| Basic Information | |
|---|---|
| Family ID | F013068 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 274 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MLTSYNGWPASKDPAEIGIKSYPVPGTNRKLRCAEAVAPLL |
| Number of Associated Samples | 151 |
| Number of Associated Scaffolds | 274 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 52.01 % |
| % of genes near scaffold ends (potentially truncated) | 98.91 % |
| % of genes from short scaffolds (< 2000 bps) | 92.70 % |
| Associated GOLD sequencing projects | 132 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (72.263 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (30.292 % of family members) |
| Environment Ontology (ENVO) | Unclassified (71.533 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (72.993 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.35% β-sheet: 20.29% Coil/Unstructured: 75.36% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 274 Family Scaffolds |
|---|---|---|
| PF03406 | Phage_fiber_2 | 3.28 |
| PF09636 | XkdW | 2.55 |
| PF16778 | Phage_tail_APC | 1.46 |
| PF13884 | Peptidase_S74 | 0.73 |
| PF07603 | DUF1566 | 0.36 |
| PF13385 | Laminin_G_3 | 0.36 |
| PF04586 | Peptidase_S78 | 0.36 |
| COG ID | Name | Functional Category | % Frequency in 274 Family Scaffolds |
|---|---|---|---|
| COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 0.36 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.83 % |
| Unclassified | root | N/A | 21.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000405|LV_Brine_h2_0102DRAFT_1016931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1459 | Open in IMG/M |
| 3300000525|JGI1221J11331_1036092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1026 | Open in IMG/M |
| 3300001097|JGIcombinedJ13537_10136803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
| 3300001523|JGI1221J15618_1148885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1293 | Open in IMG/M |
| 3300002408|B570J29032_108763535 | Not Available | 505 | Open in IMG/M |
| 3300002835|B570J40625_100039183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7111 | Open in IMG/M |
| 3300002835|B570J40625_100449317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1231 | Open in IMG/M |
| 3300002835|B570J40625_100857329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 791 | Open in IMG/M |
| 3300002835|B570J40625_101404737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| 3300002835|B570J40625_101449673 | Not Available | 565 | Open in IMG/M |
| 3300002835|B570J40625_101627133 | Not Available | 527 | Open in IMG/M |
| 3300003277|JGI25908J49247_10040578 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300003393|JGI25909J50240_1046978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 905 | Open in IMG/M |
| 3300004096|Ga0066177_10355980 | Not Available | 630 | Open in IMG/M |
| 3300004096|Ga0066177_10504576 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
| 3300004240|Ga0007787_10164209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1071 | Open in IMG/M |
| 3300004240|Ga0007787_10165145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1068 | Open in IMG/M |
| 3300004240|Ga0007787_10656438 | Not Available | 525 | Open in IMG/M |
| 3300005528|Ga0068872_10061809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2313 | Open in IMG/M |
| 3300005581|Ga0049081_10098187 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1093 | Open in IMG/M |
| 3300005581|Ga0049081_10319675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300005582|Ga0049080_10085359 | Not Available | 1078 | Open in IMG/M |
| 3300005582|Ga0049080_10099610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 989 | Open in IMG/M |
| 3300005584|Ga0049082_10026394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2023 | Open in IMG/M |
| 3300005584|Ga0049082_10064074 | Not Available | 1290 | Open in IMG/M |
| 3300005805|Ga0079957_1178783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1046 | Open in IMG/M |
| 3300005805|Ga0079957_1202974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 955 | Open in IMG/M |
| 3300005805|Ga0079957_1297141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
| 3300005943|Ga0073926_10050338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 806 | Open in IMG/M |
| 3300006014|Ga0073919_1017491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
| 3300006802|Ga0070749_10264756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 971 | Open in IMG/M |
| 3300006802|Ga0070749_10678568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
| 3300006805|Ga0075464_10046177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2389 | Open in IMG/M |
| 3300006805|Ga0075464_10204047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1175 | Open in IMG/M |
| 3300006805|Ga0075464_10308961 | Not Available | 952 | Open in IMG/M |
| 3300006805|Ga0075464_10979336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300006805|Ga0075464_11028597 | Not Available | 517 | Open in IMG/M |
| 3300006917|Ga0075472_10225648 | Not Available | 921 | Open in IMG/M |
| 3300006920|Ga0070748_1272992 | Not Available | 605 | Open in IMG/M |
| 3300007516|Ga0105050_10121929 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1692 | Open in IMG/M |
| 3300007516|Ga0105050_10217282 | All Organisms → Viruses → Predicted Viral | 1191 | Open in IMG/M |
| 3300007519|Ga0105055_10736418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas fluorescens group → Pseudomonas fluorescens | 759 | Open in IMG/M |
| 3300007520|Ga0105054_10170760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2136 | Open in IMG/M |
| 3300007538|Ga0099851_1205908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
| 3300007540|Ga0099847_1029745 | All Organisms → cellular organisms → Bacteria | 1757 | Open in IMG/M |
| 3300007622|Ga0102863_1240280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300007722|Ga0105051_10341442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1124 | Open in IMG/M |
| 3300008267|Ga0114364_1049632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1513 | Open in IMG/M |
| 3300008450|Ga0114880_1130275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 932 | Open in IMG/M |
| 3300008450|Ga0114880_1181709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
| 3300008450|Ga0114880_1234258 | Not Available | 586 | Open in IMG/M |
| 3300009068|Ga0114973_10152990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1281 | Open in IMG/M |
| 3300009068|Ga0114973_10732827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300009081|Ga0105098_10803593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300009149|Ga0114918_10448613 | Not Available | 696 | Open in IMG/M |
| 3300009155|Ga0114968_10190303 | All Organisms → Viruses → Predicted Viral | 1195 | Open in IMG/M |
| 3300009163|Ga0114970_10089771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1914 | Open in IMG/M |
| 3300009164|Ga0114975_10077902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1929 | Open in IMG/M |
| 3300009180|Ga0114979_10389854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 816 | Open in IMG/M |
| 3300009181|Ga0114969_10487104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
| 3300009181|Ga0114969_10560508 | Not Available | 631 | Open in IMG/M |
| 3300009181|Ga0114969_10629841 | Not Available | 585 | Open in IMG/M |
| 3300009181|Ga0114969_10669516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300009181|Ga0114969_10764576 | Not Available | 515 | Open in IMG/M |
| 3300009184|Ga0114976_10305403 | Not Available | 850 | Open in IMG/M |
| 3300010157|Ga0114964_10405948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
| 3300010160|Ga0114967_10179604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1153 | Open in IMG/M |
| 3300010885|Ga0133913_11139649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2005 | Open in IMG/M |
| 3300010885|Ga0133913_11172172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1973 | Open in IMG/M |
| 3300010885|Ga0133913_11184013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1961 | Open in IMG/M |
| 3300010885|Ga0133913_12967417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1133 | Open in IMG/M |
| 3300011995|Ga0153800_1005135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1231 | Open in IMG/M |
| 3300011995|Ga0153800_1027030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
| 3300012012|Ga0153799_1011447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1942 | Open in IMG/M |
| 3300012012|Ga0153799_1030130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1048 | Open in IMG/M |
| 3300012012|Ga0153799_1034664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 959 | Open in IMG/M |
| 3300012013|Ga0153805_1040152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 795 | Open in IMG/M |
| 3300012017|Ga0153801_1041259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 815 | Open in IMG/M |
| 3300012017|Ga0153801_1096631 | Not Available | 521 | Open in IMG/M |
| 3300012666|Ga0157498_1005427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2095 | Open in IMG/M |
| 3300012666|Ga0157498_1067982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
| 3300012706|Ga0157627_1017510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 835 | Open in IMG/M |
| 3300012733|Ga0157606_1032386 | Not Available | 577 | Open in IMG/M |
| 3300013005|Ga0164292_10448463 | Not Available | 853 | Open in IMG/M |
| (restricted) 3300013122|Ga0172374_1284263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10339370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 871 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10221465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1270 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10152180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1829 | Open in IMG/M |
| 3300013372|Ga0177922_10009315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 858 | Open in IMG/M |
| 3300013372|Ga0177922_10127130 | Not Available | 673 | Open in IMG/M |
| 3300013372|Ga0177922_10215430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 748 | Open in IMG/M |
| 3300013372|Ga0177922_10584435 | Not Available | 1042 | Open in IMG/M |
| 3300013372|Ga0177922_10848367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1701 | Open in IMG/M |
| 3300013372|Ga0177922_11045409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 981 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10734500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10752281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
| 3300014811|Ga0119960_1048717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
| 3300017701|Ga0181364_1004598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2417 | Open in IMG/M |
| 3300017701|Ga0181364_1013106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1388 | Open in IMG/M |
| 3300017716|Ga0181350_1051454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1093 | Open in IMG/M |
| 3300017716|Ga0181350_1055349 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1044 | Open in IMG/M |
| 3300017716|Ga0181350_1059417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 999 | Open in IMG/M |
| 3300017716|Ga0181350_1061135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 982 | Open in IMG/M |
| 3300017722|Ga0181347_1029047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1724 | Open in IMG/M |
| 3300017723|Ga0181362_1063408 | Not Available | 756 | Open in IMG/M |
| 3300017723|Ga0181362_1103021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300017736|Ga0181365_1004833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3308 | Open in IMG/M |
| 3300017736|Ga0181365_1013273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2056 | Open in IMG/M |
| 3300017736|Ga0181365_1015744 | Not Available | 1899 | Open in IMG/M |
| 3300017736|Ga0181365_1017808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1788 | Open in IMG/M |
| 3300017736|Ga0181365_1019884 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1692 | Open in IMG/M |
| 3300017736|Ga0181365_1119774 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
| 3300017736|Ga0181365_1125064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
| 3300017736|Ga0181365_1144877 | All Organisms → Viruses | 564 | Open in IMG/M |
| 3300017736|Ga0181365_1161426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300017736|Ga0181365_1174305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
| 3300017761|Ga0181356_1069575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1184 | Open in IMG/M |
| 3300017761|Ga0181356_1158185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
| 3300017761|Ga0181356_1160140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
| 3300017761|Ga0181356_1241597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
| 3300017774|Ga0181358_1048996 | Not Available | 1603 | Open in IMG/M |
| 3300017774|Ga0181358_1049043 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
| 3300017774|Ga0181358_1073208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1261 | Open in IMG/M |
| 3300017774|Ga0181358_1077290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1220 | Open in IMG/M |
| 3300017774|Ga0181358_1089244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1117 | Open in IMG/M |
| 3300017774|Ga0181358_1099347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1045 | Open in IMG/M |
| 3300017774|Ga0181358_1142272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 826 | Open in IMG/M |
| 3300017774|Ga0181358_1151398 | Not Available | 792 | Open in IMG/M |
| 3300017777|Ga0181357_1044457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1743 | Open in IMG/M |
| 3300017777|Ga0181357_1052714 | Not Available | 1586 | Open in IMG/M |
| 3300017777|Ga0181357_1189742 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 739 | Open in IMG/M |
| 3300017777|Ga0181357_1203577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
| 3300017778|Ga0181349_1023327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2515 | Open in IMG/M |
| 3300017778|Ga0181349_1038669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1899 | Open in IMG/M |
| 3300017778|Ga0181349_1046352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1715 | Open in IMG/M |
| 3300017778|Ga0181349_1247203 | Not Available | 597 | Open in IMG/M |
| 3300017778|Ga0181349_1268175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300017778|Ga0181349_1284984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
| 3300017780|Ga0181346_1044398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1812 | Open in IMG/M |
| 3300017780|Ga0181346_1049946 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1695 | Open in IMG/M |
| 3300017780|Ga0181346_1053830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1624 | Open in IMG/M |
| 3300017780|Ga0181346_1188546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 751 | Open in IMG/M |
| 3300017780|Ga0181346_1225044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
| 3300017780|Ga0181346_1277832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
| 3300017784|Ga0181348_1025391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2512 | Open in IMG/M |
| 3300017784|Ga0181348_1086881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1235 | Open in IMG/M |
| 3300017784|Ga0181348_1115438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1036 | Open in IMG/M |
| 3300017784|Ga0181348_1118509 | All Organisms → Viruses → Predicted Viral | 1019 | Open in IMG/M |
| 3300017784|Ga0181348_1140234 | Not Available | 913 | Open in IMG/M |
| 3300017784|Ga0181348_1239986 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
| 3300017785|Ga0181355_1141845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 974 | Open in IMG/M |
| 3300017785|Ga0181355_1247468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
| 3300017785|Ga0181355_1295121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
| 3300019784|Ga0181359_1001175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6784 | Open in IMG/M |
| 3300019784|Ga0181359_1013807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2950 | Open in IMG/M |
| 3300019784|Ga0181359_1104151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1036 | Open in IMG/M |
| 3300019784|Ga0181359_1170905 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300020159|Ga0211734_10367791 | Not Available | 636 | Open in IMG/M |
| 3300020172|Ga0211729_10383223 | Not Available | 572 | Open in IMG/M |
| 3300020193|Ga0194131_10219063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 888 | Open in IMG/M |
| 3300020197|Ga0194128_10479719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
| 3300020198|Ga0194120_10182213 | Not Available | 1191 | Open in IMG/M |
| 3300020200|Ga0194121_10638777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
| 3300020204|Ga0194116_10252475 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300020205|Ga0211731_10358744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 876 | Open in IMG/M |
| 3300020205|Ga0211731_10400724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1469 | Open in IMG/M |
| 3300020205|Ga0211731_10783059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 803 | Open in IMG/M |
| 3300020214|Ga0194132_10422972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
| 3300020550|Ga0208600_1020016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1069 | Open in IMG/M |
| 3300020556|Ga0208486_1065147 | Not Available | 517 | Open in IMG/M |
| 3300022190|Ga0181354_1088011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1020 | Open in IMG/M |
| 3300022190|Ga0181354_1189264 | Not Available | 620 | Open in IMG/M |
| 3300022198|Ga0196905_1130560 | Not Available | 654 | Open in IMG/M |
| 3300022200|Ga0196901_1061253 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1381 | Open in IMG/M |
| 3300022407|Ga0181351_1068196 | Not Available | 1446 | Open in IMG/M |
| 3300022407|Ga0181351_1106164 | Not Available | 1078 | Open in IMG/M |
| 3300022407|Ga0181351_1215452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300022553|Ga0212124_10195923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1096 | Open in IMG/M |
| 3300023184|Ga0214919_10012544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10403 | Open in IMG/M |
| 3300023301|Ga0209414_1045131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1250 | Open in IMG/M |
| 3300023301|Ga0209414_1056093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1064 | Open in IMG/M |
| 3300023301|Ga0209414_1132451 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
| 3300024346|Ga0244775_10688945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 824 | Open in IMG/M |
| 3300024346|Ga0244775_11132806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300024346|Ga0244775_11226635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
| 3300024346|Ga0244775_11344650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
| 3300024483|Ga0255224_1019553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1320 | Open in IMG/M |
| 3300024560|Ga0256306_1139293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
| 3300024570|Ga0255276_1150980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
| 3300025645|Ga0208643_1115021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
| 3300025896|Ga0208916_10390236 | Not Available | 607 | Open in IMG/M |
| 3300027121|Ga0255074_1033229 | Not Available | 641 | Open in IMG/M |
| 3300027131|Ga0255066_1053984 | Not Available | 563 | Open in IMG/M |
| 3300027134|Ga0255069_1009175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1021 | Open in IMG/M |
| 3300027508|Ga0255072_1037603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1004 | Open in IMG/M |
| 3300027601|Ga0255079_1003112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4353 | Open in IMG/M |
| 3300027601|Ga0255079_1085863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
| 3300027608|Ga0208974_1043614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1310 | Open in IMG/M |
| 3300027659|Ga0208975_1045759 | Not Available | 1357 | Open in IMG/M |
| 3300027659|Ga0208975_1079435 | All Organisms → Viruses | 972 | Open in IMG/M |
| 3300027659|Ga0208975_1130000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
| 3300027659|Ga0208975_1161200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
| 3300027688|Ga0209553_1205898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
| 3300027697|Ga0209033_1068548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1224 | Open in IMG/M |
| 3300027707|Ga0209443_1171039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 779 | Open in IMG/M |
| 3300027707|Ga0209443_1194086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
| 3300027707|Ga0209443_1241884 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
| 3300027734|Ga0209087_1169341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 862 | Open in IMG/M |
| 3300027736|Ga0209190_1014746 | All Organisms → Viruses → Predicted Viral | 4522 | Open in IMG/M |
| 3300027754|Ga0209596_1272825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
| 3300027754|Ga0209596_1279301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
| 3300027759|Ga0209296_1232362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
| 3300027763|Ga0209088_10188674 | Not Available | 888 | Open in IMG/M |
| 3300027763|Ga0209088_10245509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
| 3300027785|Ga0209246_10135424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 968 | Open in IMG/M |
| 3300027785|Ga0209246_10232101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
| 3300027785|Ga0209246_10299861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
| 3300027808|Ga0209354_10111079 | All Organisms → Viruses → Predicted Viral | 1119 | Open in IMG/M |
| 3300027892|Ga0209550_10375799 | Not Available | 887 | Open in IMG/M |
| 3300027899|Ga0209668_10771391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Cryobacterium → unclassified Cryobacterium → Cryobacterium sp. Hh7 | 646 | Open in IMG/M |
| 3300027940|Ga0209893_1009613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300027963|Ga0209400_1226825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 756 | Open in IMG/M |
| 3300027971|Ga0209401_1089840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1288 | Open in IMG/M |
| 3300027971|Ga0209401_1119091 | Not Available | 1066 | Open in IMG/M |
| 3300027973|Ga0209298_10310859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300027976|Ga0209702_10118501 | Not Available | 1212 | Open in IMG/M |
| 3300027976|Ga0209702_10226045 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 786 | Open in IMG/M |
| 3300028394|Ga0304730_1184691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
| 3300031746|Ga0315293_11190827 | Not Available | 530 | Open in IMG/M |
| 3300031885|Ga0315285_10371500 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300031951|Ga0315904_11413217 | Not Available | 518 | Open in IMG/M |
| 3300031999|Ga0315274_10501977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1372 | Open in IMG/M |
| 3300031999|Ga0315274_11907925 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300032053|Ga0315284_11634452 | Not Available | 675 | Open in IMG/M |
| 3300032116|Ga0315903_10715269 | Not Available | 746 | Open in IMG/M |
| 3300032116|Ga0315903_10746395 | Not Available | 724 | Open in IMG/M |
| 3300032156|Ga0315295_11131733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 771 | Open in IMG/M |
| 3300032462|Ga0335396_10099250 | Not Available | 1920 | Open in IMG/M |
| 3300032462|Ga0335396_10214170 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1265 | Open in IMG/M |
| 3300032462|Ga0335396_10313805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1021 | Open in IMG/M |
| 3300032462|Ga0335396_10517053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
| 3300033981|Ga0334982_0211492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 952 | Open in IMG/M |
| 3300033993|Ga0334994_0133859 | Not Available | 1414 | Open in IMG/M |
| 3300033995|Ga0335003_0383099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
| 3300033996|Ga0334979_0285989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 941 | Open in IMG/M |
| 3300033996|Ga0334979_0693523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300034062|Ga0334995_0686510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
| 3300034064|Ga0335001_0331783 | Not Available | 826 | Open in IMG/M |
| 3300034066|Ga0335019_0347254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 919 | Open in IMG/M |
| 3300034066|Ga0335019_0664951 | Not Available | 602 | Open in IMG/M |
| 3300034068|Ga0334990_0135448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1341 | Open in IMG/M |
| 3300034071|Ga0335028_0576755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
| 3300034071|Ga0335028_0722489 | Not Available | 519 | Open in IMG/M |
| 3300034082|Ga0335020_0323689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
| 3300034092|Ga0335010_0320795 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 880 | Open in IMG/M |
| 3300034093|Ga0335012_0299689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 816 | Open in IMG/M |
| 3300034095|Ga0335022_0188397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1245 | Open in IMG/M |
| 3300034095|Ga0335022_0605408 | Not Available | 553 | Open in IMG/M |
| 3300034095|Ga0335022_0694837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300034101|Ga0335027_0374297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 933 | Open in IMG/M |
| 3300034101|Ga0335027_0389702 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 908 | Open in IMG/M |
| 3300034106|Ga0335036_0122054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1887 | Open in IMG/M |
| 3300034106|Ga0335036_0233221 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1256 | Open in IMG/M |
| 3300034108|Ga0335050_0392143 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
| 3300034116|Ga0335068_0478665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
| 3300034119|Ga0335054_0062266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2302 | Open in IMG/M |
| 3300034119|Ga0335054_0186319 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1257 | Open in IMG/M |
| 3300034122|Ga0335060_0207864 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1110 | Open in IMG/M |
| 3300034168|Ga0335061_0046359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2324 | Open in IMG/M |
| 3300034168|Ga0335061_0076354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1784 | Open in IMG/M |
| 3300034279|Ga0335052_0418551 | Not Available | 709 | Open in IMG/M |
| 3300034280|Ga0334997_0614210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
| 3300034284|Ga0335013_0505837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 722 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 30.29% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 15.69% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 10.95% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.57% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.47% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.01% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 4.01% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.28% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.28% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.55% |
| Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 2.55% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.19% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.46% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.09% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.09% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 1.09% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.73% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.73% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.36% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.36% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.36% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.36% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.36% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.36% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.36% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.36% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000405 | Hypersaline microbial communities from Lake Vida, Antarctica - sample: Brine Hole Two 0.1-0.2 micron | Environmental | Open in IMG/M |
| 3300000525 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron | Environmental | Open in IMG/M |
| 3300001097 | Saline microbial communities from Lake Vida, Antarctica (Lake Vida Brine Hole Two - Combined Assembly 2 samples, Mar 2013 Assem) | Environmental | Open in IMG/M |
| 3300001523 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron | Environmental | Open in IMG/M |
| 3300001847 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2a | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
| 3300006014 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_25-Nov-14 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007519 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03 | Environmental | Open in IMG/M |
| 3300007520 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007722 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300012706 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012733 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
| 3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
| 3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020214 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80m | Environmental | Open in IMG/M |
| 3300020550 | Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020556 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022553 | Powell_combined assembly | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300023301 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron (SPAdes) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024483 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024560 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024570 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300027131 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300027134 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300027508 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300027601 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_25-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032462 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly) | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| 3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LV_Brine_h2_0102DRAFT_10169311 | 3300000405 | Hypersaline | LFTSHNGYPASKDPAEIGIKSYLIKGTDRKMRVAEKVAPLLCGFAADFHDLIE |
| JGI1221J11331_10360923 | 3300000525 | Hypersaline | VSLTSYNGYQASKDPAEIGIKSYLIKGTDRKVRAAESVGHLL |
| JGIcombinedJ13537_101368033 | 3300001097 | Hypersaline | VSLTSYNGYPASKDPAEIGIKSYLIKGTDRKVRAAESVGHL |
| JGI1221J15618_11488851 | 3300001523 | Hypersaline | LFTSHNGYPASKDPAEIGIKSYLIKGTDRKMRVAEKV |
| RCM41_10974842 | 3300001847 | Marine Plankton | MTEKSQNGWTASKDPEEIKIKPFPVKGTDLKIRCN |
| B570J29032_1087635351 | 3300002408 | Freshwater | VTQKSQNGWTASKIRAEIGIESFAIPGTKVKLACAKAVAPLLVGFAA |
| B570J40625_10003918310 | 3300002835 | Freshwater | MLTSYNGWPASKDPAEIGIKSYPVPGTNRKLRCAEAVAPLLVGFAAE |
| B570J40625_1004493173 | 3300002835 | Freshwater | MQTSYNGWPASKDQAEIGVKPFKVEGTSLKIRCAEKVAPLLINFA |
| B570J40625_1008573293 | 3300002835 | Freshwater | MSLTSYNGYPASKDPNEIGIKSYSVDGTALRLRCASSVGPLLAAF |
| B570J40625_1014047371 | 3300002835 | Freshwater | METSYNGYPASKDPAEIKIKSYPVKGTDRKLRCAESVGPLL |
| B570J40625_1014496733 | 3300002835 | Freshwater | MLTSYNGWQASKDPDEIRITSYKVKGTNLKLRCAEGCGPLLAAFAAE |
| B570J40625_1016271332 | 3300002835 | Freshwater | VTQKSQNGWTASKIRAEIGIESFAIPGTKVKLACAKAVAPLLVGFAAEFH |
| JGI25908J49247_100405781 | 3300003277 | Freshwater Lake | MLTSYNGWPASKDPAEIGIKSYAVPGTNRKLRCAEAVAPLLVGFAAEFHA |
| JGI25909J50240_10469783 | 3300003393 | Freshwater Lake | MKLTSYNGWTASKDQAEIGVKSYAIPGTQLKIRCAEAVAPLIVGFCKEFNEL |
| Ga0066177_103559803 | 3300004096 | Freshwater Lake | METSYNGYRASKDPSEIGVKSYPVKGTDRKLRCAEAVGPLLAA |
| Ga0066177_105045763 | 3300004096 | Freshwater Lake | METSYNGWPASKDQAEIDVKSYLVPGTDRKLRCASAVAPLLIGFASEFH |
| Ga0007787_101642091 | 3300004240 | Freshwater Lake | LLTSYNGWPASKDPAEIGIKSYAVPGTNRKLRCAEAVAPLLV |
| Ga0007787_101651451 | 3300004240 | Freshwater Lake | LLTSYNGWPASKDPAEIGINSYAVPGTNRKLRCAEAVAPL |
| Ga0007787_106564381 | 3300004240 | Freshwater Lake | MPNTTAKSDNGWPASKDPAEIGIKSYLIKGTDIKIRCAKKAGALLAAFAAEFNEK |
| Ga0068872_100618091 | 3300005528 | Freshwater Lake | MLKSYNGYPASKDQDEIKIKAYPVKGTNRKLRCAESVGPLL |
| Ga0049081_100981873 | 3300005581 | Freshwater Lentic | LLTSYNGWPASKDPAEIGIKSYAVPGTNRKLRCAEAVAPLLVGFAA |
| Ga0049081_103196752 | 3300005581 | Freshwater Lentic | MPTTLKSSNGWPASKDAAEIGIKSFKVPGTDLKIRCAEKVAPLLIGLASEFHETIEP |
| Ga0049080_100853593 | 3300005582 | Freshwater Lentic | MPNTTLKSSNGWPASKDPAEIGIKSFKVPGTDLKIRCAE |
| Ga0049080_100996101 | 3300005582 | Freshwater Lentic | MLQSYNGWPASKDPAEIGIKSYAIPGTNRKLRCAEAVAPLLVGF |
| Ga0049082_100263945 | 3300005584 | Freshwater Lentic | MLTSYNGWPASKDQAEIGIKSYSVPGTLIKLRCAEKVAPLL |
| Ga0049082_100640743 | 3300005584 | Freshwater Lentic | MATTLKSSNGWPASKDPAVIGIKSYPIPGTSIKIR |
| Ga0079957_11787831 | 3300005805 | Lake | MLTSYNGWPASKDPAEIGIKSYAVPGTNRKLRCAEAVAPLLV |
| Ga0079957_12029743 | 3300005805 | Lake | MLTSYNGWPASKDPAEIGINSYAVPGTNRKLRCAEAVAPLLV |
| Ga0079957_12971411 | 3300005805 | Lake | MLTSYNGWPASKDPAEIGIKSYLVPGTNRKLRCAEAVAPLLV |
| Ga0073926_100503383 | 3300005943 | Sand | MLTSYNGWPASKDPAEIGIKSYLVPGTKIKLRCAEAVAPLLVGFAAEFHA |
| Ga0073919_10174913 | 3300006014 | Sand | MLTSYNGWPASKDPAEIGINSYPVPGTNRKLRCAEAVAPLLVGFAAE |
| Ga0070749_102647561 | 3300006802 | Aqueous | VIRSHNGWPASKNRVEIGIKSFTVPGTKLKLACAEAVAPLLIN |
| Ga0070749_106785681 | 3300006802 | Aqueous | MLTSYNGWPASKDPAEIGIKSYAVPGTNRKLRCAEAVAP |
| Ga0075464_100461771 | 3300006805 | Aqueous | VETSANGWPASKDQADLGIKSYPVPGTAIKLRCAEAVAPL |
| Ga0075464_102040471 | 3300006805 | Aqueous | MQTSYNGWPASKEQAEIGVKPFEVEGTSLKLRCAEKVAPLLINFAKEFNE |
| Ga0075464_103089611 | 3300006805 | Aqueous | METSANGWPASKDQAALGIKSYPVPGTALKLRCAEAV |
| Ga0075464_109793363 | 3300006805 | Aqueous | MKSQPLETSYNGWPASKDQAEIGIKSYKVESSHINLRCAEKVAPLLIGFAKEFNE |
| Ga0075464_110285973 | 3300006805 | Aqueous | METSANGWPASKDQTELGIKSYPVPGTAIKLRCAE |
| Ga0075472_102256481 | 3300006917 | Aqueous | MEKSQNGWPASKDPAAIKVGSYLVPGTKIKLRVAQRCAPLL |
| Ga0070748_12729923 | 3300006920 | Aqueous | METSANGWPASKDEAELGIKSYPVPGTAIKLRCAEAVAPLLIGLAAEFHELI |
| Ga0105050_101219291 | 3300007516 | Freshwater | MGFNGYPASKDPAEIGIKSYLIKGTDRKVRAAESV |
| Ga0105050_102172822 | 3300007516 | Freshwater | MLTSGNGWQASDNQKTIGIKSYRVKGAGIKLRCAQKVAPLLVGFAAR* |
| Ga0105055_107364181 | 3300007519 | Freshwater | VSGLLTSYNGYPASKDPAEIGIKSYLIKGTDRKVRAADSVG |
| Ga0105054_101707601 | 3300007520 | Freshwater | VSGLLTSYNGYPASKDPAEIGIKSYLIKGTDRKVRAAESVGHLLAAFA |
| Ga0099851_12059083 | 3300007538 | Aqueous | MLTSYNGWPASKDPAEIGIKSYPVPGTKRTLRCAEAV |
| Ga0099847_10297451 | 3300007540 | Aqueous | VLTSYNGWPASKDPAEIGINSYAVPGTNRKLRCAEAVAPLLIGF |
| Ga0102863_12402801 | 3300007622 | Estuarine | MLQSYNGWPASKDPAEIGIKSYAVPGTNRKLRCAEAVAPLL |
| Ga0105051_103414421 | 3300007722 | Freshwater | VSLTSYNGYPASKDPAEIGIKSYLIKGTDRKVRAAESVGHLLAAF |
| Ga0114364_10496321 | 3300008267 | Freshwater, Plankton | MLKSYNGYPASKDPDEIRITSYLVKGTSRKLRCAESVGPLL |
| Ga0114880_11302751 | 3300008450 | Freshwater Lake | MLKSYNGYPASKDPDEIKIKAYPVKGTDRKLRCAESVGPLLAAFAAEFHE |
| Ga0114880_11817093 | 3300008450 | Freshwater Lake | MLKSYNGYPASKDPDEIKIKAYPVKGTDRKLRCAESVGPLLAAFA |
| Ga0114880_12342583 | 3300008450 | Freshwater Lake | MNKSQNGWDASKVRAEIDIDSFAVPGTTIKLTCNKAVAPLLVGFAA |
| Ga0114973_101529901 | 3300009068 | Freshwater Lake | METSANGWPASKDQAELGIKSYSVPGTAIKLRCAETVAPLLIGLAAEFHELIEP |
| Ga0114973_107328271 | 3300009068 | Freshwater Lake | MLTSYNGWPASKDQAEIGVKPFKVEGTSLKLRCAEK |
| Ga0105098_108035933 | 3300009081 | Freshwater Sediment | METSYNGYPASKDPAEIKIKSYPVKGTDRKLRCAESVGPLLAAFAAEFH |
| Ga0114918_104486131 | 3300009149 | Deep Subsurface | MLTTYNGWPASKDPAENGIKSYPVPGTKRTLRCAEAV |
| Ga0114968_101903033 | 3300009155 | Freshwater Lake | MTLTSYNGWEASAKPESIHVKSYAIPGTTLKIRCAED |
| Ga0114970_100897711 | 3300009163 | Freshwater Lake | MTLTSYNGWPASKEPAEIGIKSYAVPGTTLKLRCAEKVAPLLIGFAAEFHEL |
| Ga0114975_100779021 | 3300009164 | Freshwater Lake | METSYNGYPASKDQAEIKIKSYPVKGTDRKLKCAESVGPLLAAFA |
| Ga0114979_103898541 | 3300009180 | Freshwater Lake | MLKSYNGWPASKDPAEIGIKSYPIRGTNIKIKAAEGCGLLLAEFAAQ |
| Ga0114969_104871043 | 3300009181 | Freshwater Lake | MEISANGWPASKDQAELGIKSYPVPGTGIKLRCAEAVAPLLIGLAAEFHELI |
| Ga0114969_105605083 | 3300009181 | Freshwater Lake | MILTSYNGWTASKDQAEIGIKSYQIPGTQLKIRCAEAVAPLIVG |
| Ga0114969_106298413 | 3300009181 | Freshwater Lake | MTLTSYNGWTASKDQAEIGIKSYQIPGTQLKIRCAEAVAPLIVG |
| Ga0114969_106695161 | 3300009181 | Freshwater Lake | MSELKSYNGWPASKDPAEIGIKSFKVPGTDLKIRCAEKVAPLL |
| Ga0114969_107645761 | 3300009181 | Freshwater Lake | MQTSYNGWPASKEQAEINIKAYKVEGTSLKLRCAEKVAPLL |
| Ga0114976_103054033 | 3300009184 | Freshwater Lake | MKFTSQNGWPASKNRAEIGIESFPVPGTKIKLACA |
| Ga0114964_104059483 | 3300010157 | Freshwater Lake | VESSYNGYPASKDPAAIGVKSYVVQGTDLKLRCAESVGPLLAGFAAEF |
| Ga0114967_101796043 | 3300010160 | Freshwater Lake | MESSANGWPASKDQAEIGIKSYLVPGTGIKLRCAEGVAPLLIGLAAEFHE |
| Ga0133913_111396494 | 3300010885 | Freshwater Lake | MSELKSYNGWPASKDPAEIGIKSFKVPGTDLKIRCAEKVAPLLIG |
| Ga0133913_111721724 | 3300010885 | Freshwater Lake | MSELKSYNGWPASKDPAEIGIKSFKVPGTDLKIRCAEKVAPLLIGLAAEFHETIE |
| Ga0133913_111840131 | 3300010885 | Freshwater Lake | MQISANGWPASKDQAELGIKSYPVPGTAIKLRCAEAVA |
| Ga0133913_129674173 | 3300010885 | Freshwater Lake | VETSANGWPASKNQAELAIKSYPVPGTAIKLRCAEAVAPLLIGLAAEFHE |
| Ga0153800_10051353 | 3300011995 | Freshwater | MLTSYNGWPASKDPEEIGIKNYPVPGTKIKLRCAN |
| Ga0153800_10270301 | 3300011995 | Freshwater | MSELKSYNGWPASKDPAEIGIKSFKVPGTDLKIRCAEKVA |
| Ga0153799_10114471 | 3300012012 | Freshwater | MLTSYNGWPASKDPAEIGIKSYTVPGTNRKLRCAEAVAPLLIGFAA |
| Ga0153799_10301301 | 3300012012 | Freshwater | LLTSYNGWPASKDPAEIGIKSYAVPGTNRKLRCAEAVAPLLVGFAAE |
| Ga0153799_10346641 | 3300012012 | Freshwater | MLTSYNGWPASKDPAEIGIKSYFVPGTKIKLRCAEAVAPLLVG |
| Ga0153805_10401523 | 3300012013 | Surface Ice | MSELKSYNGWPASKDPAEIGIKSFKVPGTDLKIRCAEK |
| Ga0153801_10412591 | 3300012017 | Freshwater | VSQTSYNGWPASKDQAEIGVKPFKVEGTSLKIRCAEKVAPLLIN |
| Ga0153801_10966313 | 3300012017 | Freshwater | METSYNGYPASKNPAEIKIKSYPVHGTDRKLRCAESVG |
| Ga0157498_10054271 | 3300012666 | Freshwater, Surface Ice | MLQSYNGWPASKDPAEIGIKSYPVPGTNRKLRCAEAVAPLLVGFAAE |
| Ga0157498_10679821 | 3300012666 | Freshwater, Surface Ice | MLTSYNGWPASKDPAEIGIKSYPVPGTNRKLRCAEAVAPLL |
| Ga0157627_10175103 | 3300012706 | Freshwater | VSLISYNGWPASKDRAEIGIKSYQVPGCKTKLACAEGAAPLLI |
| Ga0157606_10323863 | 3300012733 | Freshwater | METSYNGYPASKDPEAIKIKSYLVKGTDRKLRCAESVG |
| Ga0164292_104484631 | 3300013005 | Freshwater | MLKSYNGYPASKNPEEIKIKSYPVKGTDRKLRCAESVGPLLAA |
| (restricted) Ga0172374_12842631 | 3300013122 | Freshwater | MLTSYNGWPASKDPAEIGIKNYPVPGTNRKLKCAEAVAP |
| (restricted) Ga0172367_103393703 | 3300013126 | Freshwater | MLTSYNGWPASKDPAEIGIKNYPVPGTNRKLKCAEAVAPLLIG |
| (restricted) Ga0172373_102214651 | 3300013131 | Freshwater | MLTSYNGWPASKDPAEIGIKNYPVPGTNRKLKCAEAVAPLLIGFAAEFHA |
| (restricted) Ga0172372_101521801 | 3300013132 | Freshwater | MLTSYNGWPASKDPAEIGIKNYPVPGTNRKLKCAE |
| Ga0177922_100093151 | 3300013372 | Freshwater | METSYNGWPASKDQAEIGIKSYQVPGTTIKLRCAEAVAPL |
| Ga0177922_101271301 | 3300013372 | Freshwater | VQTSYNGWPASKDQAEIGIKAYKVEGTSLKLRCAEK |
| Ga0177922_102154303 | 3300013372 | Freshwater | MLTSYNGWPASKDPAEIGIKSYAVPGTNRKLRCAEAVAPLLVGFA |
| Ga0177922_105844351 | 3300013372 | Freshwater | MLTSYNGWPASKDPTKIGIENYSVPGTNRKLKCAKKVAPLLIG |
| Ga0177922_108483674 | 3300013372 | Freshwater | VSETSYNGYPASKDPDAIKIRSYPVKGTDRKLRCAESVGPLLA |
| Ga0177922_110454091 | 3300013372 | Freshwater | LLTSYNGWPASKDPAEIGINSYSVPGTKIKLRCAEAV |
| (restricted) Ga0172376_107345002 | 3300014720 | Freshwater | MLTSYNGWPASKDPAEIGINSYPVPGTIRKLRCAEAVAPLLVGFA |
| (restricted) Ga0172376_107522812 | 3300014720 | Freshwater | MLQSYNGWPASKNLAEIGIKSYAVPGTNRKLRCAEAVAPLLVGFAAEFHAL |
| Ga0119960_10487173 | 3300014811 | Aquatic | MKLTSYNGWTASKDQAEIGIKSYAIPGTTLKIRCAEAVAPLDRDWE |
| Ga0181364_10045981 | 3300017701 | Freshwater Lake | MKLTSYNGWTASKDQAEIGIKSYAIPGTTLKIRCAEAVAPL |
| Ga0181364_10131061 | 3300017701 | Freshwater Lake | MLTSYNGWPASKDPAEIGIKSYTVPGTNRKLRCAEAVAPLLVGFAAE |
| Ga0181350_10514541 | 3300017716 | Freshwater Lake | LLTSYNGWPASKEPAEIGIKSYTVPGTNRKLTCAEAVAPLLIGFAAE |
| Ga0181350_10553491 | 3300017716 | Freshwater Lake | MPTTPLKSDNGWPASKDPAEIGIKSYAVKGTTIKLRCAEKVAPLLTGF |
| Ga0181350_10594171 | 3300017716 | Freshwater Lake | LLTSYNGWPASKDPAEIGIKSYPVPGTKIKLRCAEAVAPLLVGFAAEFHALIE |
| Ga0181350_10611353 | 3300017716 | Freshwater Lake | MLTSYNGWPASKDQAEIGIQSYSVPGTLIKLRCAE |
| Ga0181347_10290474 | 3300017722 | Freshwater Lake | MLTSYNGWPASKDPAEIGINSYAVPGTNRKLRCAEAVAPLLIGFAA |
| Ga0181362_10634081 | 3300017723 | Freshwater Lake | MNSYNGWPASKDQAEIGIKAYKVEGTNLKLRCAEKVAP |
| Ga0181362_11030211 | 3300017723 | Freshwater Lake | MQTSYNGWPASKDQAEIGVKPFKVEGTSLKIRCAEKVAPLL |
| Ga0181365_10048336 | 3300017736 | Freshwater Lake | MPTTLKSSNGWPASKDAAEIGIKSYPIPGTSIKVRLAEKAAPLLVALCADFDK |
| Ga0181365_10132731 | 3300017736 | Freshwater Lake | MIPTAGTAIMTTTLKSSNGWPASKDPAVIGIKSYPIPGTSIKIRLA |
| Ga0181365_10157445 | 3300017736 | Freshwater Lake | MLTSYNGWPASKDQAEIGIKSYPVPGTLIKLRCAEKVA |
| Ga0181365_10178081 | 3300017736 | Freshwater Lake | MPNTSLKSDNGWPASKDPAEIGIKSYPVKGTTIKLRCAEKVAPLLVGF |
| Ga0181365_10198841 | 3300017736 | Freshwater Lake | MQNSYNGWPASKEQAEIGVKPFKVEGTNLKIRCAEKVAPLLINFA |
| Ga0181365_11197743 | 3300017736 | Freshwater Lake | LLTSYNGWPASKDPAEIGVENYPVPGTNRKLKCDRKVALLLIGYGGEYRKLIEPI |
| Ga0181365_11250643 | 3300017736 | Freshwater Lake | MPTTLKSSNGWPASKDPALIGIKSYPIPGTSIKVRLAEKAAPLLVALCADFDK |
| Ga0181365_11448772 | 3300017736 | Freshwater Lake | MNSYNGWPASEDQNEIGVKSFPVEGTALKIRCAEKVAPLLI |
| Ga0181365_11614262 | 3300017736 | Freshwater Lake | MLQSYNGWPASKDPAEINIKSYAVPGTNRKLRCAEAVAPLLIGFAAEFHALI |
| Ga0181365_11743051 | 3300017736 | Freshwater Lake | METSYNGYPASKDPKEINIKSYPVRGTDRKLRCAESVGPLLAAF |
| Ga0181356_10695751 | 3300017761 | Freshwater Lake | MKLTSYNGWTASKDQAEIGIKSYAIPGTSLKIRCVEAVAPLL |
| Ga0181356_11581851 | 3300017761 | Freshwater Lake | LLTSYNGWPASKDPAEIGIQNYPVPGTNRKLRCAKAVAPLLIGFAAEFH |
| Ga0181356_11601401 | 3300017761 | Freshwater Lake | MQTSYNGWPASKDQAEIGVKAYKVEGTNLKLRCAEKVA |
| Ga0181356_12415973 | 3300017761 | Freshwater Lake | MLTSYNGWPASKDPTEIGINSYPVPGTNRKLRCAEAVAPLLIGFAAEFHA |
| Ga0181358_10489961 | 3300017774 | Freshwater Lake | MPTTLKSSNGWPASKDPAVIGIKSYPIPGTSIKVRLAEKAAPL |
| Ga0181358_10490434 | 3300017774 | Freshwater Lake | MLTSYNGWPASKDPAEIGINSYAVPGTNRKLRCAEAVAPLLIGFAAEFHALI |
| Ga0181358_10732081 | 3300017774 | Freshwater Lake | MTLTSYNGWTASKDQAEIGIKSYAIPGTQLKIRCAEAVAPLIVG |
| Ga0181358_10772901 | 3300017774 | Freshwater Lake | MQTSYNGWPASKEQAEIGVKPFKVEGTSLKIRCAEKVAPLLINFA |
| Ga0181358_10892443 | 3300017774 | Freshwater Lake | MPTTLKSSNGWPASKDAAEIGIKSYPIPGTSIKVRLAEKAAPLLV |
| Ga0181358_10993471 | 3300017774 | Freshwater Lake | METSYNGYPASKDPAEIGIKSYSVDGTARRLRCAESVGPLLAP |
| Ga0181358_11422721 | 3300017774 | Freshwater Lake | METSYNGYPASKDPAEIGIKSYLVDGTARKLRCAESVGPLLAA |
| Ga0181358_11513981 | 3300017774 | Freshwater Lake | MLTSYNGWPASKDQAEIGIVSIPIEGTKLKVRCAKAV |
| Ga0181357_10444571 | 3300017777 | Freshwater Lake | MPTTSLKSDNGWPASKDTAEIGIKSYAVKGTTIKLRCAEKVAPLLIGFAAE |
| Ga0181357_10527146 | 3300017777 | Freshwater Lake | MPTTLKSSNGWPASKDPAVIGIKSYPIPGTSIKVRLAEKAAPLL |
| Ga0181357_11897421 | 3300017777 | Freshwater Lake | MTLTSYNGWTASKDQAEIGVKSYAIPGTTLKIRCAEAV |
| Ga0181357_12035771 | 3300017777 | Freshwater Lake | MPTTLKSSNGWPASKDPAVIGIKSYPIPGTSIKVRLAEKA |
| Ga0181349_10233276 | 3300017778 | Freshwater Lake | MLTSYNGWPASKDQAEIGIKSYAVPGTAIKLRCAEKVAP |
| Ga0181349_10386694 | 3300017778 | Freshwater Lake | MKLTSYNGWTASKDQAEIGIKSHAIPGTHLKIRCA |
| Ga0181349_10463524 | 3300017778 | Freshwater Lake | MLTSYNGWPASKDPAEIGINSYAVPGTNRKLRCAEAVAPLLIGFA |
| Ga0181349_12472033 | 3300017778 | Freshwater Lake | METSYNGYPASKDPAEIKIKSYPVRGTDRKLRCAE |
| Ga0181349_12681753 | 3300017778 | Freshwater Lake | METSYNGWPASKDQSEIGVKPFKVKGTSLKIRCAE |
| Ga0181349_12849841 | 3300017778 | Freshwater Lake | LLTSYNGWPASKDPAEIGIKSYSVPGTNRKLRCAEAVAP |
| Ga0181346_10443981 | 3300017780 | Freshwater Lake | MPTTLKSSNGWPASKDPAVIGIKSYPIPGTSIKVRLAEKAAPLLVALCADFDK |
| Ga0181346_10499461 | 3300017780 | Freshwater Lake | MLTSYNGWPASKDPAEIGMKSYSVAGTNTKLRCAEAVAPVLIGF |
| Ga0181346_10538304 | 3300017780 | Freshwater Lake | MLTSYNGWPASKDQAEIGVKPFKVEVTSLKIRCAEKVALLL |
| Ga0181346_11885461 | 3300017780 | Freshwater Lake | MLTTYNGWRASKDPAEIGIKSYAVPGTNRKLRCAEA |
| Ga0181346_12250441 | 3300017780 | Freshwater Lake | MLQSYNGWPASKDPAEIGIKSYSVPGTNRKLRCAEAVAPLLVGFAA |
| Ga0181346_12778323 | 3300017780 | Freshwater Lake | MLQSYNGWPASKDPAEIGIENYPVPGTNRKLKCAKKVAPLLI |
| Ga0181348_10253911 | 3300017784 | Freshwater Lake | MTAISYNGCKAIKDQAEIGVKSYAIPGTTLKIRCAEAVAPLI |
| Ga0181348_10868811 | 3300017784 | Freshwater Lake | MPTTLLKSDNGWPASKDPAEIGIKSYPVKGTTIKLRCAEKVAPL |
| Ga0181348_11154383 | 3300017784 | Freshwater Lake | MIPTAGTAIMTTTLKSSNGWPASKDPAVIGIKSYPIPGTSIKIRLAEKAAPLLVAL |
| Ga0181348_11185091 | 3300017784 | Freshwater Lake | MLTSYNGWPASKDQAEIGIKSYPVPGTLIKLRCAEKVAPLLVGFAA |
| Ga0181348_11402341 | 3300017784 | Freshwater Lake | MPSILKSSNGWPASKDPVEIGIKSFKVPGTDLKIRCAEKV |
| Ga0181348_12399863 | 3300017784 | Freshwater Lake | MPTTLKSSNGWPASKDAAEIGIKSYPIPGTSIKVRLAEKAAPLLVALCA |
| Ga0181355_11418451 | 3300017785 | Freshwater Lake | LLTSYNGWPASKDPAEIGIKSYPVPGTKIKLRCAEAVAPLLVGF |
| Ga0181355_12474681 | 3300017785 | Freshwater Lake | LATLKSYNGWPASKEAAEIGIKSYKVPGTDLKIRCAEKVAPLLIGLAAEFHETIE |
| Ga0181355_12951211 | 3300017785 | Freshwater Lake | MPTTLLKSDNGWPASKDPAEIGIKSYPVKGTTIKLRCAA |
| Ga0181359_10011751 | 3300019784 | Freshwater Lake | MQTSYNGWPASKDQAEIGVKPFKVEGTSLKIRCAEKVAPLLINFAKEFNEL |
| Ga0181359_10138075 | 3300019784 | Freshwater Lake | MLTSYNGWPASKDQAEIGVKAYKVEGTSLKLRCAEKVAPLLINFAK |
| Ga0181359_11041513 | 3300019784 | Freshwater Lake | MLTSYNGWPASKDPPEIGIENYPVPGTNRKLKCAKKVA |
| Ga0181359_11709051 | 3300019784 | Freshwater Lake | MLTSYNGWPASKDPAEIGINSYAVPGTNRKLRCAE |
| Ga0211734_103677911 | 3300020159 | Freshwater | METSYNGWPASKDQAEIDVQSYLVPGTDRKLRCAS |
| Ga0211729_103832233 | 3300020172 | Freshwater | MTLTSYNGWTASKDQAEIGIKSYAIPGTQLKIRCAEAVAPLIVGF |
| Ga0194131_102190633 | 3300020193 | Freshwater Lake | MLTSYNGWPASKDPAEIGIKSYAVPGTNRKLRCAEAVAPLLIGFAAEFH |
| Ga0194128_104797193 | 3300020197 | Freshwater Lake | MLTSYNGWPASKDPAEIGIKNYPVPGTNRKLKCAEA |
| Ga0194120_101822131 | 3300020198 | Freshwater Lake | MLTSYNGWPASKDPAEIGIKSYPIPGTNRKLRCAEAVAPL |
| Ga0194121_106387771 | 3300020200 | Freshwater Lake | MLTSYNGWPASKDPAEIGIKSYAVPGTNRKLRCAEAVAPLLIGFAAE |
| Ga0194116_102524751 | 3300020204 | Freshwater Lake | MLTSYNGWPASKDPAEIGIKSYAVPGTNRKLRCAEAVAPL |
| Ga0211731_103587441 | 3300020205 | Freshwater | MISSNGWPASKDKAEIKIKAYPIAGTSIKLQCAEDVAPLLIGFATEFHQLIEPID |
| Ga0211731_104007244 | 3300020205 | Freshwater | MQTSYNGWPASKDQAEIGIKAYKVEGTSLKLRCAEKVAPLLINFAKEFNELI |
| Ga0211731_107830591 | 3300020205 | Freshwater | MTLTSYNGWTASKDQAEIGIKSYAIPGTQLKIRCAEAVAPLI |
| Ga0194132_104229723 | 3300020214 | Freshwater Lake | VLTSYNGWPASKDPAEIGIKSYPIPGTNRKLRCAEAVAPLLI |
| Ga0208600_10200161 | 3300020550 | Freshwater | METSYNGYPASKDPEAIKIKSYPVKGTDRKLRCAE |
| Ga0208486_10651473 | 3300020556 | Freshwater | MQTSYNGWPASKEQAEIGVKPFKVEGTSLKIRCAEKVAPL |
| Ga0181354_10880113 | 3300022190 | Freshwater Lake | MLTSYNGWPASKDPPEIGIENYPVPGTNRKLKCAKKVAPL |
| Ga0181354_11892643 | 3300022190 | Freshwater Lake | MQTSYNGWPASKDQAEIGVKPFKVEGTSLKIRCAEKVAPL |
| Ga0196905_11305603 | 3300022198 | Aqueous | MLTSYNGWPASKDPEEIGIKSYPVPGTNRKLRCAEAV |
| Ga0196901_10612531 | 3300022200 | Aqueous | MLTSYNGWPASKDPAEIGIKSYAVPGTNRKLRCAEAVAPLLVGFAAEF |
| Ga0181351_10681964 | 3300022407 | Freshwater Lake | MPTTLKSSNGWPASKDPAVIGIKSYPIPGTSIKVRLAEKAAPLLVA |
| Ga0181351_11061641 | 3300022407 | Freshwater Lake | MQHTLFSYNGWPASKDQAEIGVKPFKVEGTSLKIRCAEKVAPLLINFAKEFNELI |
| Ga0181351_12154522 | 3300022407 | Freshwater Lake | MLTSYNGWPASKDQVEIGIKSYPVPGTLIKLRCAEKVAPLLVGFAA |
| Ga0212124_101959233 | 3300022553 | Freshwater | VNSYNGWPASKDQAEIGIKSYPVPGTAIKLRCAEKVAPLLIGFAAEFH |
| Ga0214919_1001254414 | 3300023184 | Freshwater | METSANGWPASKDEAELGIKSYLVPGTAIKLRCAEGVAPLLIGLAAEFHALI |
| Ga0209414_10451311 | 3300023301 | Hypersaline | VSLTSYNGYPASKDPAEIGIKSYLIKGTDRKVRAAE |
| Ga0209414_10560931 | 3300023301 | Hypersaline | VSLTSYNGYPASKDPAEIGIKSYLIKGTDRKVRAAESVGH |
| Ga0209414_11324511 | 3300023301 | Hypersaline | LLTSYNGYPASKDPAEIGIKSYLIKGTDRKVRAAE |
| Ga0244775_106889451 | 3300024346 | Estuarine | MLTSYNGWPASKDPAEIGINSYLVPGTKIKLRCAEAVAPLLVGFAAEFHAL |
| Ga0244775_111328061 | 3300024346 | Estuarine | MQTSYNGWPASKEQAEIGVKPFKVEGTSLKIRCAEKVAPLL |
| Ga0244775_112266351 | 3300024346 | Estuarine | MQHTLFSYNGWPASKDQAEIGVKAYKVEGTSLKLRCAEKVAPLLINFA |
| Ga0244775_113446503 | 3300024346 | Estuarine | MPTTTLKSDNGWPASKNPAEIGIKSYLVKGTTIKLRCAEKIAPLLTG |
| Ga0255224_10195533 | 3300024483 | Freshwater | MLTSYNGWPASKDPAEIGIKSYAVPGTNRKLRCAEAVAPLLVGF |
| Ga0256306_11392931 | 3300024560 | Freshwater | MLTSYNGWPASKDPAEIGIKSYAVPGTNRKLRCAEA |
| Ga0255276_11509801 | 3300024570 | Freshwater | MISANGWPASKDRSEIGVKSFEVPGTSGKLACAEAVAPLLIGF |
| Ga0208643_11150211 | 3300025645 | Aqueous | MKSQPLQTSHNGWPASKDQAEIGIKSYPVPGTAIKLRCAEAVAPLLIGLAA |
| Ga0208916_103902361 | 3300025896 | Aqueous | MQSYNGWPASKEQAEIGVKPYKVEGTNLKLRCAEKVAPLLIN |
| Ga0255074_10332293 | 3300027121 | Freshwater | MKLTSYNGWTASKDQAEIGIKSYAIPGTQLKIRCAEAVAPLIVGF |
| Ga0255066_10539841 | 3300027131 | Freshwater | MKLTSYNGWTASKDQAEIGIKSYAIPGTQLKIRCA |
| Ga0255069_10091751 | 3300027134 | Freshwater | MQTSYNGWPASKDPAEIGIKAYKVESSHINLKCAEKVAPLLI |
| Ga0255072_10376031 | 3300027508 | Freshwater | METSYNGYPASKDPAEIKIKSYLVKGTDRKLRCAESVG |
| Ga0255079_10031121 | 3300027601 | Freshwater | MQTSYNGWPASKDQAEIGVKPFKVEGTSLKIRCAEKVAPLLINFAKEFN |
| Ga0255079_10858631 | 3300027601 | Freshwater | MLTSYNGWPASKDPAEIGINSYAVPGTNRKLRCAEAVAPLL |
| Ga0208974_10436141 | 3300027608 | Freshwater Lentic | MLTSYNGWPASKDPAEIGINSYAVPGTNRKLRCAEAVAPLLVGFAAEFHALI |
| Ga0208975_10457591 | 3300027659 | Freshwater Lentic | MPNTTLKSSNGWPASKDPAEIGIKSFKVPGTDLKIRCAEKVAPLL |
| Ga0208975_10794352 | 3300027659 | Freshwater Lentic | VETSANGWPASKDQAELGIKSYPVPGTAIKLRCAEAVAPLLIGLAAEFHEL |
| Ga0208975_11300003 | 3300027659 | Freshwater Lentic | LLTSYNGWPASKDPAEIGIKSYAVPGTNRKLRCAEAVA |
| Ga0208975_11612003 | 3300027659 | Freshwater Lentic | MPTTTLKSSNGWPASKDPAEIGIKSFKVPGTDLKIRCAEKVAPL |
| Ga0209553_12058981 | 3300027688 | Freshwater Lake | MILSSNGWQASQDPKEIGIKSYIVPGTKIKLRCSEGAAPLLVN |
| Ga0209033_10685481 | 3300027697 | Freshwater Lake | MLTSYNGWPASKDPAEIGIKSYAVPGTNRKLRCAEAVA |
| Ga0209443_11710393 | 3300027707 | Freshwater Lake | MLTSYNGWPASKDPAEIGIKSYAVPGTNRKLRCAEAVAPLLVGFAAE |
| Ga0209443_11940863 | 3300027707 | Freshwater Lake | MQTSYNGWPASKEQAEIGVKPFKVEGTNLKLRCAEKVAPLLINFAKEFNE |
| Ga0209443_12418841 | 3300027707 | Freshwater Lake | MLTSYNGWPASKDQAEIGVKSFKVEGTSLKIRCAEKVAPLLINFA |
| Ga0209087_11693411 | 3300027734 | Freshwater Lake | METSYNGYPASKDQAEIKIKSYPVKGTDRKLKCAESVGPLL |
| Ga0209190_10147466 | 3300027736 | Freshwater Lake | MTLTSYNGWTASKDQTEIGIKSYAIPGTQLKIRCAEAVAPLIVGF |
| Ga0209596_12728253 | 3300027754 | Freshwater Lake | MILSSNGWQASQDPEEIGIKSYTVPGTKIKLRCSEGAAPLLV |
| Ga0209596_12793011 | 3300027754 | Freshwater Lake | MEISANGWPASKDQAELGIKSYPVPGTGIKLRCAEAVAPLLIGLAAE |
| Ga0209296_12323623 | 3300027759 | Freshwater Lake | MKLTSYNGWTASKDQAEIGIKSYAIPGTELKIRCAEAVAPLIVGFCK |
| Ga0209088_101886743 | 3300027763 | Freshwater Lake | MTLLSANGWVASKDPNEIGIKSYPVPGTKLKIKCAEHVAPLLVTFAA |
| Ga0209088_102455093 | 3300027763 | Freshwater Lake | MQTSYNGWPASKDQAEIGVKPFEVEGTSLKIRCAEKVAPLLI |
| Ga0209246_101354243 | 3300027785 | Freshwater Lake | MLTSYNGWPASKDPAEIGIKSYAVPGTNRKLRCAEAVAPLLVGFAA |
| Ga0209246_102321013 | 3300027785 | Freshwater Lake | MPTTLKSSNGWPASKDAAEIGIKSYPIPGTSIKVR |
| Ga0209246_102998613 | 3300027785 | Freshwater Lake | MQTSYNGWPASKDQAEIGVKPFKVEGTSLKLRCAEKV |
| Ga0209354_101110794 | 3300027808 | Freshwater Lake | MLTSYNGWPASKDQAEIGVKSFKVEGTSLKIRCAEKVAPLL |
| Ga0209550_103757991 | 3300027892 | Freshwater Lake | MKLTSYNGWTASKDQAEIGIKSHAIPGTHLKIRCAEAVAPLIVG |
| Ga0209668_107713913 | 3300027899 | Freshwater Lake Sediment | MQTSYNGWPASKDQAEIGVKPFKVEGTSLKIRCAEKV |
| Ga0209893_10096131 | 3300027940 | Sand | MLTSYNGWPASKDPAEIGINSYPVPGTNRKLRCAEAVA |
| Ga0209400_12268251 | 3300027963 | Freshwater Lake | MLTSYNGWPASKDQAEIGIKSYPVPGTTIKLRCAEKVA |
| Ga0209401_10898401 | 3300027971 | Freshwater Lake | MLTSYNGWPASKDQAEIGIKSYPVPGTTIKLRCAEKVAP |
| Ga0209401_11190913 | 3300027971 | Freshwater Lake | MISANGWPASKDKAEIGIKSFPVTGTTLKLQCAEAVAPLL |
| Ga0209298_103108593 | 3300027973 | Freshwater Lake | MPTTTLKSDNGWPASIDPAEIGIKSYPVKGTTIKLRCAEKVAPLLVGFAAEFHTTI |
| Ga0209702_101185011 | 3300027976 | Freshwater | VSLTSYNGYPASKDPAEIGIKSYLIKGTDRKVRAAESV |
| Ga0209702_102260453 | 3300027976 | Freshwater | VSLTSYNGYPASKDPAEIGIKSYLIKGTDRKVRAAESVGHLLAA |
| Ga0304730_11846911 | 3300028394 | Freshwater Lake | MISANGWPASKDKAEIGIKAYPVPGSSIKFQCAEAVAPLLIGFAGDFHRL |
| Ga0315293_111908273 | 3300031746 | Sediment | MNKSQNGWDASKVRAEIDIDSFPVPGTSIKLTCNKAVAPLLVGF |
| Ga0315285_103715003 | 3300031885 | Sediment | MLHSSNGWPASKDRAEIGIESFPVPGTKIKLACAKSVAPLLVGFA |
| Ga0315904_114132171 | 3300031951 | Freshwater | MLKSYNGYPASKDPDEIKIKSYPVRGTDRKLRCAE |
| Ga0315274_105019771 | 3300031999 | Sediment | MNKSQNGWDASKVRAEIDIDSFPVPGTTIKLTCNKAVAP |
| Ga0315274_119079251 | 3300031999 | Sediment | VTPNSQNGWTASKIRAEINIDSFPVPGTKIKLTCNKAVAPLLVGFAAEF |
| Ga0315284_116344521 | 3300032053 | Sediment | MLTSYNGWPASKDQAEIAIVSIPIEGTKLKVRCAKAVAPLIAGFC |
| Ga0315903_107152691 | 3300032116 | Freshwater | MISHNGWPASKDRAELGIETFLVPGTKIKLHCAKSVAPLLV |
| Ga0315903_107463953 | 3300032116 | Freshwater | MKLTSYNGWEASAKPESIHVKSYAIPGTTLKIRCAEAVA |
| Ga0315295_111317333 | 3300032156 | Sediment | MQSQNGWTASKVRAEIDIDSFVVPGTSIKLTCNKAVAPLLVGFAAE |
| Ga0335396_100992504 | 3300032462 | Freshwater | MLTSGNGWQASDNQKTIGIKSYRVKGAGIKLRCAQKVAPLLVGFAAR |
| Ga0335396_102141703 | 3300032462 | Freshwater | VSLTSYNGYPASKDPAEIGIKSYLIKGTDRKVRAA |
| Ga0335396_103138051 | 3300032462 | Freshwater | VSLTSYNGYPASKDPAEIGIKSYLIKGTDRKVRAAES |
| Ga0335396_105170531 | 3300032462 | Freshwater | VILTSYNGYPASKDPAEIGIKSYLIKGTDRKVRAAESVGQLLA |
| Ga0334982_0211492_1_111 | 3300033981 | Freshwater | MTLISYNGWPASKDPAEIGIKSYPVPGTKIKLRCAEA |
| Ga0334994_0133859_1296_1412 | 3300033993 | Freshwater | MPTTTLKSSNGWPASKDPAEIDIKSFKVPGTDLKIRCAE |
| Ga0335003_0383099_485_607 | 3300033995 | Freshwater | MQTSYNGWPASKDPDEIRITSYKVEGTNLKLRCAEGCGPLL |
| Ga0334979_0285989_3_116 | 3300033996 | Freshwater | MSLTSYNGYPASKDPAEIGIKSYSVDGTALRLRCASSV |
| Ga0334979_0693523_2_139 | 3300033996 | Freshwater | MQTSYNGWPASKDQAEIGVKPFKVEGTSLKIRCAEKVAPLLINFAK |
| Ga0334995_0686510_2_130 | 3300034062 | Freshwater | METSYNGYPASKDPAEIKIKSYPVKGTDRKLRCAESVGPLLAA |
| Ga0335001_0331783_2_115 | 3300034064 | Freshwater | MLTSYNGWPASKDPAEIGIKSYAVHGTKIKLRCAEAVA |
| Ga0335019_0347254_2_112 | 3300034066 | Freshwater | MSEISYNGWPASKDQAAIGVQPYPVKGTNLKIRCAAG |
| Ga0335019_0664951_468_602 | 3300034066 | Freshwater | MLKSYNGYPASQDPSEINIKSYPVKGTDRKLKCASSVGPLLAAFA |
| Ga0334990_0135448_1215_1340 | 3300034068 | Freshwater | MQTSYNGWPASKEQAEIGVKPFKVEGTSLKIRCAEKVAPLLI |
| Ga0335028_0576755_3_137 | 3300034071 | Freshwater | MLTSYNGWPASKDPAEIGIKSYPVPGTKIKLRCAEAVAPLLVGFA |
| Ga0335028_0722489_376_519 | 3300034071 | Freshwater | MLTSANGWPASEDQAAIGIKSYKVPGTNLKIRCAEKVAPLLVHFAADF |
| Ga0335020_0323689_606_752 | 3300034082 | Freshwater | MQSTLKSYNGYPASKDPAEIKIKAYPVKGTDRKLRCAESVGPLLAAFAA |
| Ga0335010_0320795_1_147 | 3300034092 | Freshwater | MQTSYNGWPASKEQAEIGVKPFKVEGTSLKIRCAEKVAPLLINFAKEFN |
| Ga0335012_0299689_709_816 | 3300034093 | Freshwater | MTLTSYNGWPASKNPAEIGIKSYAVPGTNRKLRCAE |
| Ga0335022_0188397_1096_1245 | 3300034095 | Freshwater | MQTSYNGWPASKEQAEIGVKPFKVEGTSLKIRCAEKVAPLLINFAKEFNE |
| Ga0335022_0605408_408_551 | 3300034095 | Freshwater | METSYNGYPASKDPEAIKIKSYLVKGTDRKLRCAESVGPLLAAFAAEF |
| Ga0335022_0694837_2_145 | 3300034095 | Freshwater | MQTSYNGWPASKDQAEIGVKPFKVEGTNLKIRCAEKVAPLLINFAKEF |
| Ga0335027_0374297_2_145 | 3300034101 | Freshwater | METSYNGYPASKDPEAIKIKSYRVRGTDRKLRCAESVGPLLAAFAAEF |
| Ga0335027_0389702_3_116 | 3300034101 | Freshwater | MQTSYNGWPASKDPEEIRITSYKVEGTNLKLRCAEGCG |
| Ga0335036_0122054_1742_1885 | 3300034106 | Freshwater | MPTTTLKSSNGWPASKDPAEIGIKSFKVPGTDLKIRCAEKVAPLLIGL |
| Ga0335036_0233221_1123_1254 | 3300034106 | Freshwater | MQTSYNGWPASKEQAEIGVKPFKVEGTSLKIRCAEKVAPLLINF |
| Ga0335050_0392143_498_626 | 3300034108 | Freshwater | METSYNGYPASKDPDAIKIKSYLVKGTDRKLRCAESVGPLLAA |
| Ga0335068_0478665_470_580 | 3300034116 | Freshwater | MQTSYNGWPASKEQAEIGVKPFKVEGTSLKIRCAEKV |
| Ga0335054_0062266_3_119 | 3300034119 | Freshwater | METSYNGYPASKDPEAIKIKSYLVKGTDRKLRCAESVGP |
| Ga0335054_0186319_3_185 | 3300034119 | Freshwater | MSNLKSSNGWPASKDPAEIDIKSFKVPGTDLKIRCAEKVAPLLIGLAAEFHETIEPIDKG |
| Ga0335060_0207864_981_1109 | 3300034122 | Freshwater | MQTSYNGWPASKEQAEIGVKPFKVEGTSLKIRCAEKVAPLLIN |
| Ga0335061_0046359_2183_2323 | 3300034168 | Freshwater | MSLTSYNGYPASKDPAEIGIKSYSVDGTALRLRCASSVGPLLAAFAA |
| Ga0335061_0076354_1652_1783 | 3300034168 | Freshwater | MQTSYNGWPASKDQAEISVKPFKVEGTSLKIRCAEKVAPLLINF |
| Ga0335052_0418551_587_709 | 3300034279 | Freshwater | MLKSYNGYPASKDPNEIKIKAYPVKGTDRKLRCAESVGPLL |
| Ga0334997_0614210_3_170 | 3300034280 | Freshwater | MKSQPLQTSYNGWPASKDQTEIGVKPFKVEGTSLKIRCAEKVAPLLINFAKEFNEL |
| Ga0335013_0505837_2_130 | 3300034284 | Freshwater | MQTSYNGWPASKDQAEIGVKPFKVEGTSLKLRCAEKVAPLLIN |
| ⦗Top⦘ |