2 2.19
PF13419HAD_2 2.19
PF01411tRNA-synt_2c 1.82
PF13649Methyltransf_25 1.46
PF07311Dodecin 1.46
PF04828GFA 1.46
PF08241Methyltransf_11 1.46
PF12680SnoaL_2 1.09
PF01494FAD_binding_3 1.09
PF00005ABC_tran 1.09
PF02896PEP-utilizers_C 1.09
PF16864Dimerisation2 1.09
PF12806Acyl-CoA_dh_C 1.09
PF01230HIT 1.09
PF030614HBT 0.73
PF07366SnoaL 0.73
PF04545Sigma70_r4 0.73
PF00891Methyltransf_2 0.73
PF12727PBP_like 0.73
PF00440TetR_N 0.73
PF12697Abhydrolase_6 0.73
PF01641SelR 0.73
PF01841Transglut_core 0.73
PF01242PTPS 0.73
PF00561Abhydrolase_1 0.73
PF13193AMP-binding_C 0.73
PF01053Cys_Met_Meta_PP 0.73
PF13185GAF_2 0.36
PF04030ALO 0.36
PF04185Phosphoesterase 0.36
PF08240ADH_N 0.36
PF05544Pro_racemase 0.36
PF00753Lactamase_B 0.36
PF10017Methyltransf_33 0.36
PF13450NAD_binding_8 0.36
PF01757Acyl_transf_3 0.36
PF08031BBE 0.36
PF00872Transposase_mut 0.36
PF132794HBT_2 0.36
PF00365PFK 0.36
PF05853BKACE 0.36
PF12831FAD_oxidored 0.36
PF12802MarR_2 0.36
PF06445GyrI-like 0.36
PF04191PEMT 0.36
PF04264YceI 0.36
PF00248Aldo_ket_red 0.36
PF01695IstB_IS21 0.36
PF13751DDE_Tnp_1_6 0.36
PF00202Aminotran_3 0.36
PF07730HisKA_3 0.36
PF01432Peptidase_M3 0.36
PF03109ABC1 0.36
PF04542Sigma70_r2 0.36
PF13602ADH_zinc_N_2 0.36
PF00067p450 0.36
PF00436SSB 0.36
PF03965Penicillinase_R 0.36
PF07521RMMBL 0.36
PF03070TENA_THI-4 0.36
PF00999Na_H_Exchanger 0.36
PF01625PMSR 0.36
PF02574S-methyl_trans 0.36
PF01527HTH_Tnp_1 0.36
PF06441EHN 0.36
PF13847Methyltransf_31 0.36
PF13191AAA_16 0.36
PF02541Ppx-GppA 0.36
PF13671AAA_33 0.36
PF07995GSDH 0.36
PF00313CSD 0.36
PF03848TehB 0.36
PF14534DUF4440 0.36
PF02897Peptidase_S9_N 0.36
PF13683rve_3 0.36
PF03547Mem_trans 0.36
PF00551Formyl_trans_N 0.36
PF14026DUF4242 0.36
PF02515CoA_transf_3 0.36

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 274 Family Scaffolds
COG1309DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmATranscription [K] 2.55
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 2.55
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 2.19
COG0013Alanyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 1.82
COG3360Flavin-binding protein dodecinGeneral function prediction only [R] 1.46
COG3791Uncharacterized conserved proteinFunction unknown [S] 1.46
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 1.09
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 1.09
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 1.09
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.73
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 0.73
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.73
COG07206-pyruvoyl-tetrahydropterin synthaseCoenzyme transport and metabolism [H] 0.73
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.73
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 0.73
COG0229Peptide methionine sulfoxide reductase MsrBPosttranslational modification, protein turnover, chaperones [O] 0.73
COG0248Exopolyphosphatase/pppGpp-phosphohydrolaseSignal transduction mechanisms [T] 0.73
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.73
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.73
COG4100Cystathionine beta-lyase family protein involved in aluminum resistanceInorganic ion transport and metabolism [P] 0.73
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.73
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.73
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.73
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 0.73
COG2965Primosomal replication protein NReplication, recombination and repair [L] 0.36
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 0.36
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.36
COG3246Uncharacterized conserved protein, DUF849 familyFunction unknown [S] 0.36
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 0.36
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 0.36
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.36
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.36
COG3682Transcriptional regulator, CopY/TcrY familyTranscription [K] 0.36
COG1505Prolyl endopeptidase PreP, S9A serine peptidase familyAmino acid transport and metabolism [E] 0.36
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.36
COG3938Proline racemase/hydroxyproline epimeraseAmino acid transport and metabolism [E] 0.36
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.36
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.36
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 0.36
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.36
COG0679Predicted permease, AEC (auxin efflux carrier) familyGeneral function prediction only [R] 0.36
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 0.36
COG02056-phosphofructokinaseCarbohydrate transport and metabolism [G] 0.36
COG0225Peptide methionine sulfoxide reductase MsrAPosttranslational modification, protein turnover, chaperones [O] 0.36
COG0339Zn-dependent oligopeptidase, M3 familyPosttranslational modification, protein turnover, chaperones [O] 0.36
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 0.36
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.36
COG05962-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase foldCoenzyme transport and metabolism [H] 0.36
COG0629Single-stranded DNA-binding proteinReplication, recombination and repair [L] 0.36
COG0646Methionine synthase I (cobalamin-dependent), methyltransferase domainAmino acid transport and metabolism [E] 0.36
COG0661Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB familySignal transduction mechanisms [T] 0.36
COG2133Glucose/arabinose dehydrogenase, beta-propeller foldCarbohydrate transport and metabolism [G] 0.36
COG1164Oligoendopeptidase FAmino acid transport and metabolism [E] 0.36
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.36
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 0.36
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.36
COG1770Protease IIAmino acid transport and metabolism [E] 0.36
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.36
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.36
COG2040Homocysteine/selenocysteine methylase (S-methylmethionine-dependent)Amino acid transport and metabolism [E] 0.36
COG2124Cytochrome P450Defense mechanisms [V] 0.36


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.58 %
UnclassifiedrootN/A16.42 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573001|GZR05M101E12KEAll Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197502Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_104958870All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300003505|JGIcombinedJ51221_10480930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia501Open in IMG/M
3300004152|Ga0062386_101825341All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300004157|Ga0062590_101298250All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300005161|Ga0066807_1013519All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300005172|Ga0066683_10208318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1208Open in IMG/M
3300005329|Ga0070683_101259300All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300005331|Ga0070670_100619568All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300005338|Ga0068868_100918359All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300005347|Ga0070668_101144326All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300005354|Ga0070675_100819704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria851Open in IMG/M
3300005434|Ga0070709_11129274All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300005439|Ga0070711_100110223All Organisms → cellular organisms → Bacteria2019Open in IMG/M
3300005440|Ga0070705_101739955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Caldilineae → Caldilineales → Caldilineaceae → Caldilinea → Caldilinea aerophila528Open in IMG/M
3300005467|Ga0070706_100247368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales1665Open in IMG/M
3300005561|Ga0066699_10027668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3230Open in IMG/M
3300005610|Ga0070763_10193049All Organisms → cellular organisms → Bacteria1083Open in IMG/M
3300005616|Ga0068852_100927537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia888Open in IMG/M
3300005764|Ga0066903_101666944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1212Open in IMG/M
3300005764|Ga0066903_104727111Not Available725Open in IMG/M
3300005841|Ga0068863_102661933All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300005844|Ga0068862_101944838Not Available598Open in IMG/M
3300006028|Ga0070717_10098696All Organisms → cellular organisms → Bacteria2476Open in IMG/M
3300006028|Ga0070717_10871685All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium819Open in IMG/M
3300006052|Ga0075029_101072389All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300006102|Ga0075015_100384701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales789Open in IMG/M
3300006173|Ga0070716_100572400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae845Open in IMG/M
3300006574|Ga0074056_10798067All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300006575|Ga0074053_11807983All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300006605|Ga0074057_11683211All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium597Open in IMG/M
3300006904|Ga0075424_101090758All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300006953|Ga0074063_13074922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces mirabilis642Open in IMG/M
3300006954|Ga0079219_11396135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia625Open in IMG/M
3300006954|Ga0079219_12462645All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300009098|Ga0105245_11185279All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300009143|Ga0099792_10382704Not Available857Open in IMG/M
3300009147|Ga0114129_13326871All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300009162|Ga0075423_11466213All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300009174|Ga0105241_10870818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia834Open in IMG/M
3300009520|Ga0116214_1072364All Organisms → cellular organisms → Bacteria1258Open in IMG/M
3300009521|Ga0116222_1274792All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300009521|Ga0116222_1512530Not Available525Open in IMG/M
3300009524|Ga0116225_1317186Not Available695Open in IMG/M
3300009551|Ga0105238_10315369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1549Open in IMG/M
3300009683|Ga0116224_10543675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia554Open in IMG/M
3300009698|Ga0116216_10304978All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300009792|Ga0126374_10061035All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1971969Open in IMG/M
3300009792|Ga0126374_10439001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium924Open in IMG/M
3300010046|Ga0126384_11090894All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300010046|Ga0126384_12347795Not Available515Open in IMG/M
3300010049|Ga0123356_10463605All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1417Open in IMG/M
3300010337|Ga0134062_10316394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → Tetrasphaera japonica → Tetrasphaera japonica T1-X7743Open in IMG/M
3300010339|Ga0074046_10262699All Organisms → cellular organisms → Bacteria1069Open in IMG/M
3300010358|Ga0126370_10446541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1971077Open in IMG/M
3300010359|Ga0126376_12824419Not Available535Open in IMG/M
3300010361|Ga0126378_11685034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia720Open in IMG/M
3300010366|Ga0126379_10197375Not Available1932Open in IMG/M
3300010366|Ga0126379_12371740All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300010371|Ga0134125_10305136Not Available1767Open in IMG/M
3300010371|Ga0134125_11271205All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197803Open in IMG/M
3300010373|Ga0134128_12566318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi562Open in IMG/M
3300010373|Ga0134128_13140780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium507Open in IMG/M
3300010375|Ga0105239_11423358All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium800Open in IMG/M
3300010376|Ga0126381_101972252All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300010379|Ga0136449_101219213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1183Open in IMG/M
3300010379|Ga0136449_104309898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia526Open in IMG/M
3300010396|Ga0134126_12625852Not Available547Open in IMG/M
3300010397|Ga0134124_11692779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium665Open in IMG/M
3300010399|Ga0134127_12808530Not Available566Open in IMG/M
3300010400|Ga0134122_12658323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales552Open in IMG/M
3300010401|Ga0134121_12264564All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium581Open in IMG/M
3300010403|Ga0134123_10234366Not Available1586Open in IMG/M
3300010403|Ga0134123_11295243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → Tetrasphaera japonica → Tetrasphaera japonica T1-X7764Open in IMG/M
3300012201|Ga0137365_10672951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia757Open in IMG/M
3300012212|Ga0150985_112793750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia926Open in IMG/M
3300012897|Ga0157285_10150465Not Available692Open in IMG/M
3300012905|Ga0157296_10304975All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300012907|Ga0157283_10425240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia501Open in IMG/M
3300012916|Ga0157310_10513021Not Available524Open in IMG/M
3300012955|Ga0164298_10595917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia758Open in IMG/M
3300012957|Ga0164303_10784049Not Available653Open in IMG/M
3300012960|Ga0164301_11811865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. FDAARGOS 1241513Open in IMG/M
3300013102|Ga0157371_10562680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium846Open in IMG/M
3300013105|Ga0157369_12253897Not Available552Open in IMG/M
3300013297|Ga0157378_10720559All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1018Open in IMG/M
3300013307|Ga0157372_11645222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium739Open in IMG/M
3300014745|Ga0157377_10003569All Organisms → cellular organisms → Bacteria7041Open in IMG/M
3300014969|Ga0157376_10148370All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2112Open in IMG/M
3300015371|Ga0132258_10725381All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2503Open in IMG/M
3300015372|Ga0132256_102709217All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300016319|Ga0182033_11055210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria724Open in IMG/M
3300016319|Ga0182033_12158565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria508Open in IMG/M
3300016357|Ga0182032_10970265All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300016371|Ga0182034_11253767All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197646Open in IMG/M
3300016371|Ga0182034_11833211All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300016404|Ga0182037_11594149All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300016422|Ga0182039_10682222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales904Open in IMG/M
3300016422|Ga0182039_11909246All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales545Open in IMG/M
3300016445|Ga0182038_11770149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia557Open in IMG/M
3300016445|Ga0182038_12025833All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Rubellimicrobium → Rubellimicrobium mesophilum → Rubellimicrobium mesophilum DSM 19309521Open in IMG/M
3300017821|Ga0187812_1019233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales2360Open in IMG/M
3300017823|Ga0187818_10568698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia512Open in IMG/M
3300017928|Ga0187806_1203521All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300017933|Ga0187801_10344790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia612Open in IMG/M
3300017943|Ga0187819_10407134All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300017961|Ga0187778_10554666Not Available767Open in IMG/M
3300017966|Ga0187776_10652330All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300017970|Ga0187783_11353294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae513Open in IMG/M
3300017974|Ga0187777_10760873Not Available690Open in IMG/M
3300017994|Ga0187822_10266600Not Available594Open in IMG/M
3300017999|Ga0187767_10149183Not Available699Open in IMG/M
3300018058|Ga0187766_10229258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1181Open in IMG/M
3300018058|Ga0187766_10473363Not Available840Open in IMG/M
3300018058|Ga0187766_11356060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium520Open in IMG/M
3300018060|Ga0187765_10119452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1458Open in IMG/M
3300018085|Ga0187772_10236539All Organisms → cellular organisms → Bacteria1237Open in IMG/M
3300018431|Ga0066655_11150608All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300019361|Ga0173482_10140396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium929Open in IMG/M
3300020082|Ga0206353_10504778All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300020150|Ga0187768_1076854Not Available753Open in IMG/M
3300021358|Ga0213873_10199467Not Available620Open in IMG/M
3300021374|Ga0213881_10083926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1369Open in IMG/M
3300021377|Ga0213874_10136863Not Available845Open in IMG/M
3300021384|Ga0213876_10056262All Organisms → cellular organisms → Bacteria2076Open in IMG/M
3300021384|Ga0213876_10367586Not Available765Open in IMG/M
3300021384|Ga0213876_10591433Not Available590Open in IMG/M
3300021388|Ga0213875_10183669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria983Open in IMG/M
3300021388|Ga0213875_10595401Not Available534Open in IMG/M
3300021402|Ga0210385_10537560All Organisms → cellular organisms → Bacteria888Open in IMG/M
3300021403|Ga0210397_10995025All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300021407|Ga0210383_10523517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1023Open in IMG/M
3300021420|Ga0210394_11365193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → Tetrasphaera japonica → Tetrasphaera japonica T1-X7604Open in IMG/M
3300021420|Ga0210394_11512396All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300021432|Ga0210384_10114926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1972413Open in IMG/M
3300021478|Ga0210402_11950799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces513Open in IMG/M
3300021560|Ga0126371_11548997All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300022886|Ga0247746_1084628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria762Open in IMG/M
3300023077|Ga0247802_1070806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium576Open in IMG/M
3300025907|Ga0207645_10377816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium951Open in IMG/M
3300025916|Ga0207663_10208661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → Tetrasphaera japonica → Tetrasphaera japonica T1-X71414Open in IMG/M
3300025917|Ga0207660_11380431All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300025927|Ga0207687_11224852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium645Open in IMG/M
3300025928|Ga0207700_11839919All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria532Open in IMG/M
3300025932|Ga0207690_10943157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria717Open in IMG/M
3300025935|Ga0207709_10555997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium903Open in IMG/M
3300025935|Ga0207709_11217567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium621Open in IMG/M
3300025936|Ga0207670_10351762All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1167Open in IMG/M
3300026067|Ga0207678_12006896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales503Open in IMG/M
3300026075|Ga0207708_11720628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium551Open in IMG/M
3300026121|Ga0207683_11085735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium742Open in IMG/M
3300026335|Ga0209804_1337330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium507Open in IMG/M
3300026542|Ga0209805_1027365All Organisms → cellular organisms → Bacteria2941Open in IMG/M
3300027070|Ga0208365_1060700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia510Open in IMG/M
3300027297|Ga0208241_1020649All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium983Open in IMG/M
3300027497|Ga0208199_1068466Not Available746Open in IMG/M
3300027604|Ga0208324_1006713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3921Open in IMG/M
3300027884|Ga0209275_10019069All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3047Open in IMG/M
3300027915|Ga0209069_10215276All Organisms → cellular organisms → Bacteria986Open in IMG/M
3300028587|Ga0247828_10881299All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Paraglaciecola575Open in IMG/M
3300028589|Ga0247818_10357253Not Available979Open in IMG/M
3300028592|Ga0247822_11092486Not Available662Open in IMG/M
3300028708|Ga0307295_10212330All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300028906|Ga0308309_10530621All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. HBU652071019Open in IMG/M
3300030336|Ga0247826_10204635Not Available1353Open in IMG/M
3300030336|Ga0247826_10601525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia843Open in IMG/M
3300030902|Ga0308202_1100749All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300031092|Ga0308204_10175201All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300031226|Ga0307497_10639308All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300031543|Ga0318516_10613792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria620Open in IMG/M
3300031543|Ga0318516_10637941Not Available607Open in IMG/M
3300031544|Ga0318534_10317941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria897Open in IMG/M
3300031544|Ga0318534_10505528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria690Open in IMG/M
3300031544|Ga0318534_10776518Not Available539Open in IMG/M
3300031545|Ga0318541_10481617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium694Open in IMG/M
3300031546|Ga0318538_10347566All Organisms → cellular organisms → Bacteria → Terrabacteria group801Open in IMG/M
3300031546|Ga0318538_10395061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria748Open in IMG/M
3300031549|Ga0318571_10093951All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300031549|Ga0318571_10268795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium632Open in IMG/M
3300031549|Ga0318571_10363312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia558Open in IMG/M
3300031564|Ga0318573_10302280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria856Open in IMG/M
3300031572|Ga0318515_10166141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1179Open in IMG/M
3300031572|Ga0318515_10263503All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300031572|Ga0318515_10626420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium571Open in IMG/M
3300031573|Ga0310915_10292678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1150Open in IMG/M
3300031668|Ga0318542_10246061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia909Open in IMG/M
3300031679|Ga0318561_10573584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia621Open in IMG/M
3300031681|Ga0318572_10302818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria945Open in IMG/M
3300031681|Ga0318572_10406070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium810Open in IMG/M
3300031682|Ga0318560_10493532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium663Open in IMG/M
3300031713|Ga0318496_10070303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. FDAARGOS 12411843Open in IMG/M
3300031716|Ga0310813_10368552All Organisms → cellular organisms → Bacteria → Acidobacteria1228Open in IMG/M
3300031719|Ga0306917_10528515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria927Open in IMG/M
3300031720|Ga0307469_11992398All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300031723|Ga0318493_10374695All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300031724|Ga0318500_10478908Not Available624Open in IMG/M
3300031747|Ga0318502_10250239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1034Open in IMG/M
3300031751|Ga0318494_10064248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. FDAARGOS 12411964Open in IMG/M
3300031751|Ga0318494_10889352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales522Open in IMG/M
3300031769|Ga0318526_10173400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia879Open in IMG/M
3300031769|Ga0318526_10205346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales805Open in IMG/M
3300031770|Ga0318521_10441159All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Rubellimicrobium → Rubellimicrobium mesophilum → Rubellimicrobium mesophilum DSM 19309779Open in IMG/M
3300031770|Ga0318521_10741194All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300031770|Ga0318521_11042695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia502Open in IMG/M
3300031771|Ga0318546_10170544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1475Open in IMG/M
3300031771|Ga0318546_10751315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium686Open in IMG/M
3300031778|Ga0318498_10524599All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300031779|Ga0318566_10161628Not Available1111Open in IMG/M
3300031792|Ga0318529_10146518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1084Open in IMG/M
3300031797|Ga0318550_10638216All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Rubellimicrobium → Rubellimicrobium mesophilum → Rubellimicrobium mesophilum DSM 19309511Open in IMG/M
3300031798|Ga0318523_10678523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia506Open in IMG/M
3300031798|Ga0318523_10680313All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300031799|Ga0318565_10377154Not Available688Open in IMG/M
3300031805|Ga0318497_10133260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1351Open in IMG/M
3300031805|Ga0318497_10585639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia626Open in IMG/M
3300031819|Ga0318568_10125647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1554Open in IMG/M
3300031820|Ga0307473_10295336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1017Open in IMG/M
3300031821|Ga0318567_10040841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2359Open in IMG/M
3300031821|Ga0318567_10582533All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300031831|Ga0318564_10464426All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300031832|Ga0318499_10232494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus717Open in IMG/M
3300031832|Ga0318499_10338525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium579Open in IMG/M
3300031832|Ga0318499_10391329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium532Open in IMG/M
3300031833|Ga0310917_10603947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia745Open in IMG/M
3300031846|Ga0318512_10081186All Organisms → cellular organisms → Bacteria1498Open in IMG/M
3300031846|Ga0318512_10182883Not Available1021Open in IMG/M
3300031860|Ga0318495_10352607All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300031879|Ga0306919_10729429All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria763Open in IMG/M
3300031879|Ga0306919_11393784All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300031890|Ga0306925_11444571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia676Open in IMG/M
3300031890|Ga0306925_11548716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium647Open in IMG/M
3300031893|Ga0318536_10301788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae812Open in IMG/M
3300031894|Ga0318522_10031021All Organisms → cellular organisms → Bacteria → Terrabacteria group1808Open in IMG/M
3300031896|Ga0318551_10406618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia774Open in IMG/M
3300031896|Ga0318551_10609885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Rubellimicrobium → Rubellimicrobium mesophilum → Rubellimicrobium mesophilum DSM 19309630Open in IMG/M
3300031910|Ga0306923_10777658All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1059Open in IMG/M
3300031910|Ga0306923_11034127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia890Open in IMG/M
3300031910|Ga0306923_12284438All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300031912|Ga0306921_10159908Not Available2637Open in IMG/M
3300031941|Ga0310912_10752086All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197754Open in IMG/M
3300031942|Ga0310916_10529347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1003Open in IMG/M
3300031962|Ga0307479_10990042All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300031962|Ga0307479_11442363All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae646Open in IMG/M
3300032001|Ga0306922_11393990Not Available705Open in IMG/M
3300032008|Ga0318562_10531320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → Tetrasphaera japonica → Tetrasphaera japonica T1-X7681Open in IMG/M
3300032009|Ga0318563_10436787Not Available708Open in IMG/M
3300032009|Ga0318563_10535314All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300032035|Ga0310911_10244459All Organisms → cellular organisms → Bacteria → Terrabacteria group1027Open in IMG/M
3300032041|Ga0318549_10299242Not Available725Open in IMG/M
3300032044|Ga0318558_10307442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium784Open in IMG/M
3300032044|Ga0318558_10413112Not Available672Open in IMG/M
3300032065|Ga0318513_10097795All Organisms → cellular organisms → Bacteria → Terrabacteria group1370Open in IMG/M
3300032065|Ga0318513_10136086All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Candidatus Magnetomorum → unclassified Candidatus Magnetomorum → Candidatus Magnetomorum sp. HK-11167Open in IMG/M
3300032066|Ga0318514_10245797Not Available942Open in IMG/M
3300032068|Ga0318553_10011051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales3964Open in IMG/M
3300032068|Ga0318553_10649399All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300032076|Ga0306924_11513164All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300032076|Ga0306924_12515809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia516Open in IMG/M
3300032090|Ga0318518_10548645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Dactylosporangium → Dactylosporangium roseum591Open in IMG/M
3300032090|Ga0318518_10671074All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300032160|Ga0311301_11648421All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300032261|Ga0306920_103079233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium627Open in IMG/M
3300032261|Ga0306920_103437277All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300032261|Ga0306920_104408814All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300032770|Ga0335085_10331349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1791Open in IMG/M
3300032783|Ga0335079_11181969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Dactylosporangium → Dactylosporangium roseum770Open in IMG/M
3300032892|Ga0335081_12520062All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300032898|Ga0335072_10097957All Organisms → cellular organisms → Bacteria3759Open in IMG/M
3300032898|Ga0335072_10388543Not Available1504Open in IMG/M
3300033158|Ga0335077_10998041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia835Open in IMG/M
3300033290|Ga0318519_10679387All Organisms → cellular organisms → Bacteria → Terrabacteria group629Open in IMG/M
3300033550|Ga0247829_10940161All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300033803|Ga0314862_0018851Not Available1328Open in IMG/M
3300033808|Ga0314867_072564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium801Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil29.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.12%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.74%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.01%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.01%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.01%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.01%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.65%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.19%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.19%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots2.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.82%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.46%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.46%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.09%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.09%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.09%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.09%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.09%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.09%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.09%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.73%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.73%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.73%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.73%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.73%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.73%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.73%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.73%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.73%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.36%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.36%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.36%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.36%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.36%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.36%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.36%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.36%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.36%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.36%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.36%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.36%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.36%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.36%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.36%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.36%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573001Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300005161Soil and rhizosphere microbial communities from Laval, Canada - mgLPAEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010049Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3Host-AssociatedOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020150Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MGEnvironmentalOpen in IMG/M
3300021358Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3Host-AssociatedOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022886Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5EnvironmentalOpen in IMG/M
3300023077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300027070Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes)EnvironmentalOpen in IMG/M
3300027297Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes)EnvironmentalOpen in IMG/M
3300027497Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030902Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031092Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033803Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10EnvironmentalOpen in IMG/M
3300033808Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FD2_073797702189573001Grass SoilVNYIQVLRFRDGKHVSFNLMFDRLTMLEQLGLVPTSAVAA
INPhiseqgaiiFebDRAFT_10495887013300000364SoilDVPPTGRCVKVDYIQVLRFRDGKHLSFNLMFDRLTMLEQLGLVPAPAEAA*
JGIcombinedJ51221_1048093023300003505Forest SoilVTVDYIHVLRYRDGKHVSFNLIFDRLQMLEQLGIIPAPAPTG*
Ga0062386_10182534113300004152Bog Forest SoilGEIPPTGRSIRVPYTHVLRYRDGLHISFSLLFDRLEMLEQLGVVPVPANAR*
Ga0062590_10129825013300004157SoilDYLQVLGFRDGKHVSFNLMFDRLSMLEQLGLVPTPDSDEARGSRP*
Ga0066807_101351923300005161SoilVNLDYIQMLRFREGKHVSFNLMFDRLQMVEQLGLIPAPAA*
Ga0066683_1020831833300005172SoilPVAVPYVQVLRFRDGQHASFNLMYDRLLMLGQLGLIPAPA*
Ga0070683_10125930013300005329Corn RhizosphereTGRSVAVEYVQVLRFRDGQHASFSLVFDRLQMLEQLGLVAAPTAA*
Ga0070670_10061956813300005331Switchgrass RhizosphereVDYIQVLRFRDGKHVSFHLMFDRLAMLEQLGLVPMSAAA*
Ga0068868_10091835913300005338Miscanthus RhizosphereVRVDYIQVLRFREGKHCSFNLMFDRLLMLEQLGLIPAPAA*
Ga0070668_10114432633300005347Switchgrass RhizosphereTGRSVRLDYIQVLHFRNGKHVSFNLMFDRLLMLEQLGLIPAPTA*
Ga0070675_10081970413300005354Miscanthus RhizosphereRSVRLDYIQVLHFRDGRHVSFNLMFDRLLMLEQLGLVPAPAPAP*
Ga0070709_1112927433300005434Corn, Switchgrass And Miscanthus RhizosphereVEVDYIQVLRFRDGKHVSFNLMFDRLTMLEQLGLVPTSAAAA*
Ga0070711_10011022313300005439Corn, Switchgrass And Miscanthus RhizospherePPTGQPVAVPYVQVLRFRDGQHTSFNLMFDRLLMLEQLGLIPAAA*
Ga0070705_10173995513300005440Corn, Switchgrass And Miscanthus RhizosphereGRSVKVDYIQVLRFRNGKHVSFNLMFDRLLMLEQLGLVPAPAA*
Ga0070706_10024736813300005467Corn, Switchgrass And Miscanthus RhizosphereDYIHVLRYRDGMHVSFNLLFDRLLMLEQLGLIPAPAPAG*
Ga0066699_1002766853300005561SoilYIQVITFRNGRCIAANLMFDRLQLLEQLGLVPAPATSG*
Ga0070763_1019304923300005610SoilIAPTGRPVTVDYIHVLRYRDGLHVSFNLMFDRLLMLEQLGLIPAPVSTG*
Ga0068852_10092753723300005616Corn RhizospherePATGRRTAVDYIHVLRYRDGLHVSFNLVFDRLQMLEQLGLIPGPAPAR*
Ga0066903_10166694433300005764Tropical Forest SoilGDIPPTGRPVTVGYIQVLRFRDGKHVSFNLMFDRLLMLEQLGIPALAAAG*
Ga0066903_10472711113300005764Tropical Forest SoilRVGYVQVLRFRDGKHTSFNLMFDRLLMLEQLDLMPAATHAG*
Ga0068863_10266193313300005841Switchgrass RhizosphereHNGPLPTPAGDIPPTGCPVTVGYIQVLHFRDGQHVSFSLMYDRLLMLEQLGLFPAPATTG
Ga0068862_10194483813300005844Switchgrass RhizospherePTGRAVRLDYLQVLRFRDGTHVAFNLSFDRLAMLEQLGP*
Ga0070717_1009869613300006028Corn, Switchgrass And Miscanthus RhizosphereIPPTGRSVSLDYIQVLRFCDGKHASFNLMFDRLLMLEQLDLMPAATSAG*
Ga0070717_1087168533300006028Corn, Switchgrass And Miscanthus RhizosphereIQVLHFRDGQHVSFSLMYDRLLMLEQLGLFPAPATTG*
Ga0075029_10107238923300006052WatershedsVDYIHVLRYRDGKHISFNLIFDRLLMLQQLGIIPAPAPTG*
Ga0075015_10038470123300006102WatershedsVNIDYIQVHRLRDGNQVSFHLVFDRFEMLEQLGLIPAPAGGGLLD*
Ga0070716_10057240033300006173Corn, Switchgrass And Miscanthus RhizosphereVLHFRDGQHVSFSLMYDRLLMLEQLGLFPAPATTG*
Ga0074056_1079806713300006574SoilPMGDFQPTGGSVKLPYIQVLRFREGKHVSFNLMFDRLQMVEQLGLIPAPAA*
Ga0074053_1180798323300006575SoilMGDFQPTGGSVKLPYIQVLRFREGKHVSFNLMFDRLQMVEQLGLIPAPAA*
Ga0074057_1168321113300006605SoilQVLRFRDGKHASFNLMFDRLQMLEQLGLVTPPAPAR*
Ga0075424_10109075823300006904Populus RhizosphereKVKVDYIQVLRYRDGLCVSANLMFDRMELLEQLGLVPAPAAAG*
Ga0074063_1307492213300006953SoilGDIPPTGRAVSLDYIQVLRFRDGKHVSFKLMFDQLLMLEQLGLIPAAVPAG*
Ga0079219_1139613523300006954Agricultural SoilATGRRTAVDYIHVLRYRDGLHVSFSLLFDRLQMLEQLGLIPAPAPAR*
Ga0079219_1246264513300006954Agricultural SoilSVTLDYIQVIRFRDGKHSSFHLAFDRLLMLEQLGLMPAHALAA*
Ga0105245_1118527923300009098Miscanthus RhizosphereVKAQYVNVLRFGDGRFVSGDLMFDRLALLEQLGLVPQPAVG*
Ga0099792_1038270423300009143Vadose Zone SoilPVAVPYVQVLRFRDGRHVSFNLVYDRLLMLEQLGLIPAAV*
Ga0114129_1332687113300009147Populus RhizosphereGRSVCLDYVRLVRVHDGKQVSLDLMFDRLLMLEQLGLVQP*
Ga0075423_1146621313300009162Populus RhizosphereRPVEVDYIQVLQFRDGKHRSFHLMFDRLLMLEQLGLVPAPDGSGRSG*
Ga0105241_1087081813300009174Corn RhizosphereVTVDYIQVLRFRDGKHASFSLMFDRLLMLEQLGLIPAPAAAG*
Ga0116214_107236423300009520Peatlands SoilVLRYRDGLHVSFNLVFDRLLMLEQLGLVPAPAALQ*
Ga0116222_127479213300009521Peatlands SoilVLRFRDGKHISFNLIFDRLAMLEQLGLIPAPAPAG*
Ga0116222_151253013300009521Peatlands SoilVLRYRDGLHLSFNLVFDQLLMLEQLDLVPAPAAVQ*
Ga0116225_131718613300009524Peatlands SoilVPPTRPFVKVDYIQVLRFRDGKHLSFNLMFDRLMMLEQLGLVPAPAEAA*
Ga0105238_1031536923300009551Corn RhizosphereQVLHFRDGRHVSFNLMFDRLLMLEQLGLVPAAAPAG*
Ga0116224_1054367523300009683Peatlands SoilDYIQVLRFRDGKYVSFNLMYDRLLLLEQLGLVRAQQPAG*
Ga0116216_1030497823300009698Peatlands SoilGRAVSLPYIHVLRFRGGLHASFNLIFDRLLMLEQLGVIPAPAVAQ*
Ga0126374_1006103533300009792Tropical Forest SoilMGDIAPTGRSIQVDYIQVLRFRGGKHVSFHLMFDQLMMLEQLGLVPTPAAAA*
Ga0126374_1043900113300009792Tropical Forest SoilVDYIHVLRYRDGKHVLFNLLFDRLLMLEQLGLVPAPAPAG*
Ga0126384_1109089413300010046Tropical Forest SoilRIVYLQVLRFRDGKHISFSLMFDRLQLLEQLGLGPAPALAGS*
Ga0126384_1234779523300010046Tropical Forest SoilLRFRDGRHVSFNLMFDRLMMLEQLGLVLTTAAAA*
Ga0123356_1046360523300010049Termite GutMTYVQVLRFRDGKHVSFNLMFDRLAMLEQLGLAPTPAVAGEATS*
Ga0134062_1031639413300010337Grasslands SoilVQVLRFRDGKHASFNLMFDRLLMLEQLGLIPAPA*
Ga0074046_1026269933300010339Bog Forest SoilHVLRYRDGKHVSLDLMFDRLMMLEQLGLVPTPALAG*
Ga0126370_1044654133300010358Tropical Forest SoilMGDIAPTGRSIQVDYIQVLRFRGGKHVSFHLMFDQLMMLEQLGLVPKPAAAA*
Ga0126376_1282441933300010359Tropical Forest SoilITPTGRHIAVNYTHVLRYRDGKHTSFNLIFDRLQMLEQLGLVSEPARAT*
Ga0126378_1168503423300010361Tropical Forest SoilGRPVTIYYLQVLRFRDGKHVSFNLMFDRLLMLEQLGLIPAPAPAG*
Ga0126379_1019737513300010366Tropical Forest SoilTGRSVEVDYIQVLRFRDGKHVSFNLLFDRLMMLEQLGLAPTPAAAA*
Ga0126379_1237174023300010366Tropical Forest SoilYIQVLRFRDGKHISFNLMFDRLLMLEQLGILPAAAPAG*
Ga0134125_1030513623300010371Terrestrial SoilHVLRYRDGLHVSFNLLFDRLQMLEQLGLIPAPAPAR*
Ga0134125_1127120523300010371Terrestrial SoilVNYIQVLRFRDGKHVSFNLMFDRLTMLEQLGLVPTSAAAA*
Ga0134128_1256631823300010373Terrestrial SoilVELDYIQVLHFREGKHQSFNLMFDRLLMLEQLGLLPVSG*
Ga0134128_1314078023300010373Terrestrial SoilDYVQVLRFRDGRHVSFNLMFDRLLMLEQLGLVPAPAPAP*
Ga0105239_1142335813300010375Corn RhizospherePPTGRSVEVDYIQVLRFRDGKHVSFHLMFDRLAMLEQLGLVPMSAAA*
Ga0126381_10197225213300010376Tropical Forest SoilYIQVLRFRGGKHVSFHLMFDQLMMLEQLGLVPAPAAAA*
Ga0136449_10121921333300010379Peatlands SoilLRYRDGKHISFNLIFDRLLMLEQLGIIPAPAPTG*
Ga0136449_10430989813300010379Peatlands SoilTVDYVQVLRFRDGKYVSFNLMYDRLLLLEQLGLIRAQQPAG*
Ga0134126_1262585223300010396Terrestrial SoilPPTGRAVRVDYIQVLRFRDGTHVSFNLSFDRLAMLEQLGS*
Ga0134124_1169277913300010397Terrestrial SoilVQVLRFRDGRHVSFNLMFDRLLMLEQLGLVPAPAPAP*
Ga0134127_1280853013300010399Terrestrial SoilPTGRAVAVDYVQVLRFRDGRHVAFNLSFDRLLMLEQLGLGG*
Ga0134122_1265832313300010400Terrestrial SoilIPPTGRAVDLDYIQVLRFRDGRHVSSNLMFDRMLMLEQLGLVPAPNT*
Ga0134121_1226456423300010401Terrestrial SoilPVTVGYIQVLHFRDGQHVSFSLMYDRLLMLEQLGLFPAPATTG*
Ga0134123_1023436623300010403Terrestrial SoilRLDYIQVLHFRNGKHVSFNLMFDRLLMLEQLGLIPAPTA*
Ga0134123_1129524323300010403Terrestrial SoilPTGQPVAVPYVQVLRFRDGQHTSFNLMFDRLLMLEQLGLIPAPA*
Ga0137365_1067295113300012201Vadose Zone SoilVIIQVLRFRDGLHASFNLMFDRLLMLEQLGLVPAAA*
Ga0150985_11279375013300012212Avena Fatua RhizospherePPTGRSVKAPYMQVLRFRGDKCVSADLMYDRLELLEQLGLVPQAAAS*
Ga0157285_1015046513300012897SoilIQVLRFRDGKHVSFHLMFDRLAMLEQLGLVPAAAG*
Ga0157296_1030497523300012905SoilPVSLDYIQVLRFRDGQHVSFNLMFDRLLMLEQLGLIPAPAG*
Ga0157283_1042524013300012907SoilSVDYIQVLRFRDGKHVSFNLMFDRLLMLEQLGLILAPAQAAGRG*
Ga0157310_1051302123300012916SoilPTGRAVAVDYIQVLRFRHGRHVAFNLSFDRLLMLEQLGLAG*
Ga0164298_1059591713300012955SoilPTGRPVSVGYIQVLSFRDGKHASFNLMFDRLLMLEQLQLMPVAAHGG*
Ga0164303_1078404933300012957SoilQVLHFRNGKHVSFNLMFDRLLMLEQLGLIPAPTA*
Ga0164301_1181186523300012960SoilVPYVQVLRFRDGQHTFFNLMFDRLLMLEQLGLIPAPA*
Ga0157371_1056268023300013102Corn RhizosphereVLRFRDGRHVSFNLMFDRLLMLEQLGLVPAPAADG*
Ga0157369_1225389723300013105Corn RhizosphereQVLRFRDGKHVSFHLMFDRLAMLEQLGLVPMSAAA*
Ga0157378_1072055923300013297Miscanthus RhizosphereQVLRFRDGKHVSFHLMFDRLAMLEQLGFVPMSAAA*
Ga0157372_1164522223300013307Corn RhizosphereDYIQVLHFRDGRHVSFNLMFDRLLMLEQLGLVPAAAPAG*
Ga0157377_1000356913300014745Miscanthus RhizosphereGRAVRLDYIQVLRFRDGKHASFHLMFDRLLMLEQLGLAG*
Ga0157376_1014837043300014969Miscanthus RhizospherePTGRSVEVDYIQVLRFRDGKHVSFHLMFDRLAMLEQLGLVPMSAAA*
Ga0132258_1072538113300015371Arabidopsis RhizosphereVDYIQVLRFRDGKHVSLNLMFDRLTMLEQLGLVPTSAAAA*
Ga0132256_10270921723300015372Arabidopsis RhizosphereGRPVKVDYIQVLHFRDGKHVSFNLTFDRLLMLEQLGLVPAPAAAA*
Ga0182033_1105521013300016319SoilRAVNLDYIHVLHFRGGEHVSFNLMFDRLLMLEQLALIPAPAPAA
Ga0182033_1215856513300016319SoilGDIPPTGRPVTLDYLQVLRFRDGSHVLFNLMYDRLLLLEQLGLIPAPAATG
Ga0182032_1097026513300016357SoilIPPTGRFVEVDYVHVLRYRDGKHVSFNLMFDRLMMLEQLGVVPAPALELG
Ga0182034_1125376713300016371SoilQVLRFRDGKHVSFNLMFDRLLMLEQLGLIPTPGVAA
Ga0182034_1183321113300016371SoilLRFRDGKHVSFNLVFDRLQMLEQLELLPAPAPARG
Ga0182037_1159414913300016404SoilTGRPVRIAYIQVLRFRDGKHVSFNLMFDRLSMLEQLGLIPAPLPTAR
Ga0182039_1068222213300016422SoilVAVDYVHVLRYRDGQHISFNLMFDRLLMLEQLGLFTAPVR
Ga0182039_1190924623300016422SoilPTGDVPPTGRFVKVDYIQVLRFRDGKHLSFNLMFDRLTMLEQLALVPMPAEAA
Ga0182038_1177014913300016445SoilVLHYRDGKHVSFSLSYDRLQMIEQLGLIPAPAPAS
Ga0182038_1202583313300016445SoilRQVTVDYIQVLRFRDGKHISFNLMYDRLLMLEQLGLLPAPAAAS
Ga0187812_101923313300017821Freshwater SedimentVDYIHVLRYRDGQHISFNLMFDRLLILEQLGLVPAPAATG
Ga0187818_1056869813300017823Freshwater SedimentIHVLRYRDGLHVSFSLLFDRLLMLEQLGLVPAPAAAG
Ga0187806_120352123300017928Freshwater SedimentVAVDYVHVLRYRDGLHISFTLVFDRLLMLEQLGLIPAPASAS
Ga0187801_1034479013300017933Freshwater SedimentYFQVLRFRDGKHISFNLMYDRLALLEQLGIIPAPAPTS
Ga0187819_1040713413300017943Freshwater SedimentVDYTHVLRFRDGKHASFNLTFDRLMMLEQLGLVPTPALAG
Ga0187778_1055466613300017961Tropical PeatlandRSVSVPYIHLLRFREGFHVSFNLVFDRLQLLEQLGLVPTPAPTG
Ga0187776_1065233023300017966Tropical PeatlandPTGRPVRIAYIHVLRFRDGKHISFNLMFDRLSMLEQLGLIPASVPDG
Ga0187783_1135329423300017970Tropical PeatlandVAVDYIQVLRFRDGKHISFNLMYDRLLLLEQLGVIPAPPAG
Ga0187777_1076087313300017974Tropical PeatlandIHVLRYRDGLHAAFNLSFDRLVMLEQLGLIPAPAAEL
Ga0187822_1026660023300017994Freshwater SedimentMQVLRFRDGKHTSFNLMFDRLEMLEQLGLSPVAAQAG
Ga0187767_1014918323300017999Tropical PeatlandGRSVTADYIQVLGFRDGQNVSFHLMYDRLHLLEQLGLIPAAAQAG
Ga0187766_1022925833300018058Tropical PeatlandPYIHVLRYRDGLHAAFNLSFDRLVMLEQLGLIPVPAAAQ
Ga0187766_1047336313300018058Tropical PeatlandVDYIHVLRYRDGLHVSFNLMFDRLLMLEQLGLIPAPAPAG
Ga0187766_1135606013300018058Tropical PeatlandPAGPIPPTGRAVAADYIQVLRFRDGLVVSFNLMFDLLRMLEQLDLVPAFAPAD
Ga0187765_1011945213300018060Tropical PeatlandIPPTGRRISLEYIQVLRFRHGRHVSFNLMFDRLEMLEQLGLIPAPAQAG
Ga0187772_1023653913300018085Tropical PeatlandPAGDIPPTGRTVAVDYIQVLRFRDGKHTSFNLMYDRLLLLEQLGLIPAPPPG
Ga0066655_1115060813300018431Grasslands SoilSPMGDVPPTGRLVRIAYIQVLRFRIEKHVSFKLLFGRFAMLEQLGLIPTPAAG
Ga0173482_1014039613300019361SoilIQVLRFREGKHVSFNLMFDRLQMVEQLGLIPAAAA
Ga0206353_1050477813300020082Corn, Switchgrass And Miscanthus RhizosphereATGRRTAVDYIHVLRYRDGLHVSFNLVFDRLQMLEQLGLIPGPAPAR
Ga0187768_107685413300020150Tropical PeatlandVSVPYIHVLRYRDGLHAAFNLSFDRLVMLEQLGLIPVPAAAQ
Ga0213873_1019946723300021358RhizosphereVPYVHVLRYRDGLHVSFNLMFDRLLMLEQLGLMPAPSRTE
Ga0213881_1008392613300021374Exposed RockAVGYVHVLRYRDGKHVSFNLLFDRLQMLEQLGLVPAPAPAPAS
Ga0213874_1013686313300021377Plant RootsPTGRAVSLPYIHVLRYREGLHASFNLSFDRLQMLEQLGLMPAREPAVR
Ga0213876_1005626213300021384Plant RootsPPTARAVSVPYIHVLRYRDGLHVSFNLAFDRLSMLEQLGLIPAPAPSR
Ga0213876_1036758613300021384Plant RootsDVPPTGRTVSVPYIHTLRYRDGLHVSFNLSFDRLLMLEQLGLVPAPAVAR
Ga0213876_1059143313300021384Plant RootsRVQLDYIQVIRFRDGKHSSFHLAFDRLLMLEQLGLMAAPAVGA
Ga0213875_1018366923300021388Plant RootsLDYIQVIRYRDGKHASFNLMFDRLLMLEQLGLAPSPDGA
Ga0213875_1059540113300021388Plant RootsGRAVSLPYIQVLRYRDGLHASFNLAFDRLAMLEQLGLIPAPAAAP
Ga0210385_1053756013300021402SoilPTGHSVELDYVHVLRFRDGKHASFNLMFDRLMMLEQLGLVPMPAAAE
Ga0210397_1099502513300021403SoilDVPPTGRSVEVDYTHVLRYRDGKHVSFNLMFDRLMMLEQLGLVPTPALAG
Ga0210383_1052351713300021407SoilGRPVALDYIQVLRYRDGLHISFNLIFDRLAMLEQLGLIPAPAPTG
Ga0210394_1136519323300021420SoilPGSRVAVPYVQVLRFRDGQHASFNLMFDRLLMLEQLGLIPAPA
Ga0210394_1151239613300021420SoilTGRPVRIAYIQVLRFRDGKHVSFNLMFDRLSMLEQLGLVLAPQHTDG
Ga0210384_1011492613300021432SoilMSSSARRFRDGKHVSFNLLSDRLLMLEQLGLIPAPAPAPAS
Ga0210402_1195079913300021478SoilVLRYRDGLHASFNLMFDRLLMLEQLGLIPAPAPAS
Ga0126371_1154899713300021560Tropical Forest SoilPTGRPVRIAYIQVLRFRHGKHASFDLMFDRLEMLEQLGLAILPSTTG
Ga0247746_108462823300022886SoilGRHVSLDYVQVLRIRDGRHISFNLMFDRLLMLEQLGLVPAPADA
Ga0247802_107080613300023077SoilVEIDYIQVLRFRDGKHTSFNLMFDRLLMLEQLGLVPAPAADG
Ga0207645_1037781623300025907Miscanthus RhizosphereDYIQVLHFRDGRHVSFNLMFDRLLMLEQLGLVPAAAPAG
Ga0207663_1020866123300025916Corn, Switchgrass And Miscanthus RhizospherePPTGQPVAVPYVQVLRFRDGQHTSFNLMFDRLLMLEQLGLIPAAA
Ga0207660_1138043113300025917Corn RhizosphereDIAATGRRTAVDYIHVLRYRDGLHVSFNLLFDRLQMLEQLGLIPAPAPAR
Ga0207687_1122485213300025927Miscanthus RhizosphereYIQVLRFRDGKHTSFNLMFDRLLMLEQLGLVPAPAADG
Ga0207700_1183991913300025928Corn, Switchgrass And Miscanthus RhizosphereVSLDYIQVLRFRDGKHVSFNLMFDQLLMLGQLGLIPAPAPAG
Ga0207690_1094315723300025932Corn RhizosphereRLDYLQVLRFRDGRHVSFNLMFDRLLMLEQLGLVPAAAGR
Ga0207709_1055599713300025935Miscanthus RhizosphereLDYVQVLRFRDGRHVSFNLMFDRLLMLEQLGLVAAAAPAA
Ga0207709_1121756713300025935Miscanthus RhizosphereVRLDYIQVLHFRDGRHVSFNLMFDRLLMLEQLGLVPAAAPAG
Ga0207670_1035176233300025936Switchgrass RhizosphereVEVDYIQVLRFRDGKHVSFHLMFDRLAMLEQLGLVPMSAAA
Ga0207678_1200689613300026067Corn RhizosphereGDLAPTGRAVRLDYIQVLRFRDGTHVSFNLSFDRLAMLEQLGP
Ga0207708_1172062823300026075Corn, Switchgrass And Miscanthus RhizosphereVRLDYVQVLRFRDGRHVSFNLMFDRLLMLEQLGLVAAAAPAA
Ga0207683_1108573523300026121Miscanthus RhizosphereRPVEIDYIQVLRFREGKHASFNLMFDRLLMLEQLGLVPAPAADG
Ga0209804_133733023300026335SoilIQVITFRNGRCIAANLMFDRLQLLEQLGLVPAPATSG
Ga0209805_102736553300026542SoilRRVQGDYIQVITFRNGRCIAANLMFDRLQLLEQLGLVPAPATSG
Ga0208365_106070013300027070Forest SoilPPTGQPVAVPYVQVLRFRDGQHASFNLMFDRLLMLEQLGLIPAPAPTG
Ga0208241_102064933300027297Forest SoilQVLRYRDGLHISFNLIFDRLAMLEQLGLIPVPAPTG
Ga0208199_106846623300027497Peatlands SoilTGRAVSLPYIHVLRFRGGLHASFNLIFDRLLMLEQLGVIPAPAVAQ
Ga0208324_100671323300027604Peatlands SoilVLRYRDGLHVSFNLVFDRLLMLEQLGLVPAPAALQ
Ga0209275_1001906933300027884SoilSVEVDYTHVLRYRDGKHVSFNLMFDRLMMLEQLGLVPTPALAG
Ga0209069_1021527613300027915WatershedsLHSPAGDIPPTGHSVQVNYIQVLRIREGRHVSFNLIFDRLLMFEQLGLVPAQTPAG
Ga0247828_1088129913300028587SoilRISYVQVLRFRDGRHVSFNLMFDRLSMLEQLGVVQAPAPRA
Ga0247818_1035725323300028589SoilGVLHGADGDIPPTGRFVQLDYIQVLRFRAGKHVSFHLMFDRLLMLEQLGLAPVPVSPR
Ga0247822_1109248613300028592SoilAGDLPPTGRAVRLDYLQVLRFRDGTHVAFNLSFDRLAMLEQLGP
Ga0307295_1021233013300028708SoilGRPVKVDYIQVLHFRDGKHSSFNLMFDRLLMLEQLGLIPAPALDG
Ga0308309_1053062113300028906SoilHVLRYRDGKHVSFNLMFDRLMMLEQLGLVPTPALAG
Ga0247826_1020463523300030336SoilIQVLRFRDGRHLEFNLMFDRLLMLEQLGLAPAPAGE
Ga0247826_1060152523300030336SoilVRLDYLQVLRFRDGKHTSFHLSFDRLAMLEQLGLVPEPAPAITGGTAPAR
Ga0308202_110074923300030902SoilIAYIQVLRFRDGKHVSFNLGFDRLEMLEQLGLVPAPAATS
Ga0308204_1017520113300031092SoilIAYIQVLRFRDGKHVSFNLSFDRLEMLEQLGLVPAPAATS
Ga0307497_1063930813300031226SoilGRPVRLDYVQVLRFRDGRHVSFNLMFDRLLMLEQLGLVPAAAPAP
Ga0318516_1061379213300031543SoilPPTGRPVTVGYIQVLHFRDGRHVSFNLMYDRLLLLEQLGLIPSPAPAS
Ga0318516_1063794113300031543SoilYIHVLRYRDGLHASFNLMFDRLLMLEQLGLIPAPAPAG
Ga0318534_1031794113300031544SoilPGPAGDIPPTGRPVTVPYIQVLRFRDGLHASFSLMYDRLLMLEHLGLV
Ga0318534_1050552823300031544SoilLQVLRFRDGNHVMFNLMYDRLLLLEQLGLIPAPAATG
Ga0318534_1077651823300031544SoilIHVLRYRDGLHVSFNLLFDRLLMLEQLGLVPAPAATG
Ga0318541_1048161723300031545SoilDYIEVLGFRDGKHVSFNLMYDRLLLLEQLGLIPAPLAG
Ga0318538_1034756623300031546SoilANYIQVLRFRDGMIAALNLMFDQLELLEQLGLVPDPAQTG
Ga0318538_1039506113300031546SoilGRPVTVPYIQVLRFRDGRHASFNLMYDRLLMLEHLGLT
Ga0318571_1009395123300031549SoilAVQGAVDYIHVLRYRDGKHVSFNLLFDRLQMLEQLGLLPAPAPAG
Ga0318571_1026879513300031549SoilTGRPVTVPYIQVLRFRDGRHASFNLMYDRLLMLEHLGLA
Ga0318571_1036331213300031549SoilDYVHVLHYRDGKHVSFSLSYDRLQMIEQLGLIPAPAPAS
Ga0318573_1030228023300031564SoilVSLDYVHVLRFRDGKHVSFNLMFDRLLMLEQLGLIPAPAAGP
Ga0318515_1016614113300031572SoilDYIHVLRYRDGLHVSFNLMFDRLLMLEQLGLIPAPAPAG
Ga0318515_1026350313300031572SoilVSLDYIHVLHFRDGEHVSFNLMFDRLLMLEQLGLIPAPAPAAQ
Ga0318515_1062642013300031572SoilVQVLRFRAGKHASFNLMFDRLLMLEQLGLLPAPAPAP
Ga0310915_1029267823300031573SoilIPPTGRPVTVDYIEVLGFRDGKHVSFNLMYDRLLLLEQLGLIPAPLAG
Ga0318542_1024606123300031668SoilPPTGRPVAVDYIQVLRFRGGKHISFNLMFDRLLMLEQLGLLPAAAAAG
Ga0318561_1057358423300031679SoilVVHVLRYRDGKHVSFNLLFDRLSMLEQLGLLPAPAPAG
Ga0318572_1030281813300031681SoilAVHYIHVLRYRDGKHVSFNLLFDRLQMLEQLGLMPAPAPTS
Ga0318572_1040607023300031681SoilIEVLGFRDGKHVSFNLMYDRLLLLEQLGLIPAPLAG
Ga0318560_1049353223300031682SoilPVSVDYIEVLGFRDGKHVSFNLMYDRLLLLEQLGLIPAPLAG
Ga0318496_1007030323300031713SoilAGDIPPTGRPVTVPYIQVLRFRDGRHASFNLMYDRLLMLEHLGLV
Ga0310813_1036855223300031716SoilSVSVAYMQVLRFRDGKHASFHLMFDRLSMLEQLGLVPIAH
Ga0306917_1052851523300031719SoilPVTLDYLQVLRFRDGNHVMFNLMYDRLLLLEQLGLIPAPAATG
Ga0307469_1199239813300031720Hardwood Forest SoilVDYVQVLRFRGGKHVSFHLMFDRLVMLEQLGFVPAPTPAG
Ga0318493_1037469533300031723SoilTGRPVTVPYIQVLRFRDGLHASFSLMYDRLLMLEHLGLV
Ga0318500_1047890813300031724SoilGDIAATGRPVAVHYIHVLRYRDGKHVSFNLLFDRLQMLEQLGLIPAPAPTS
Ga0318502_1025023933300031747SoilIHVLRYRDGQHVSFNLMFDRLLMLEQLGLLTAPVR
Ga0318494_1006424813300031751SoilPGPSGEIPPTGRPVTVPYIQVLRFRDGQHASFNLMYDRLLMLEHLGLV
Ga0318494_1088935213300031751SoilGRAVNVEYVHVLRFRDGLHISFNLMFDRLLMLEQLGLVPAPATAQ
Ga0318526_1017340023300031769SoilVAVDYIQVLRFRGGKHISFNLMFDRLLMLEQLGLLPAAAAAG
Ga0318526_1020534623300031769SoilVNVEYVHVLRFRDGLHISFNLMFDRLLMLEQLGLVPAPATAQ
Ga0318521_1044115923300031770SoilVDYIQVLRFRDGKHISFNLMYDRLLMLEQLGLLPAPAAAS
Ga0318521_1074119423300031770SoilPTGRAVSLDYIHVLRFRGGEHVSFNLMFDRLLMLEQLGLIPAPAPAV
Ga0318521_1104269513300031770SoilLQVLRFRDGKHVSFNLMFDRLSMLEQLGLVPAPTAVD
Ga0318546_1017054443300031771SoilDIPPTGRRVAVDYVHVLRYRDGQHISFNLMFDRLLMLEQLGLLTAPVR
Ga0318546_1075131513300031771SoilPGPAGDIPATGRPVTVPYIQVLRFRDGLHASFSLMYDRLLMLEHLGLV
Ga0318498_1052459923300031778SoilPAGDIPPTGRPVTVPYIQVLRFRDGLHASFSLMYDRLLMLEHLGLV
Ga0318566_1016162813300031779SoilSVAIDYIQVLRFRDGKHVSFNLVFDRLQMLEQLELLPAPAPARG
Ga0318529_1014651813300031792SoilIHVLRYRDGLHVSFNLMFDRLLMLEQLGLIPAPAPAG
Ga0318550_1063821623300031797SoilTVDYIQVLRFRDGKHISFNLMYDRLLMLEQLGLLPAPAAAS
Ga0318523_1067852313300031798SoilTGRPVAVDYVHVLHYRDGKHVSFNLSYDRLQMIEQLGVIPAPAPAS
Ga0318523_1068031313300031798SoilYIQVLRFRDGKHVSFNLVFDRLQMLEQLELLPAPAPARG
Ga0318565_1037715423300031799SoilPPTDRAVSLDYIHLLRLRDGEHVSFNLMFARLLMLEQLGLIRVPAPAAQ
Ga0318497_1013326013300031805SoilVDYIHVLRYRDGQHVSFNLMFDRLLMLEQLGLLTAPVR
Ga0318497_1058563913300031805SoilVDYVQVLRFRDGKHVSFNLMFDRLSMLEQLGLVPAPTGVD
Ga0318568_1012564733300031819SoilAVNVEYVHVLRFRDGLHISFNLMFDRLLMLEQLGLVPAPATA
Ga0307473_1029533613300031820Hardwood Forest SoilATGRPVTVDYIQVLRFRDGKHASFSLIYDRLLMLEQLGLIPAPAG
Ga0318567_1004084113300031821SoilPTGRAVNVEYVHVLRFRDGLHISFNLMFDRLLMLEQLGLVPAPATAQ
Ga0318567_1058253323300031821SoilVDYIQVLRFRDGKHVSFNLMFDRLLMLEQLGLIPAPPAE
Ga0318564_1046442613300031831SoilPTGRSVEVDYIQVLRFRDGKHVSFHLMFDRLAMLEQLGLVPTSATA
Ga0318499_1023249433300031832SoilAATGRAVAVDYIHVLRYRDGLHVSFNLIFDRLAMLEQLGLIPAPAPAG
Ga0318499_1033852523300031832SoilVSVDYIEVLGFRDGKHVSFNLMYDRLLLLEQLGLIPAPLAG
Ga0318499_1039132913300031832SoilIQALRFRDGRHASFNLMYDRLLLLEQLGLVPAPAG
Ga0310917_1060394713300031833SoilAVDYIHVLRYRDGKHVSFNLLFDRLSMLEQLGLLPAPAPAG
Ga0318512_1008118613300031846SoilIAATGRPIAVHYIHVLRYRDGKHVSFNLLFDRLQMLEQLGLIPAPAPTS
Ga0318512_1018288323300031846SoilGRRVTLDYIAVNRYRDGKVASVNLMYDQLLLLEQLGLIPAPQPAG
Ga0318495_1035260713300031860SoilVDYIQVLRFRDGKHISFNLMFDRLLMLEQLGLLPAEAPAG
Ga0306919_1072942913300031879SoilVLRFHDGKHVSFNLLFDRLSMLEQLGLAPAPAEAG
Ga0306919_1139378423300031879SoilDIAPTGRQVAVDYIHVLRYRDGKHVSFNLLFDRLQMLEQLGLLPAPAPAG
Ga0306925_1144457113300031890SoilTGRPVAVDYIQVLRFRGGKHISFNLMFDRLLMLEQLGLLPAAAAAG
Ga0306925_1154871623300031890SoilTGRAVSLDYIHVLHFRDGEHVSFNLMFDRLLMLEQLGLIPAPAPAA
Ga0318536_1030178823300031893SoilVHYIHVLRYRDGKHVSFNLLFDRLQMLEQLGLIPAPAPTS
Ga0318522_1003102133300031894SoilHYIHMLRYRDGKHVSFNLLFDRLQMLEQLGLIPAPAPTS
Ga0318551_1040661813300031896SoilPVAVDYIQVLRFRGGKHISFNLMFDRLLMLEQLGLLPAAAAAG
Ga0318551_1060988513300031896SoilGRQVTVDYIQVLRFRDGKHISFNLMYDRLLMLEQLGLLPAPAAAS
Ga0306923_1077765813300031910SoilVDYIQVLRFRDGKHLSFNLMFDRLTMLEQLALVPMPAEAA
Ga0306923_1103412713300031910SoilIQVLRFRGGKHVSFNLMFDRLLMLEQLGLLPAAAAAG
Ga0306923_1228443813300031910SoilPTGRPVRIAYIQVLRFRDGKHVSFNLMFDRLSMLEQLGLIPAPLPTAR
Ga0306921_1015990823300031912SoilMTITPTLIVSDVPPTGRSVSVGYIQVLRFQNGKHALFNLMFDRLQLQEQLGLIPGAPPVR
Ga0310912_1075208613300031941SoilEVDYIQVLRFRDGKHVSFNLMYDRLLMLEQLGLIPTPGVAA
Ga0310916_1052934713300031942SoilDIPPTGRRVAVDYVHVLRYRDGQHISFNLMFDRLLMLEQLGLFTAPVR
Ga0307479_1099004213300031962Hardwood Forest SoilGRPVRIAYVQVLRFRDGKHVSFNLMFDRLSMFEQLGLVPAPLSTAGETPVT
Ga0307479_1144236323300031962Hardwood Forest SoilQVLRFRSGKHVSFNLVFDRLSMLEQLGLVPAPQHTDG
Ga0306922_1139399023300032001SoilHVLRYRDGKHVSFNLLFDRLQMLEQLGLMPAPAPTS
Ga0318562_1053132023300032008SoilGEIPPTGRPVTVPYIQVLRFRDGQHASFNLMYDRLLMLEHLGLV
Ga0318563_1043678713300032009SoilDYIHVLRYRDGLHVSFYLMFDRLLMLEQLGLIPAPAPAG
Ga0318563_1053531413300032009SoilSVDYIHVLRFRDGLHVSFNLMFDRLLMLEQLGLIPAPAPAQ
Ga0310911_1024445913300032035SoilPTGRHVTANYIQVVRFRDGMIAALNLMFDQLELLEQLGLVPDPAQTG
Ga0318549_1029924223300032041SoilTGRSVAVDYIQVLRFRDGKHVSFNLVFDRLQMLEQLELLPAPAPARG
Ga0318558_1030744223300032044SoilGRPVTVDYIEVLGFRDGKHVSFNLMYDRLLLLEQLGLIPAPLAG
Ga0318558_1041311223300032044SoilDVVHRDGLHVSFNLMFDRLLMLEQLGLIPAPAPAG
Ga0318513_1009779533300032065SoilPVAVHYIHMLRYRDGKHVSFNLLFDRLQMLEQLGLIPAPAPTS
Ga0318513_1013608613300032065SoilGDVPPTDRAVSLDYIHLLRLRDGEHVSFNLMFARLLMLEQLGLIRVPAPAAQ
Ga0318514_1024579713300032066SoilVSIDYVNVLRFKDGKHVSFSLTFDRLAMLEQLGLIPPPAPGGR
Ga0318553_1001105143300032068SoilPTGRRVAVDYVHVLRYRDGQHISFNLMFDRLLMLEQLGLLTAPVR
Ga0318553_1064939913300032068SoilGALPGPAGDIAPTGRPVTVPYIQVLRFRDGLHASFSLMYDRLLMLEHLGLV
Ga0306924_1151316423300032076SoilTGCSVSVDYIQVLRFRDGKHVSFNLMFDRLLMLEQLGLIPAPPAE
Ga0306924_1251580923300032076SoilAGDIAPTGRQVAVDYIHVLRYRDGKHVSFNLLFDRLSMLEQLGLLPAPAPAG
Ga0318518_1054864523300032090SoilGDIAATGRAVAVDYIHVLRYRDGLHVSFNLIFDRLAMLEQLGLIPAPAPAG
Ga0318518_1067107423300032090SoilVHYIHMLRYRDGKHVSFNLLFDRLQMLEQLGLIPAPAPTS
Ga0311301_1164842113300032160Peatlands SoilTGRAVSLPYIHVLRFRGGLHASFNLIFDRLLMLEQLGVIPAPRLARGSR
Ga0306920_10307923323300032261SoilGPAVDIPPTGRPVTVPYIQVLRFRDGLHASFSLMYDRLLMLEHLGLV
Ga0306920_10343727733300032261SoilRPVAVDYIHVLRYRDGLHVSFNLMFDRLLMLEQLGHIPAPAPAG
Ga0306920_10440881413300032261SoilGYIQVLRFREGKHVSFHLMFDRLAMLEQLGLVPAPAA
Ga0335085_1033134913300032770SoilVDYIHVPCFRDGRHISVNLITDRLLMLEQFGLIPAPAPAV
Ga0335079_1118196923300032783SoilVPRFRDGKHISFNLIFDRLLMLYPLGLYPLGLIRAQAPAD
Ga0335081_1252006223300032892SoilVPYIQVLRFRDGRHASFNLMYDRLLMLEHLGLVPA
Ga0335072_1009795723300032898SoilVDYIHVLRYREGKHVSFNLLFDRLLMLEQLGILPTTVPAR
Ga0335072_1038854333300032898SoilDYIQVLRYRDGKHVSFNLMYDQLLLLEQLGLIPAQQPAG
Ga0335077_1099804123300033158SoilYIPPTGRPVTVDYIQVLRFRDGRHVCFNLMYDRLLMLEQLGLIPAPAAS
Ga0318519_1067938713300033290SoilNVTLEYIQVLHFRDGMTVSFNLMFDRLELLEQLGLVADPAQMG
Ga0247829_1094016113300033550SoilPPTGRSVSVPYLQVLRFRDGKHILFNLMFDRLLMLEQLGLVPAPVPMG
Ga0314862_0018851_1161_12833300033803PeatlandVDYVNVLRFKDGKHVSFSLTFDRLAMLEQLGLVPAPPPAG
Ga0314867_072564_650_7993300033808PeatlandRSVSVPYIHVLRFREGFHVSFNLIFDRLLLLEQLGLVPTPTPHRVIRTA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.