| Basic Information | |
|---|---|
| Family ID | F013035 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 275 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MFLAAFTSALQAYPQAVHTKRAWLSRDFASTCPHAEQRWLVNAG |
| Number of Associated Samples | 223 |
| Number of Associated Scaffolds | 275 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.55 % |
| % of genes near scaffold ends (potentially truncated) | 91.27 % |
| % of genes from short scaffolds (< 2000 bps) | 85.82 % |
| Associated GOLD sequencing projects | 211 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.636 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.273 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.909 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.909 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.17% β-sheet: 0.00% Coil/Unstructured: 45.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 275 Family Scaffolds |
|---|---|---|
| PF01061 | ABC2_membrane | 2.18 |
| PF02653 | BPD_transp_2 | 2.18 |
| PF13407 | Peripla_BP_4 | 2.18 |
| PF08281 | Sigma70_r4_2 | 1.82 |
| PF00106 | adh_short | 1.82 |
| PF01939 | NucS | 1.45 |
| PF09349 | OHCU_decarbox | 1.45 |
| PF00866 | Ring_hydroxyl_B | 1.09 |
| PF10979 | DUF2786 | 1.09 |
| PF00232 | Glyco_hydro_1 | 1.09 |
| PF00072 | Response_reg | 1.09 |
| PF00528 | BPD_transp_1 | 1.09 |
| PF01144 | CoA_trans | 1.09 |
| PF01039 | Carboxyl_trans | 1.09 |
| PF00196 | GerE | 0.73 |
| PF13561 | adh_short_C2 | 0.73 |
| PF01329 | Pterin_4a | 0.73 |
| PF00155 | Aminotran_1_2 | 0.73 |
| PF13472 | Lipase_GDSL_2 | 0.73 |
| PF02771 | Acyl-CoA_dh_N | 0.73 |
| PF01262 | AlaDh_PNT_C | 0.73 |
| PF00005 | ABC_tran | 0.73 |
| PF01571 | GCV_T | 0.73 |
| PF06089 | Asparaginase_II | 0.73 |
| PF01960 | ArgJ | 0.73 |
| PF00756 | Esterase | 0.73 |
| PF03561 | Allantoicase | 0.73 |
| PF00378 | ECH_1 | 0.73 |
| PF02254 | TrkA_N | 0.73 |
| PF00206 | Lyase_1 | 0.73 |
| PF00440 | TetR_N | 0.73 |
| PF01189 | Methyltr_RsmB-F | 0.73 |
| PF07883 | Cupin_2 | 0.73 |
| PF00534 | Glycos_transf_1 | 0.73 |
| PF12705 | PDDEXK_1 | 0.73 |
| PF00041 | fn3 | 0.73 |
| PF01435 | Peptidase_M48 | 0.73 |
| PF00248 | Aldo_ket_red | 0.73 |
| PF01796 | OB_aCoA_assoc | 0.36 |
| PF02627 | CMD | 0.36 |
| PF05690 | ThiG | 0.36 |
| PF01343 | Peptidase_S49 | 0.36 |
| PF03795 | YCII | 0.36 |
| PF01979 | Amidohydro_1 | 0.36 |
| PF04343 | DUF488 | 0.36 |
| PF00578 | AhpC-TSA | 0.36 |
| PF13385 | Laminin_G_3 | 0.36 |
| PF01315 | Ald_Xan_dh_C | 0.36 |
| PF03404 | Mo-co_dimer | 0.36 |
| PF01471 | PG_binding_1 | 0.36 |
| PF02803 | Thiolase_C | 0.36 |
| PF05893 | LuxC | 0.36 |
| PF02133 | Transp_cyt_pur | 0.36 |
| PF00171 | Aldedh | 0.36 |
| PF13193 | AMP-binding_C | 0.36 |
| PF02597 | ThiS | 0.36 |
| PF03450 | CO_deh_flav_C | 0.36 |
| PF02739 | 5_3_exonuc_N | 0.36 |
| PF13411 | MerR_1 | 0.36 |
| PF00745 | GlutR_dimer | 0.36 |
| PF08245 | Mur_ligase_M | 0.36 |
| PF01557 | FAA_hydrolase | 0.36 |
| PF06325 | PrmA | 0.36 |
| PF12399 | BCA_ABC_TP_C | 0.36 |
| PF02423 | OCD_Mu_crystall | 0.36 |
| PF00696 | AA_kinase | 0.36 |
| PF01656 | CbiA | 0.36 |
| PF13532 | 2OG-FeII_Oxy_2 | 0.36 |
| PF02547 | Queuosine_synth | 0.36 |
| PF08669 | GCV_T_C | 0.36 |
| PF01385 | OrfB_IS605 | 0.36 |
| PF00185 | OTCace | 0.36 |
| PF02129 | Peptidase_S15 | 0.36 |
| PF12706 | Lactamase_B_2 | 0.36 |
| PF01926 | MMR_HSR1 | 0.36 |
| PF12840 | HTH_20 | 0.36 |
| PF00391 | PEP-utilizers | 0.36 |
| PF09594 | GT87 | 0.36 |
| PF04116 | FA_hydroxylase | 0.36 |
| PF00733 | Asn_synthase | 0.36 |
| PF14588 | YjgF_endoribonc | 0.36 |
| PF08353 | MurT_C | 0.36 |
| PF02909 | TetR_C_1 | 0.36 |
| PF00293 | NUDIX | 0.36 |
| PF00583 | Acetyltransf_1 | 0.36 |
| PF05222 | AlaDh_PNT_N | 0.36 |
| PF00903 | Glyoxalase | 0.36 |
| PF02965 | Met_synt_B12 | 0.36 |
| PF01738 | DLH | 0.36 |
| PF03824 | NicO | 0.36 |
| PF00486 | Trans_reg_C | 0.36 |
| PF00676 | E1_dh | 0.36 |
| PF00113 | Enolase_C | 0.36 |
| PF01169 | UPF0016 | 0.36 |
| PF13692 | Glyco_trans_1_4 | 0.36 |
| PF02784 | Orn_Arg_deC_N | 0.36 |
| PF02595 | Gly_kinase | 0.36 |
| PF11716 | MDMPI_N | 0.36 |
| PF10974 | DUF2804 | 0.36 |
| PF08044 | DUF1707 | 0.36 |
| PF07690 | MFS_1 | 0.36 |
| PF03773 | ArsP_1 | 0.36 |
| PF02589 | LUD_dom | 0.36 |
| PF05138 | PaaA_PaaC | 0.36 |
| PF09130 | DUF1932 | 0.36 |
| PF01042 | Ribonuc_L-PSP | 0.36 |
| PF01243 | Putative_PNPOx | 0.36 |
| PF04261 | Dyp_perox | 0.36 |
| PF14561 | TPR_20 | 0.36 |
| PF00266 | Aminotran_5 | 0.36 |
| PF07905 | PucR | 0.36 |
| PF01300 | Sua5_yciO_yrdC | 0.36 |
| PF00589 | Phage_integrase | 0.36 |
| PF05175 | MTS | 0.36 |
| PF02565 | RecO_C | 0.36 |
| PF00069 | Pkinase | 0.36 |
| PF02738 | MoCoBD_1 | 0.36 |
| PF07282 | OrfB_Zn_ribbon | 0.36 |
| PF02913 | FAD-oxidase_C | 0.36 |
| PF13419 | HAD_2 | 0.36 |
| PF00278 | Orn_DAP_Arg_deC | 0.36 |
| COG ID | Name | Functional Category | % Frequency in 275 Family Scaffolds |
|---|---|---|---|
| COG1637 | Endonuclease NucS, RecB family | Replication, recombination and repair [L] | 1.45 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.45 |
| COG1788 | Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit | Lipid transport and metabolism [I] | 1.09 |
| COG5517 | 3-phenylpropionate/cinnamic acid dioxygenase, small subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.09 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 1.09 |
| COG4670 | Acyl CoA:acetate/3-ketoacid CoA transferase | Lipid transport and metabolism [I] | 1.09 |
| COG2723 | Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase | Carbohydrate transport and metabolism [G] | 1.09 |
| COG2057 | Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit | Lipid transport and metabolism [I] | 1.09 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 1.09 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 1.09 |
| COG2154 | Pterin-4a-carbinolamine dehydratase | Coenzyme transport and metabolism [H] | 0.73 |
| COG2508 | DNA-binding transcriptional regulator, PucR/PutR family | Transcription [K] | 0.73 |
| COG1364 | Glutamate N-acetyltransferase (ornithine transacetylase) | Amino acid transport and metabolism [E] | 0.73 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.73 |
| COG1166 | Arginine decarboxylase (spermidine biosynthesis) | Amino acid transport and metabolism [E] | 0.73 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.73 |
| COG4266 | Allantoicase | Nucleotide transport and metabolism [F] | 0.73 |
| COG4448 | L-asparaginase II | Amino acid transport and metabolism [E] | 0.73 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.73 |
| COG0144 | 16S rRNA C967 or C1407 C5-methylase, RsmB/RsmF family | Translation, ribosomal structure and biogenesis [J] | 0.73 |
| COG0019 | Diaminopimelate decarboxylase | Amino acid transport and metabolism [E] | 0.73 |
| COG2119 | Putative Ca2+/H+ antiporter, TMEM165/GDT1 family | General function prediction only [R] | 0.36 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.36 |
| COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 0.36 |
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 0.36 |
| COG0214 | Pyridoxal 5'-phosphate synthase subunit PdxS | Coenzyme transport and metabolism [H] | 0.36 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.36 |
| COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 0.36 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.36 |
| COG2837 | Periplasmic deferrochelatase/peroxidase EfeB | Inorganic ion transport and metabolism [P] | 0.36 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.36 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.36 |
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 0.36 |
| COG3396 | 1,2-phenylacetyl-CoA epoxidase, catalytic subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.36 |
| COG3897 | Protein N-terminal and lysine N-methylase, NNT1/EFM7 family | Posttranslational modification, protein turnover, chaperones [O] | 0.36 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.36 |
| COG0148 | Enolase | Carbohydrate transport and metabolism [G] | 0.36 |
| COG1381 | Recombinational DNA repair protein RecO (RecF pathway) | Replication, recombination and repair [L] | 0.36 |
| COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 0.36 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.36 |
| COG0675 | Transposase | Mobilome: prophages, transposons [X] | 0.36 |
| COG0701 | Uncharacterized membrane protein YraQ, UPF0718 family | Function unknown [S] | 0.36 |
| COG0769 | UDP-N-acetylmuramyl tripeptide synthase | Cell wall/membrane/envelope biogenesis [M] | 0.36 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.36 |
| COG0809 | S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine synthetase) | Translation, ribosomal structure and biogenesis [J] | 0.36 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.36 |
| COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 0.36 |
| COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 0.36 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.36 |
| COG1410 | Methionine synthase I, cobalamin-binding domain | Amino acid transport and metabolism [E] | 0.36 |
| COG1545 | Uncharacterized OB-fold protein, contains Zn-ribbon domain | General function prediction only [R] | 0.36 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.36 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.36 |
| COG1929 | Glycerate kinase | Carbohydrate transport and metabolism [G] | 0.36 |
| COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 0.36 |
| COG2022 | Thiazole synthase ThiGH, ThiG subunit (thiamin biosynthesis) | Coenzyme transport and metabolism [H] | 0.36 |
| COG0373 | Glutamyl-tRNA reductase | Coenzyme transport and metabolism [H] | 0.36 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.36 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.00 % |
| Unclassified | root | N/A | 11.64 % |
| Planomonospora | genus | Planomonospora | 0.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_106620986 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300004479|Ga0062595_101896488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 571 | Open in IMG/M |
| 3300005355|Ga0070671_100130223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2119 | Open in IMG/M |
| 3300005356|Ga0070674_100064439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2568 | Open in IMG/M |
| 3300005434|Ga0070709_10026277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3449 | Open in IMG/M |
| 3300005435|Ga0070714_100620589 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300005435|Ga0070714_101576117 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300005435|Ga0070714_101653024 | Not Available | 626 | Open in IMG/M |
| 3300005436|Ga0070713_100267148 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
| 3300005436|Ga0070713_101085193 | Not Available | 773 | Open in IMG/M |
| 3300005437|Ga0070710_10168448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1363 | Open in IMG/M |
| 3300005437|Ga0070710_10302988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1043 | Open in IMG/M |
| 3300005439|Ga0070711_101448160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 598 | Open in IMG/M |
| 3300005445|Ga0070708_101689612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 589 | Open in IMG/M |
| 3300005455|Ga0070663_100229574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1461 | Open in IMG/M |
| 3300005466|Ga0070685_11467524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 525 | Open in IMG/M |
| 3300005537|Ga0070730_10296957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1059 | Open in IMG/M |
| 3300005556|Ga0066707_10858745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 558 | Open in IMG/M |
| 3300005577|Ga0068857_100251423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1620 | Open in IMG/M |
| 3300005577|Ga0068857_102196887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 542 | Open in IMG/M |
| 3300005602|Ga0070762_10097496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1696 | Open in IMG/M |
| 3300005618|Ga0068864_101043225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 812 | Open in IMG/M |
| 3300005718|Ga0068866_11067806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 577 | Open in IMG/M |
| 3300005834|Ga0068851_10093741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1585 | Open in IMG/M |
| 3300005842|Ga0068858_100521913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1148 | Open in IMG/M |
| 3300006028|Ga0070717_11059464 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300006049|Ga0075417_10317767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 758 | Open in IMG/M |
| 3300006059|Ga0075017_100199227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1448 | Open in IMG/M |
| 3300006163|Ga0070715_10488470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 702 | Open in IMG/M |
| 3300006163|Ga0070715_10558923 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300006173|Ga0070716_100030608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2922 | Open in IMG/M |
| 3300006358|Ga0068871_100079321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2716 | Open in IMG/M |
| 3300006578|Ga0074059_11759359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 578 | Open in IMG/M |
| 3300006800|Ga0066660_11031993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 658 | Open in IMG/M |
| 3300006806|Ga0079220_10578989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. SID12488 | 791 | Open in IMG/M |
| 3300006845|Ga0075421_102143404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 592 | Open in IMG/M |
| 3300006914|Ga0075436_100380495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1021 | Open in IMG/M |
| 3300009038|Ga0099829_10025649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4128 | Open in IMG/M |
| 3300009038|Ga0099829_10888306 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300009088|Ga0099830_10762121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 798 | Open in IMG/M |
| 3300009088|Ga0099830_10817132 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300009090|Ga0099827_10377104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1210 | Open in IMG/M |
| 3300009090|Ga0099827_10928521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 754 | Open in IMG/M |
| 3300009090|Ga0099827_11119686 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300009090|Ga0099827_11532891 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300009093|Ga0105240_12620024 | Not Available | 521 | Open in IMG/M |
| 3300009137|Ga0066709_100061630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4330 | Open in IMG/M |
| 3300009137|Ga0066709_101973182 | Not Available | 809 | Open in IMG/M |
| 3300009137|Ga0066709_103088935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kibdelosporangium → Kibdelosporangium banguiense | 609 | Open in IMG/M |
| 3300009143|Ga0099792_10923083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 579 | Open in IMG/M |
| 3300009520|Ga0116214_1240850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 686 | Open in IMG/M |
| 3300009524|Ga0116225_1034248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2504 | Open in IMG/M |
| 3300009665|Ga0116135_1077874 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300009683|Ga0116224_10494779 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300009698|Ga0116216_10523407 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300009698|Ga0116216_10858351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kibdelosporangium → Kibdelosporangium banguiense | 543 | Open in IMG/M |
| 3300009826|Ga0123355_10300746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2188 | Open in IMG/M |
| 3300010048|Ga0126373_12061507 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300010159|Ga0099796_10161878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 887 | Open in IMG/M |
| 3300010337|Ga0134062_10277693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 787 | Open in IMG/M |
| 3300010360|Ga0126372_11437335 | Not Available | 723 | Open in IMG/M |
| 3300010360|Ga0126372_12664335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 552 | Open in IMG/M |
| 3300010361|Ga0126378_10131650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2521 | Open in IMG/M |
| 3300010361|Ga0126378_10953633 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300010366|Ga0126379_12155588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 659 | Open in IMG/M |
| 3300010371|Ga0134125_11895939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 648 | Open in IMG/M |
| 3300010373|Ga0134128_10275993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1884 | Open in IMG/M |
| 3300010373|Ga0134128_11610440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 715 | Open in IMG/M |
| 3300010376|Ga0126381_100947986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1240 | Open in IMG/M |
| 3300010376|Ga0126381_105086035 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300010379|Ga0136449_101823729 | Planomonospora → Planomonospora venezuelensis | 909 | Open in IMG/M |
| 3300010379|Ga0136449_102599254 | Not Available | 722 | Open in IMG/M |
| 3300010396|Ga0134126_11487116 | Not Available | 747 | Open in IMG/M |
| 3300010397|Ga0134124_10051141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 3475 | Open in IMG/M |
| 3300010401|Ga0134121_10459852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1163 | Open in IMG/M |
| 3300010866|Ga0126344_1018552 | Not Available | 851 | Open in IMG/M |
| 3300010869|Ga0126359_1257263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 589 | Open in IMG/M |
| 3300010876|Ga0126361_10418628 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300010880|Ga0126350_10028733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1523 | Open in IMG/M |
| 3300011106|Ga0151489_1433954 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300011107|Ga0151490_1793703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1282 | Open in IMG/M |
| 3300012096|Ga0137389_10123289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2091 | Open in IMG/M |
| 3300012189|Ga0137388_10779244 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300012199|Ga0137383_10030404 | All Organisms → cellular organisms → Bacteria | 3788 | Open in IMG/M |
| 3300012199|Ga0137383_10302889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1170 | Open in IMG/M |
| 3300012200|Ga0137382_10371666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1005 | Open in IMG/M |
| 3300012201|Ga0137365_10018327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 5464 | Open in IMG/M |
| 3300012206|Ga0137380_10377018 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300012207|Ga0137381_10428880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1154 | Open in IMG/M |
| 3300012208|Ga0137376_11633686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
| 3300012209|Ga0137379_10378241 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300012210|Ga0137378_10621333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 991 | Open in IMG/M |
| 3300012478|Ga0157328_1010159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kibdelosporangium → Kibdelosporangium banguiense | 646 | Open in IMG/M |
| 3300012482|Ga0157318_1039166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kibdelosporangium → Kibdelosporangium banguiense | 500 | Open in IMG/M |
| 3300012496|Ga0157353_1008332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 810 | Open in IMG/M |
| 3300012507|Ga0157342_1003904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1300 | Open in IMG/M |
| 3300012515|Ga0157338_1015499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kibdelosporangium → Kibdelosporangium banguiense | 832 | Open in IMG/M |
| 3300012957|Ga0164303_11482601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 511 | Open in IMG/M |
| 3300012960|Ga0164301_10464810 | Not Available | 903 | Open in IMG/M |
| 3300012961|Ga0164302_11850049 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300012988|Ga0164306_10041950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2712 | Open in IMG/M |
| 3300013100|Ga0157373_10035516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3578 | Open in IMG/M |
| 3300014162|Ga0181538_10004401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 13188 | Open in IMG/M |
| 3300014497|Ga0182008_10081856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1589 | Open in IMG/M |
| 3300015373|Ga0132257_103630209 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300016319|Ga0182033_10174421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1685 | Open in IMG/M |
| 3300016319|Ga0182033_10907138 | Not Available | 780 | Open in IMG/M |
| 3300016341|Ga0182035_10198567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 1585 | Open in IMG/M |
| 3300016357|Ga0182032_10452009 | Not Available | 1048 | Open in IMG/M |
| 3300016357|Ga0182032_10972091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 724 | Open in IMG/M |
| 3300016371|Ga0182034_10503385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1011 | Open in IMG/M |
| 3300016445|Ga0182038_10228013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1484 | Open in IMG/M |
| 3300016445|Ga0182038_10262511 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
| 3300016445|Ga0182038_10346847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1229 | Open in IMG/M |
| 3300017821|Ga0187812_1000533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13409 | Open in IMG/M |
| 3300017926|Ga0187807_1249023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 582 | Open in IMG/M |
| 3300017928|Ga0187806_1012993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2350 | Open in IMG/M |
| 3300017932|Ga0187814_10001246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus | 9661 | Open in IMG/M |
| 3300017932|Ga0187814_10392656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300017933|Ga0187801_10013032 | Not Available | 2747 | Open in IMG/M |
| 3300017937|Ga0187809_10439453 | Not Available | 503 | Open in IMG/M |
| 3300017943|Ga0187819_10331248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 881 | Open in IMG/M |
| 3300017994|Ga0187822_10196963 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium ADurb.Bin126 | 670 | Open in IMG/M |
| 3300018001|Ga0187815_10431621 | Not Available | 562 | Open in IMG/M |
| 3300018006|Ga0187804_10022103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2328 | Open in IMG/M |
| 3300018060|Ga0187765_10215993 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300018089|Ga0187774_11236549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 537 | Open in IMG/M |
| 3300018431|Ga0066655_10393443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 914 | Open in IMG/M |
| 3300018482|Ga0066669_10265044 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300018482|Ga0066669_10954704 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300020081|Ga0206354_10221654 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300020081|Ga0206354_10660423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 816 | Open in IMG/M |
| 3300020082|Ga0206353_10065552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 738 | Open in IMG/M |
| 3300020082|Ga0206353_10102774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kibdelosporangium → Kibdelosporangium banguiense | 1369 | Open in IMG/M |
| 3300020579|Ga0210407_10916952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 671 | Open in IMG/M |
| 3300020580|Ga0210403_10469553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1024 | Open in IMG/M |
| 3300020581|Ga0210399_11071905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 646 | Open in IMG/M |
| 3300021171|Ga0210405_10254134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1391 | Open in IMG/M |
| 3300021178|Ga0210408_11272397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 559 | Open in IMG/M |
| 3300021180|Ga0210396_10327255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1354 | Open in IMG/M |
| 3300021405|Ga0210387_10992834 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300021407|Ga0210383_10285614 | Not Available | 1418 | Open in IMG/M |
| 3300021407|Ga0210383_10466181 | Not Available | 1090 | Open in IMG/M |
| 3300021420|Ga0210394_10969083 | Not Available | 738 | Open in IMG/M |
| 3300021475|Ga0210392_10763190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 721 | Open in IMG/M |
| 3300021479|Ga0210410_10522007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1059 | Open in IMG/M |
| 3300021479|Ga0210410_10523405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1058 | Open in IMG/M |
| 3300022467|Ga0224712_10358247 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300022533|Ga0242662_10044591 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300022533|Ga0242662_10238517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 586 | Open in IMG/M |
| 3300022840|Ga0224549_1000107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8995 | Open in IMG/M |
| 3300024222|Ga0247691_1009999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1564 | Open in IMG/M |
| 3300025414|Ga0208935_1036442 | Not Available | 654 | Open in IMG/M |
| 3300025898|Ga0207692_10715914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 650 | Open in IMG/M |
| 3300025898|Ga0207692_11169873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
| 3300025906|Ga0207699_10190061 | All Organisms → cellular organisms → Archaea | 1385 | Open in IMG/M |
| 3300025910|Ga0207684_10627105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 917 | Open in IMG/M |
| 3300025917|Ga0207660_10408644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1094 | Open in IMG/M |
| 3300025920|Ga0207649_10641748 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300025921|Ga0207652_10752240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 867 | Open in IMG/M |
| 3300025924|Ga0207694_10734540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 833 | Open in IMG/M |
| 3300025926|Ga0207659_10487217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1042 | Open in IMG/M |
| 3300025928|Ga0207700_10016567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4900 | Open in IMG/M |
| 3300025928|Ga0207700_10504174 | Not Available | 1071 | Open in IMG/M |
| 3300025928|Ga0207700_10935825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 776 | Open in IMG/M |
| 3300025932|Ga0207690_10853702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 754 | Open in IMG/M |
| 3300025939|Ga0207665_10366373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1091 | Open in IMG/M |
| 3300025949|Ga0207667_10338769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1535 | Open in IMG/M |
| 3300026067|Ga0207678_10052624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3511 | Open in IMG/M |
| 3300026088|Ga0207641_11965722 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300026142|Ga0207698_11124193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 799 | Open in IMG/M |
| 3300026285|Ga0209438_1157113 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300027071|Ga0209214_1002698 | Not Available | 1777 | Open in IMG/M |
| 3300027662|Ga0208565_1143818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 698 | Open in IMG/M |
| 3300027696|Ga0208696_1000841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 19402 | Open in IMG/M |
| 3300027725|Ga0209178_1204135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kibdelosporangium → Kibdelosporangium banguiense | 701 | Open in IMG/M |
| 3300027783|Ga0209448_10078010 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300027787|Ga0209074_10215109 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300027846|Ga0209180_10532110 | Not Available | 656 | Open in IMG/M |
| 3300027853|Ga0209274_10363027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 747 | Open in IMG/M |
| 3300027854|Ga0209517_10288696 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300027869|Ga0209579_10530286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 639 | Open in IMG/M |
| 3300027908|Ga0209006_10159222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinomycetospora → Actinomycetospora endophytica | 1978 | Open in IMG/M |
| 3300028146|Ga0247682_1056395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kibdelosporangium → Kibdelosporangium banguiense | 711 | Open in IMG/M |
| 3300028653|Ga0265323_10081643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura hibisca | 1091 | Open in IMG/M |
| 3300028742|Ga0302220_10059411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1579 | Open in IMG/M |
| 3300028747|Ga0302219_10142446 | Not Available | 916 | Open in IMG/M |
| 3300028789|Ga0302232_10076806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1729 | Open in IMG/M |
| 3300028789|Ga0302232_10530624 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300028807|Ga0307305_10307368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 721 | Open in IMG/M |
| 3300028877|Ga0302235_10299491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 695 | Open in IMG/M |
| 3300029944|Ga0311352_10892139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 689 | Open in IMG/M |
| 3300029951|Ga0311371_10114275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 4249 | Open in IMG/M |
| 3300030007|Ga0311338_10168101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 2579 | Open in IMG/M |
| 3300030056|Ga0302181_10002288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13683 | Open in IMG/M |
| 3300030058|Ga0302179_10000938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 18217 | Open in IMG/M |
| 3300030520|Ga0311372_10009125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 22073 | Open in IMG/M |
| 3300030524|Ga0311357_10139680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2402 | Open in IMG/M |
| 3300030706|Ga0310039_10100409 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300030707|Ga0310038_10200333 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300030707|Ga0310038_10235987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 853 | Open in IMG/M |
| 3300030738|Ga0265462_11332613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 653 | Open in IMG/M |
| 3300031234|Ga0302325_11172893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1025 | Open in IMG/M |
| 3300031236|Ga0302324_100007348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 23457 | Open in IMG/M |
| 3300031474|Ga0170818_113889683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 930 | Open in IMG/M |
| 3300031543|Ga0318516_10235285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Frankia coriariae | 1059 | Open in IMG/M |
| 3300031543|Ga0318516_10621753 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300031543|Ga0318516_10869366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
| 3300031544|Ga0318534_10104023 | All Organisms → cellular organisms → Bacteria | 1627 | Open in IMG/M |
| 3300031546|Ga0318538_10070608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1753 | Open in IMG/M |
| 3300031572|Ga0318515_10290844 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300031640|Ga0318555_10365948 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300031640|Ga0318555_10499277 | Not Available | 660 | Open in IMG/M |
| 3300031640|Ga0318555_10797226 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300031682|Ga0318560_10644211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 573 | Open in IMG/M |
| 3300031708|Ga0310686_108966488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans flavus | 906 | Open in IMG/M |
| 3300031736|Ga0318501_10074738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1645 | Open in IMG/M |
| 3300031744|Ga0306918_10978413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 658 | Open in IMG/M |
| 3300031747|Ga0318502_10344136 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300031747|Ga0318502_10737063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 596 | Open in IMG/M |
| 3300031751|Ga0318494_10538663 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300031754|Ga0307475_10545790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 930 | Open in IMG/M |
| 3300031769|Ga0318526_10013514 | All Organisms → cellular organisms → Bacteria | 2710 | Open in IMG/M |
| 3300031769|Ga0318526_10322589 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300031778|Ga0318498_10463855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Candidatus Frankia californiensis | 560 | Open in IMG/M |
| 3300031782|Ga0318552_10164130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1119 | Open in IMG/M |
| 3300031798|Ga0318523_10025475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2630 | Open in IMG/M |
| 3300031799|Ga0318565_10535417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kibdelosporangium → Kibdelosporangium banguiense | 564 | Open in IMG/M |
| 3300031831|Ga0318564_10206238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 874 | Open in IMG/M |
| 3300031846|Ga0318512_10616933 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300031860|Ga0318495_10206352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 884 | Open in IMG/M |
| 3300031879|Ga0306919_10850142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 700 | Open in IMG/M |
| 3300031894|Ga0318522_10097833 | Not Available | 1085 | Open in IMG/M |
| 3300031894|Ga0318522_10378691 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300031896|Ga0318551_10047244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2158 | Open in IMG/M |
| 3300031896|Ga0318551_10283092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 931 | Open in IMG/M |
| 3300031897|Ga0318520_10614390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 676 | Open in IMG/M |
| 3300031912|Ga0306921_10974684 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300031942|Ga0310916_10169102 | All Organisms → cellular organisms → Bacteria | 1815 | Open in IMG/M |
| 3300031947|Ga0310909_10627379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 897 | Open in IMG/M |
| 3300031995|Ga0307409_101429895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 718 | Open in IMG/M |
| 3300032001|Ga0306922_10438414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1397 | Open in IMG/M |
| 3300032001|Ga0306922_10813188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 976 | Open in IMG/M |
| 3300032001|Ga0306922_11723914 | Not Available | 619 | Open in IMG/M |
| 3300032008|Ga0318562_10029164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 2930 | Open in IMG/M |
| 3300032035|Ga0310911_10774128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 555 | Open in IMG/M |
| 3300032042|Ga0318545_10202016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 711 | Open in IMG/M |
| 3300032043|Ga0318556_10083917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1594 | Open in IMG/M |
| 3300032052|Ga0318506_10340050 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300032055|Ga0318575_10010070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 3615 | Open in IMG/M |
| 3300032055|Ga0318575_10372227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 724 | Open in IMG/M |
| 3300032059|Ga0318533_10865148 | Not Available | 663 | Open in IMG/M |
| 3300032065|Ga0318513_10150833 | Not Available | 1109 | Open in IMG/M |
| 3300032067|Ga0318524_10482601 | Not Available | 650 | Open in IMG/M |
| 3300032067|Ga0318524_10764359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 511 | Open in IMG/M |
| 3300032068|Ga0318553_10716528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium | 523 | Open in IMG/M |
| 3300032074|Ga0308173_11634770 | Not Available | 606 | Open in IMG/M |
| 3300032076|Ga0306924_10023381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 6602 | Open in IMG/M |
| 3300032090|Ga0318518_10584172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Candidatus Frankia californiensis | 570 | Open in IMG/M |
| 3300032160|Ga0311301_11816722 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300032174|Ga0307470_11169905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 623 | Open in IMG/M |
| 3300032261|Ga0306920_101420247 | Not Available | 994 | Open in IMG/M |
| 3300032770|Ga0335085_11361016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 746 | Open in IMG/M |
| 3300032770|Ga0335085_12342507 | Not Available | 533 | Open in IMG/M |
| 3300032783|Ga0335079_12209746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kibdelosporangium → Kibdelosporangium banguiense | 525 | Open in IMG/M |
| 3300032828|Ga0335080_11392041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 698 | Open in IMG/M |
| 3300032893|Ga0335069_11960089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kibdelosporangium → Kibdelosporangium banguiense | 618 | Open in IMG/M |
| 3300032954|Ga0335083_11428657 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300033134|Ga0335073_10467005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1453 | Open in IMG/M |
| 3300033134|Ga0335073_11395829 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300033289|Ga0310914_10244934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1609 | Open in IMG/M |
| 3300033289|Ga0310914_10721226 | Not Available | 893 | Open in IMG/M |
| 3300033289|Ga0310914_11194944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 662 | Open in IMG/M |
| 3300033475|Ga0310811_10832599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kibdelosporangium → Kibdelosporangium banguiense | 852 | Open in IMG/M |
| 3300034124|Ga0370483_0194770 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.27% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.18% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.09% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.09% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.55% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.18% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.45% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.09% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.09% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.09% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.09% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.09% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.73% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.73% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.73% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.73% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.73% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.73% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.73% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.73% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.36% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.36% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.36% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.36% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.36% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.36% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.36% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.36% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.36% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.36% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.36% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.36% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.36% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.36% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.36% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.36% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.36% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Host-Associated | Open in IMG/M |
| 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Host-Associated | Open in IMG/M |
| 3300012496 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610 | Environmental | Open in IMG/M |
| 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
| 3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Host-Associated | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1066209862 | 3300000955 | Soil | MFLAAFTSALQAYPQAVHRKTAWLSRDFGSTRPHAEQ |
| Ga0062595_1018964881 | 3300004479 | Soil | MFLAAFTSAFSVYPQATQRNRAWLSRLLAAMCPHAEQSWLVCAERTFST |
| Ga0070671_1001302233 | 3300005355 | Switchgrass Rhizosphere | MFLAAFTSALQVLPQAVQAKTAWLLRFSPAICPHTEQRWLVNAGLTFSTR |
| Ga0070674_1000644394 | 3300005356 | Miscanthus Rhizosphere | MFLAAFTSAFSVKLQAVHRNTAWLWRDSLAACPHAEQRWLV |
| Ga0070709_100262771 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIAAFTSALAVYAQATQAKTAWLLRLSAAMCPHAEQRWLVYA |
| Ga0070714_1006205891 | 3300005435 | Agricultural Soil | MLMAAFTSALAAYPQAVHRKTAWLSRDFGSTCPHAEHRWLVNAGFTFST |
| Ga0070714_1015761172 | 3300005435 | Agricultural Soil | MLIAAFTSAWQAYPQAVHRKTAWLSRDFGSTCPHAEHRWL |
| Ga0070714_1016530241 | 3300005435 | Agricultural Soil | MFLAALTSALQAYPQAVHRKTAWLSRDFGSTCPHAEQRWLV |
| Ga0070713_1002671483 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MLMAAFTSALAAYPQAVHRKTAWLSRDFGSTCPHAEHRWLV |
| Ga0070713_1010851932 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VGCPAAMLMAAFTSAWQAYPQAVHRKTAWLSRDFGSTCPHAEHRWLVNAG |
| Ga0070710_101684482 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MFRAAFSVYPQATQRNRAWLLRLPAAMCPHAEQRWLVYARGTRFLSA* |
| Ga0070710_103029882 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIAAFTSALQAYPQAVQQNRAWLSRDFASTCPHAEHRWL |
| Ga0070711_1014481602 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MLMAAFTSAWQAYPQAVHTNRAWLSRDLASTCPHAEHRWLVNAA |
| Ga0070708_1016896121 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MFRAAFTSAWQAYPQAVHRNTAWLSRESRSTCPHAEHRWL |
| Ga0070663_1002295741 | 3300005455 | Corn Rhizosphere | MFLAAFTSALQAYPQAVQAKRAWLSRDLASTCPHALQRCEVYAGGTFCTRPGA |
| Ga0070685_114675242 | 3300005466 | Switchgrass Rhizosphere | MFLAAFTSALQAYPQAVHRKSAWLSRDFGSTCPHAEQRWLVKAGLIFSTRP |
| Ga0070730_102969571 | 3300005537 | Surface Soil | MFLAAFTSALAAYPQVTQENRAWLLRDPAATCPHAEQSWLVYAGL |
| Ga0066707_108587452 | 3300005556 | Soil | MFIAAFTSALEANPQVVQAKTAWLLRFPLATCPHSEQRWLVKA |
| Ga0068857_1002514231 | 3300005577 | Corn Rhizosphere | MFLAAFTSALQAKRQAVHTKRAWLSRDFASTCPHAEQRW |
| Ga0068857_1021968872 | 3300005577 | Corn Rhizosphere | MFLAAFTSALQAYPQAVHRKSAWLSRDFGSTCPHAEQRWLV |
| Ga0070762_100974961 | 3300005602 | Soil | MFLAAFTSALQATPQAVHRNTAWLSRESRSTCPHAEHRWLVNAGLIF |
| Ga0068864_1010432251 | 3300005618 | Switchgrass Rhizosphere | MLIAAFTSALQAYPQAVQQNRAWLSRDFASTCPHAE |
| Ga0068866_110678062 | 3300005718 | Miscanthus Rhizosphere | MFLAAFTSALQVLPQAVQAKTAWLLRFSPAICPHTEQRWLVNAGLTFST |
| Ga0068851_100937411 | 3300005834 | Corn Rhizosphere | MFFAAFTSAWQAYPQAVHRKTAWLSRDFGSTCPHAEQRWLVNAGLIF |
| Ga0068858_1005219131 | 3300005842 | Switchgrass Rhizosphere | MFLAAFTSALQAKVQATQAKRAWLLRLSAATCPHAEQRWLVYAGLTFSTRPGALSC |
| Ga0070717_110594642 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLMAAFTSAWQAKPQAVHRNTAWLSREPRSTCPHAEHRWLVNTGLTLSTRPGALSS |
| Ga0075417_103177672 | 3300006049 | Populus Rhizosphere | MFLAAFTSAFSVYPQATQRNRAWLSRLLAAMCPHAEQSWLVCAE |
| Ga0075017_1001992273 | 3300006059 | Watersheds | MFRAAFTSALQAYPQAVHANRAWLSREFASTCPHAEQRWLV |
| Ga0070715_104884702 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MFLAAFTSASQAKPQAVHRKTAWLSRDFRSTRPHAEQRWLV* |
| Ga0070715_105589232 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MLMAAFTSAWQAYPQAVHTNRAWLSRDLASTCPHAEHRWLVN |
| Ga0070716_1000306081 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MLMAAFTSAWQAYPQEVHRKTAWLSRDFGSTCPHAEHRWL |
| Ga0068871_1000793211 | 3300006358 | Miscanthus Rhizosphere | MFFAAFTSALPTYPQAVHWKTAWLSRGFESTCPHVEHRWLVNAG |
| Ga0074059_117593592 | 3300006578 | Soil | MFLAAFTSALQAKLQATQAKRAWLLRLSAAMCPHAEQRW |
| Ga0066660_110319931 | 3300006800 | Soil | MFLAAFTSAWQAKPQAVHRNTAWLSRESRSTCPHAEHRWLVNAG |
| Ga0079220_105789892 | 3300006806 | Agricultural Soil | MLIAAFTSALAANPQAVHTKRAWLSRDFASTCPHALQRCDVY |
| Ga0075421_1021434041 | 3300006845 | Populus Rhizosphere | MFFAAFTSALSENAQAVHRKAAWLSRDFGSVCPHALQRWLVYAGLTISTRPG |
| Ga0075436_1003804953 | 3300006914 | Populus Rhizosphere | MFLAALTSALQAYAQAVHQKPAWLSRDFGSTCPHAEQRWLVYAGLIFCTR |
| Ga0099829_100256491 | 3300009038 | Vadose Zone Soil | MVRAAFTSAWQAYPQEVQTKTAGLLRDFASTRPHAEHRWLV |
| Ga0099829_108883062 | 3300009038 | Vadose Zone Soil | MFLAAFTSAWQAKPQAVHTKRAWLSRDFPSTCPHAEHRWLV* |
| Ga0099830_107621211 | 3300009088 | Vadose Zone Soil | GPVRPRAVTACPAAMVRAAFTSAWQAYPQEVQTKTAWLLRDFASTRPHAEHRWLVYAG* |
| Ga0099830_108171322 | 3300009088 | Vadose Zone Soil | MFLAAFTSAWPVYPQAAHRKTAWLSRLSGAMCPHAFDPRLVRASLRSSRLS |
| Ga0099827_103771042 | 3300009090 | Vadose Zone Soil | MFLAAFTSALQAKPQAVHRKTAWLSRDFPSTCPHAEQRWLV* |
| Ga0099827_109285212 | 3300009090 | Vadose Zone Soil | MFLAAFTSALQAKPQAVHRKTAWLSRGFPSTCPHAEQRWLVWCGLIFS |
| Ga0099827_111196862 | 3300009090 | Vadose Zone Soil | MFLAAFTSAWQAYPQAVHRKTAWLSRDFPSTRPHAEHRWLV* |
| Ga0099827_115328911 | 3300009090 | Vadose Zone Soil | MFRAAFTSALQAYPQAVHAKLAWFSRDFASTCPHAEQRWLV* |
| Ga0105240_126200241 | 3300009093 | Corn Rhizosphere | MFFAAFTSALPTYPQAVHWKTAWLSRDFESTCPHVEHRWLVNAGLTFSTRPGAFCSRRR |
| Ga0066709_1000616305 | 3300009137 | Grasslands Soil | MFFAALTSALSVYAQATQRKRAWLLRLSGARCPHAEQRWLVN |
| Ga0066709_1019731821 | 3300009137 | Grasslands Soil | MIWAALKSALAVYLQAWQQKSAWLSRLPAAVCPQATQRWLL |
| Ga0066709_1030889351 | 3300009137 | Grasslands Soil | MFLAAFTSAWQAKPQAVHRNRAWLSRDFGSTCPHAEHRWLVNAGLTFSPRP |
| Ga0099792_109230832 | 3300009143 | Vadose Zone Soil | MFLAAFTSAWQAKPQAVHTKRAWLSRDFPSTCPHAEHRWLVNA |
| Ga0116214_12408501 | 3300009520 | Peatlands Soil | MFRAAFTSALQAKPQAVHRNLAWLSREFRSTCPHAEQRWLVYAG |
| Ga0116225_10342483 | 3300009524 | Peatlands Soil | MFLAAFTSAWQAKPQAVHRKLAWLSRDFRSTCPHAEHRWLVNAGL |
| Ga0116135_10778741 | 3300009665 | Peatland | MLMAAFTSAWQAKPQAVHRNTAWLSREARSTRPHAEHRWLVNAGLIFST |
| Ga0116224_104947791 | 3300009683 | Peatlands Soil | MFLAAFTSALQAYPQATQQNRAWLSRLPAAMCPHAEQRWLVNAGLTF |
| Ga0116216_105234071 | 3300009698 | Peatlands Soil | MFLAAFTSALQAYPQATQQNRAWLSRLPAAMCPHAEQRWLVNAGLTFSTRPGA |
| Ga0116216_108583511 | 3300009698 | Peatlands Soil | LRAAFTSAWQAYPQAVQAKTAWLLRDFASTCPHAEHRWL |
| Ga0123355_103007461 | 3300009826 | Termite Gut | MFVAAFMSALQAYPQDVQRKAAWLSRDLPSTCPHAEQRWL |
| Ga0126373_120615072 | 3300010048 | Tropical Forest Soil | MFLAAFTSALQANPQAVHRKTAWLSRDFRSTCPHAEQRWLV* |
| Ga0099796_101618781 | 3300010159 | Vadose Zone Soil | MFLAAFTSALQAYPQAVHTKRAWLSRDFASTCPHAEQRWLVNAG |
| Ga0134062_102776931 | 3300010337 | Grasslands Soil | MFIAAFTSALEANPQVVQAKTAWLLRFPLATCPHSEQRWLV |
| Ga0126372_114373352 | 3300010360 | Tropical Forest Soil | MAMFFAAFTSALQANLQAVHRKTAWLSRDFPSTCPQALQR |
| Ga0126372_126643352 | 3300010360 | Tropical Forest Soil | MFLAAFTSAWQADLQAVHRKTAWLSRDFRSTHPHAEQR* |
| Ga0126378_101316503 | 3300010361 | Tropical Forest Soil | MFLAAFTSALQAKSQVVHWKTAWLLRDFQSTCPHALHR* |
| Ga0126378_109536332 | 3300010361 | Tropical Forest Soil | MFLAALMSALQEYPQDVHANRAWLLRLFASTRPHSAQRWLVYAGLTFSTRPA |
| Ga0126379_121555881 | 3300010366 | Tropical Forest Soil | MFLAAFTSALQANLQVTHAKRAWLLRLSDAMRPHALQRWLVNAGLTL |
| Ga0134125_118959391 | 3300010371 | Terrestrial Soil | MFLAAFTSAWQAYPQAVHRKTAWLSRDRPSTCPHAEHRWLVNAGLILS |
| Ga0134128_102759931 | 3300010373 | Terrestrial Soil | MFLAAFASALQAYLQATQRNRAWLSRLPAAICPHAEHR |
| Ga0134128_116104401 | 3300010373 | Terrestrial Soil | MFLAAFTSALQAYPQAVHQKPALLWRDFGSTCPHGDQRWLV |
| Ga0126381_1009479863 | 3300010376 | Tropical Forest Soil | MFLAAFTSALQAYPQAVHWKTAWLSRESRSTCPHAEHRWLVNAGLIFSTR |
| Ga0126381_1050860352 | 3300010376 | Tropical Forest Soil | MFMAAFTSALQAKPQAVQANRAWLSREFASTHPHAEHRWLVNAGLILSTRPGALSS |
| Ga0136449_1018237291 | 3300010379 | Peatlands Soil | MFFAAFTSAFSACPQDRQAKTAWLSRASASLVPHAEH |
| Ga0136449_1025992542 | 3300010379 | Peatlands Soil | MLMAAFTSAWQAKPQAVHRKTAWLSRESRSTCPHAEHRWLVNAGLIFS |
| Ga0134126_114871162 | 3300010396 | Terrestrial Soil | MLMAAFTSAWQAYPQAVHRKTAWLSRDFGSTCPHAEHRWLVNAGLT |
| Ga0134124_100511415 | 3300010397 | Terrestrial Soil | MFLAAFTSALQVLPQAVQAKTAWLLRFSPAICPHTEQRWLVNAGLTFSTRPG |
| Ga0134121_104598523 | 3300010401 | Terrestrial Soil | MFFAAFTSAWQAYPQAVHRKTAWLSRDFGSTCPHAE |
| Ga0126344_10185521 | 3300010866 | Boreal Forest Soil | MFRAAFTSALQAYPQVVHTNRAWLSRESASTCPHAEHRWLVNC |
| Ga0126359_12572632 | 3300010869 | Boreal Forest Soil | MFLAAFTSAWQAYPQAVQTNRAWLLRDFASTCPHAEHRWLVNAGL |
| Ga0126361_104186281 | 3300010876 | Boreal Forest Soil | MFLAAFTSALQAYPQAVHANRAWLSREFASTSLHAEQR |
| Ga0126350_100287331 | 3300010880 | Boreal Forest Soil | MLIAAFTSALQAYPQAVHAKRAWLSRESASTSPHAEQRWLVYAGLIFCTRPGALSASR |
| Ga0151489_14339541 | 3300011106 | Soil | MFVAAFTSAWQAKPQAVHRNTAWLSREPRSTCPHAEHRWLVNAGLTF |
| Ga0151490_17937032 | 3300011107 | Soil | MFLAAFKSALQAKPQAVHTKRGWLSRDLASTCPHAEHRWLVKCGLTFSTRPDALS |
| Ga0137389_101232894 | 3300012096 | Vadose Zone Soil | MLIAAFTSALQAKPQAVHRKSAWLSRDFRSTCSHAEHRWLVKAGLTFST |
| Ga0137388_107792441 | 3300012189 | Vadose Zone Soil | MFLAAFTSALQAYPQATQQNRAWLSRLPAAICPHAEQRW |
| Ga0137383_100304041 | 3300012199 | Vadose Zone Soil | MFLAAFTSALQAKVQATQAKRAWLLRLSAATCPHAEQRWLVYAGLTVSTRPG |
| Ga0137383_103028891 | 3300012199 | Vadose Zone Soil | MFLAAFTSALQAKLQATQAKRAWLLRLSAAMCPHAEQRWLVYAELT |
| Ga0137382_103716661 | 3300012200 | Vadose Zone Soil | MFLAAFTSALQAYPQAVQAKTAWLLRFSPATCPHTLQRWLVYAGLIFWTR |
| Ga0137365_100183271 | 3300012201 | Vadose Zone Soil | MFLAAFTSALSAYPQAVHRKSAWLSRDFGSTCPHAEHRWLVNAGL |
| Ga0137380_103770181 | 3300012206 | Vadose Zone Soil | MLLAAFASALPAYPQAVQRNSAWLSRLSAAACPHAEHRWLVNAG* |
| Ga0137381_104288801 | 3300012207 | Vadose Zone Soil | TGERPRAVTACPAAMLLAAFTSALPAYPQAVQRNSAWLSRLSAAACPHAEHRWLVNAG* |
| Ga0137376_116336861 | 3300012208 | Vadose Zone Soil | MLLAAFTSALPVYPQAVQRNSAWLSRLSAATCPHTEHRWLVNAGLILSTRPQALS |
| Ga0137379_103782412 | 3300012209 | Vadose Zone Soil | MLLAAFTSALPAYPQAVQRNSAWLSRLSAAACPHAEHRWLVNAG* |
| Ga0137378_106213333 | 3300012210 | Vadose Zone Soil | MFLAAFTSALQAYPQAVQWKAVWLSRDFASTYPHAEHRWL |
| Ga0157328_10101592 | 3300012478 | Arabidopsis Rhizosphere | MFFAAFTSAWQAYPQAVHRKTAWLSRDFGSTCPHAEQRWLLNAGLIFSTRPEAFCSSRRT |
| Ga0157318_10391661 | 3300012482 | Arabidopsis Rhizosphere | MFFAAFTSAWQAYPQAVHRKTAWLSRDFGSTCPHAEQRWLVNAG |
| Ga0157353_10083322 | 3300012496 | Unplanted Soil | MFLAAFTAALQTYPQAVHRKTAWLSRDFESTCPHVEHRWLVNAGLTFSTRPGAFC |
| Ga0157342_10039041 | 3300012507 | Arabidopsis Rhizosphere | MFLAAFTSALQTYPQAVRRKTAWLSRDFESTCPHVEHRW |
| Ga0157338_10154991 | 3300012515 | Arabidopsis Rhizosphere | MFFAAFTSAWQAYPQAVHRKTAWLSRDFGSTCPHAEQRWLVNAGLI |
| Ga0164303_114826012 | 3300012957 | Soil | MLMAAFTSALAAYPQAVHRKTAWLSRDFGPTCPHAEHRWLV |
| Ga0164301_104648102 | 3300012960 | Soil | MFLAAFTSALQVLPQAVQAKTAWLLRFSPATCPHIEQRWLVN |
| Ga0164302_118500491 | 3300012961 | Soil | MFLAAFTSALQAKPQTVQTKRAWLSRDSESTCPHAEHRWLVKAGLI |
| Ga0164306_100419504 | 3300012988 | Soil | MFLAAFTSALLVYPQAVHRKTAWLSRDFRSTSPHAEQR* |
| Ga0157373_100355161 | 3300013100 | Corn Rhizosphere | MFLAAFTSALQAYPQAVHRKSAWLSRDFGSTCPHAEQRWLVKAGLIFSTRPG |
| Ga0181538_100044013 | 3300014162 | Bog | MFLAAFTSALQAKPQAVHRKPAWLSRDFRSTCLHAEHRWLVSAGLIFSTR* |
| Ga0182008_100818563 | 3300014497 | Rhizosphere | MFLAAFTSALQAKPQAVHLKTAWLSRDFGSTFLHAEQR* |
| Ga0132257_1036302092 | 3300015373 | Arabidopsis Rhizosphere | MFLAAFTPALQAKRQAVHTKRAWLSRDFASTCPHAEQRWLLNAGL |
| Ga0182033_101744213 | 3300016319 | Soil | MFFAALTSALSVYAQATQWKRAWLSRLSDATCPHAEQRW |
| Ga0182033_109071382 | 3300016319 | Soil | MFLAAFTSAFSVYVHATQVKNAWLLRLSAAMCPHAEHRWLV |
| Ga0182035_101985671 | 3300016341 | Soil | MFLAAFTSALQANPQAVHRKTAWLSRDFPATCPHALHRWLVNA |
| Ga0182032_104520092 | 3300016357 | Soil | MFLAAFTSALQLYRQAVQAKTAWLLRFSLATWPHQLQRWLVNEGLIFSIR |
| Ga0182032_109720911 | 3300016357 | Soil | MFLAAFTSALQAYPQAVQAKTAWLSRDFASTRPHAEQRWLVYAGLTLSTRPG |
| Ga0182034_105033852 | 3300016371 | Soil | MFWAAFTSALHAKPQTVHANRAWLSRDFASTCPHAEQRWLVNAGLIF |
| Ga0182038_102280131 | 3300016445 | Soil | MFLAAFTSALQANPQAVHRKTAWLSRDFPSTCPHALHRWLVNAA |
| Ga0182038_102625111 | 3300016445 | Soil | MFFAALTSALSVYAQATQWKRAWLSRLSDATCPHAEQRWLVNA |
| Ga0182038_103468473 | 3300016445 | Soil | MFLAAFTSAWQANPQAVHRKTAWLSRDFPSTCPHAEHRWLVNAGL |
| Ga0187812_100053313 | 3300017821 | Freshwater Sediment | MFLAAFTSALQAKPQAVHRKTAWLSRDFPSTCPHAEHRWLVNAGLIFS |
| Ga0187807_12490232 | 3300017926 | Freshwater Sediment | MLRAAFTSALQAYPQAVHRKSAWLSRDFRSTAPQALHR |
| Ga0187806_10129931 | 3300017928 | Freshwater Sediment | MFLAAFTSALQAKPQAVQAKCAWLSRDFPSTCPHAEQRWLVNAGLIFSTRPGALS |
| Ga0187814_100012469 | 3300017932 | Freshwater Sediment | MFLAAFTSALQANPQAVHANRAWLSREFPSMCPQAEQRWLVNAGLIVCTRPGALSLSRR |
| Ga0187814_103926561 | 3300017932 | Freshwater Sediment | MFLAAFTSALQAKLQAVHENRAWLSREFASTCPHAEHRWLV |
| Ga0187801_100130321 | 3300017933 | Freshwater Sediment | MFLAAFTSALQANPQAVHANRACLSREFPSMCPQAEQRWLVNAGLIV |
| Ga0187809_104394532 | 3300017937 | Freshwater Sediment | MFLAAFTSALQANPQAVHAKCAWLSRDFPSTCPHAEQRWLVNAGLI |
| Ga0187819_103312482 | 3300017943 | Freshwater Sediment | MFLAAFTSALQAKPQAVHRKTAWLSRDFPSTCPHAEHRWLVNAGLIFSIRPGALSA |
| Ga0187822_101969631 | 3300017994 | Freshwater Sediment | MFRAAFTSAWQAYPQAVHRKTAWLSRDFGSTCPHAEHRWLVNA |
| Ga0187815_104316212 | 3300018001 | Freshwater Sediment | MLIAAFTSALQAQLQATQRKMAWLSRLSGATCPHAEQRWLVN |
| Ga0187804_100221033 | 3300018006 | Freshwater Sediment | MFLAAFTSAWQAYPQAVHANRAWLSRDLPSTYPHAEHRWLVYCGLTFSTRPGAL |
| Ga0187765_102159931 | 3300018060 | Tropical Peatland | MFLAAFTSAWPTNPQAVQANRAWLSRELASTCPHAEQRWLVNAGLIFSTRPGAF |
| Ga0187774_112365492 | 3300018089 | Tropical Peatland | MFLAAFKSALQEYPQDRQAKSAWLSRDLPSTVPHALQRCEVN |
| Ga0066655_103934432 | 3300018431 | Grasslands Soil | MLMAAFTSAWQAKPQAVHTKRAWLSRDFGSTCPHAEHRWLVNAGLTL |
| Ga0066669_102650442 | 3300018482 | Grasslands Soil | MFLAAFMSALSVKRQAVHRKAAWLSRDFGSTCPHAEQRWLVYAGLIFSTR |
| Ga0066669_109547041 | 3300018482 | Grasslands Soil | LLAAFTSALAVYRQMVQAKTAWLLRFSLATCPHAEQRWL |
| Ga0206354_102216541 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MFLAAFTSAFSVKLQAVHRNTAWLWRDSLAACPHAEQRWLVYA |
| Ga0206354_106604232 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MFLAAFTSALQAKPQAVQRKTAWLSRFSRATCPHAL |
| Ga0206353_100655522 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MFLAAFTSAFSVKLQAVHRNSAWLSRLFRSTRPHAEQRWLVNAGLTLS |
| Ga0206353_101027742 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MFLAAFTSALQAYPQAVHRKTAWLSRDFGSTRPHAEQH |
| Ga0210407_109169521 | 3300020579 | Soil | MFRAAFTSALQAKPQAVHTNRAWLSRESASTYPHAEHRWLVKCGLIL |
| Ga0210403_104695531 | 3300020580 | Soil | MFRAAFTSALQAKPQAVHTNRAWLSRESASTCPHSEHCWLVKCG |
| Ga0210399_110719051 | 3300020581 | Soil | MFLAAFTSALQAYPQAVHRKSAWLSRDLPSTCPHAEHRWLVYAGCI |
| Ga0210405_102541341 | 3300021171 | Soil | MLMAAFTSAWPAKPQAVHAKRAWLWREFASTCPHAE |
| Ga0210408_112723971 | 3300021178 | Soil | MFLAAFTSALQTKPQAVHRKAAWLSRELPSTCPHAEQRWLVNMGLIFSTR |
| Ga0210396_103272553 | 3300021180 | Soil | MLMAAFTSAWPAKPQAVHRNTAWLSRESRSTCPHAEHRWLVNAGLTF |
| Ga0210387_109928341 | 3300021405 | Soil | MFLAAFTSALQAKLQATQAKRAWLLRLSAAACPHAE |
| Ga0210383_102856142 | 3300021407 | Soil | MFLAAFTSALQTYPQDRQAKSAWLSRDFPSTVPHALQRCEVNAGVTFCT |
| Ga0210383_104661811 | 3300021407 | Soil | PARAVTACPAAMLMAAFTSAWPAKPQAVHRNTAWLSREPRSTRPHAEHRWLVNAGLIF |
| Ga0210394_109690831 | 3300021420 | Soil | MFLAAFTSAFSVFPQAAQRNRAWLSRLPAATCPHAEHRWLVYAGLIFSTR |
| Ga0210392_107631902 | 3300021475 | Soil | MFRAAFTSALQVKPQAVHAKRAWLSRDFASTCPHA |
| Ga0210410_105220072 | 3300021479 | Soil | MFLAAFTSALQAKLQATQAKRAWLLRLSAAACPHAEQRWLVYTGLTF |
| Ga0210410_105234052 | 3300021479 | Soil | MFLAAFTSALQAKLQAVHRKTAWLSRLSRATCPHALQRW |
| Ga0224712_103582471 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MFLAAFTSALQAKPQAVQTKRAWLSRDSESTCPHAEHRWLVKAGLTFSTRPG |
| Ga0242662_100445912 | 3300022533 | Soil | MFLAAFTSAWQAKPQAVHRNRAWLSRESRSTCPHAEHRWLVNAGLTFS |
| Ga0242662_102385171 | 3300022533 | Soil | MFRAAFTSAWQAYPQAVHRKTAWLSRDRRSTCPHAEHRWL |
| Ga0224549_100010713 | 3300022840 | Soil | MLMAAFTSALQAKPQAVHRNTAWLSREARSTCPHAEHRWLVNAG |
| Ga0247691_10099993 | 3300024222 | Soil | MFLAAFTSALQAKVQATQAKRAWLLRLSAAMCPHAEQRWLVYAGL |
| Ga0208935_10364422 | 3300025414 | Peatland | MLIAAFTSALPAKPQAVHRNTAWLSREPRSTRPHAEHRWLVNAGLIFSTRPGTGRFHVYR |
| Ga0207692_107159142 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MFLAAFTSALETYLQAVHRKTAWLSRDFGSTCPHAE |
| Ga0207692_111698732 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MFLAAFTSAWQAKPQAVHRKTAWLARDFGSTCPHAEHRWLVNA |
| Ga0207699_101900611 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MFLAAFTSALQAKVQATQAKRAWLLRLSAARCPHAEQRWLVYAG |
| Ga0207684_106271051 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MFLAAFTSALQAKRQAVHTKRAWLSRDFESKCPHAEHRWLVN |
| Ga0207660_104086442 | 3300025917 | Corn Rhizosphere | MFLAAFTSALQAKLQATQAKRAWLLRLSAATCPHAEQRWLVNAASIFSTR |
| Ga0207649_106417481 | 3300025920 | Corn Rhizosphere | MFLAAFTSALQAKVQATQAKRAWLLRLSAATCPHAEQRWLVY |
| Ga0207652_107522401 | 3300025921 | Corn Rhizosphere | MFLAAFASALQAYLQATQRNRAWLSRLPAAICPHAEHRWL |
| Ga0207694_107345401 | 3300025924 | Corn Rhizosphere | MFLAAFTSALQAKRQAVHTKRAWLSRDFASTCPHAEQRWLLNAGLTFST |
| Ga0207659_104872171 | 3300025926 | Miscanthus Rhizosphere | MFLAAFTSALQAKRQAVHTKRAWLSRDFASTCPHAEQRWLLNAGLTFSTRLVALVSS |
| Ga0207700_100165675 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MGRWVGCPAAMFLAAFTSALQVYLQAMHRKTAWLSRDFPSTCPRAEQRWL |
| Ga0207700_105041742 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VGCPAAMLMAAFTSAWQAYPQAVHRKTAWLSRDFGSTCPHAEHRWL |
| Ga0207700_109358251 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MLMAAFTSAWQAYPQAVQQKRAWLSRDLASTCPHAEHRWLVNVALTFPTR |
| Ga0207690_108537022 | 3300025932 | Corn Rhizosphere | MFLAAFTSALQARPQAVHTKRAWLSRDFASTCPHAEQRWHVNAGL |
| Ga0207665_103663731 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MFLAAFTSALQAYPQAVHRKTAWLSRDFGSTCPHTERRWLV |
| Ga0207667_103387692 | 3300025949 | Corn Rhizosphere | MFLAAFTSALQAYPQAVHRKSAWLSRDFGSTCPHAEQRWLVKAGLIFSTRPGA |
| Ga0207678_100526245 | 3300026067 | Corn Rhizosphere | MFLAAFTSALQANLQAVQRKTAWLSRFSRATCPHALQRCEVYAGLTLSTLP |
| Ga0207641_119657222 | 3300026088 | Switchgrass Rhizosphere | MLIAAFTSALQAYPQAVQQNRAWLSRDFASTCPHAEHRWLENAGLTFSTRPGAFSSRRRT |
| Ga0207698_111241932 | 3300026142 | Corn Rhizosphere | MFLAAFTSALQAYPQAVHRKSAWLSRDFGSTCPHAEQRWLVKAG |
| Ga0209438_11571132 | 3300026285 | Grasslands Soil | MFFAAFTSAFSSYPQVVHRNTAWLSRLSGSTVRHAE |
| Ga0209214_10026982 | 3300027071 | Forest Soil | MFLAAFTSALQAKPQAVHTKRAWLSRDFASTCPHAEQRWLLNAGLTFSTR |
| Ga0208565_11438181 | 3300027662 | Peatlands Soil | MFLAAFTSAWQAKPQAVHRKTAWLSRESRSTCSHAEHRWLVNPGLTFSTRPGALSYSR |
| Ga0208696_10008411 | 3300027696 | Peatlands Soil | MLMAAFTSAWQAKPQAVHRKTAWLSRESRSTCPHAEHRWLV |
| Ga0209178_12041351 | 3300027725 | Agricultural Soil | MFLAAFTSAWQAYPQAVHRKTAWLSRDRPSTCPHAEHRWLVNAGLILSTR |
| Ga0209448_100780102 | 3300027783 | Bog Forest Soil | MFLAAFTSALQAYPQAVHAKRAWLSREFVSTCPHAEQRWLVNLGLIPLTFSGR |
| Ga0209074_102151091 | 3300027787 | Agricultural Soil | MFLAAFTSAFSVYPQATQRNRAWLSRLLAAMCPHAEQSWLVCAERTFSTRRG |
| Ga0209180_105321101 | 3300027846 | Vadose Zone Soil | MLMAAFTSAWQAYPQAVHRKTAWLSRESRSTCPHAEHRWLVNAGLTFSTR |
| Ga0209274_103630272 | 3300027853 | Soil | MFLAAFTSALQANPQAVHQKTAWLSRDFGSTCPHAEHRWLVNAGLI |
| Ga0209517_102886961 | 3300027854 | Peatlands Soil | MFLAAFTSAWQAKPQAVHRKTAWLSRESRSTCPHAEHRWLV |
| Ga0209579_105302861 | 3300027869 | Surface Soil | MFLAAFTSALQAYPQAVQAKRAWLSRDLASTCPHAEHRWLVYAGLTFSTLA |
| Ga0209006_101592221 | 3300027908 | Forest Soil | MAAFTSALAAKPQAVHRNTAWLSREPRSTRPHAEHRWLVNAGLTFS |
| Ga0247682_10563952 | 3300028146 | Soil | MFLAAFTSALQAKVQATQAKRAWLLRLSAATCPHAEQRWLVYAGLTFSTRPGAL |
| Ga0265323_100816431 | 3300028653 | Rhizosphere | MFLAAFTSALQAYPQAVHRKTAWLSRDLRSTCPHALQRCEVYAGGTFSTRP |
| Ga0302220_100594114 | 3300028742 | Palsa | MFLAAFTSALPAKPQAVHTKRAWLWRDLASTCLHTEHRWPVKAGLTFST |
| Ga0302219_101424461 | 3300028747 | Palsa | MLIAAFTSALQAKPQAVHRNTAWLSREPRSTSPHAEHRWLVNAGLIFS |
| Ga0302232_100768064 | 3300028789 | Palsa | RAAFTSALPAYPQAVHRNRAWLSRDLPSTCPHAEHRWLVYK |
| Ga0302232_105306241 | 3300028789 | Palsa | MFRAAFTSALPAYPQAVHRNRAWLSRDLPSTCPHAEHRWLV |
| Ga0307305_103073681 | 3300028807 | Soil | MFLAAFTSALAVYRQAAQAKTAWLLRFSLATCPHALQRRLVYAGLIFS |
| Ga0302235_102994911 | 3300028877 | Palsa | MLMAAFTSALPAKPQAVHRNTAWLSRESRSPCPHAEHRWLVNAGLTFS |
| Ga0311352_108921391 | 3300029944 | Palsa | MLMAAFTSALPAKPQAVHRNTAWLSREPRSTCPHAEHRWLVN |
| Ga0311371_101142751 | 3300029951 | Palsa | MLMAAFTSALQAKPQAVHRNTAWLSREARSTCPHAEHRWLVNAGLI |
| Ga0311338_101681011 | 3300030007 | Palsa | MGRWVGCPAAILIAAFTSALQAKPQAVHRNTAWLSREPRSTRPHAEHRWLVNAGLIFST |
| Ga0302181_100022881 | 3300030056 | Palsa | MFLAAFTSALQAKPQAVHRKTAWLSREARSTCPHAEHRWLV |
| Ga0302179_100009381 | 3300030058 | Palsa | MLMAAFTSAFPAKPQAVHRNTAWLSRESRSTCPHAEHRWLVNAGLTFSTRPGA |
| Ga0311372_100091251 | 3300030520 | Palsa | MLMAAFTSALQAKPQAVHRNTAWLSREARSTCPHAEHRWLVNAGLIF |
| Ga0311357_101396801 | 3300030524 | Palsa | MLMAAFTSALQAKPQAVHRNTAWLSREARSTCPHAEHRWLVNAGLIFSTRPGA |
| Ga0310039_101004091 | 3300030706 | Peatlands Soil | MFLAAFTSALQAYPQATQQNRAWLSRLPAAMCPHAEQRWLVNAGL |
| Ga0310038_102003331 | 3300030707 | Peatlands Soil | MFLAAFTSALQAYPQATQQNRAWLSRLPAAMCPHAEQRWLVNAGLTFSTRP |
| Ga0310038_102359872 | 3300030707 | Peatlands Soil | MFRAASTSALQAKLQATQAKTAWLSRLSAAMCPHAEHRWLVNAALIFSTRPGAL |
| Ga0265462_113326132 | 3300030738 | Soil | MFLAAFTSAWQAYPQTVHTNRAWLSRDFASTCPHAEHRWLVNAAYK |
| Ga0302325_111728933 | 3300031234 | Palsa | VGCPAAMLIAAFTSALPAKPQAVHRNTAWLSREPRSTCPHAEHRWLVNAGPHAEHRWLVK |
| Ga0302324_1000073481 | 3300031236 | Palsa | MLMAAFTSALPAKPQAVHRNTAWLSREPRSTRPHAEHRWLVNAGLIFSTRPGALS |
| Ga0170818_1138896832 | 3300031474 | Forest Soil | MFFAAFTSALQTYPQAVHRKTAWLSRDFESTCPHVEHRWLVNAGLTFS |
| Ga0318516_102352851 | 3300031543 | Soil | MFLAAFTSAFSVFPQAAQRNRAWLSRLPAATCPHAEHR |
| Ga0318516_106217532 | 3300031543 | Soil | MFLAAFTSALHAYPQAVHANRAWLSREFASTCPHAGQRWLVNAGLTFSTRPGALSCR |
| Ga0318516_108693661 | 3300031543 | Soil | MFLAALTSALAVYAQATQQKSAWLSRLSAAMCPHAEHRWLV |
| Ga0318534_101040232 | 3300031544 | Soil | MLMAAFTSALQAKPQATQRYKAWLSRLPAAMCPHAEQRWLVKAG |
| Ga0318538_100706083 | 3300031546 | Soil | MFFAALTSALSVYAQATQWKRAWLSRLSDATCPHAEQRWLVNAGLTRWT |
| Ga0318515_102908441 | 3300031572 | Soil | MFLAAFTSALHAYPQAVHANRAWLSREFASTCPHAEQRWL |
| Ga0318555_103659481 | 3300031640 | Soil | MFLAAFTSALQAKPQAVHPNRAWLLRDSGSTCPHAEQRWLVTAGLIFAT |
| Ga0318555_104992772 | 3300031640 | Soil | MFFAALTSAFSVYAQATQRKRAWLSRLSDATCPHAEQRW |
| Ga0318555_107972261 | 3300031640 | Soil | MFLAAFTSAWQANPQAVHRKTAWLSRDFRSTCPHAEHRWLVN |
| Ga0318560_106442111 | 3300031682 | Soil | MFRAAFTSALQAYPQAVHRKAAWLSRDFRSTSPHALHRWLVNAGLIFST |
| Ga0310686_1089664881 | 3300031708 | Soil | MFRAAFTSALQAYPQAVHRKTAWLSRDFGSTRPHAEQCWLVNAGV |
| Ga0318501_100747382 | 3300031736 | Soil | MLMAAFTSALQAKPQATQRYKAWLSRLPAAMYPHAEQRWLVKAG |
| Ga0306918_109784132 | 3300031744 | Soil | MFLAAFTSAWQAYPQAVHRKTAWLSRDFRSTRPHTEHRWLVNTGLIFSTRPGALSS |
| Ga0318502_103441361 | 3300031747 | Soil | MFLAAFTSAFSVYPQATQRNRAWLSRLFAAMCPHAEQSWLVCAERTFSTRPE |
| Ga0318502_107370631 | 3300031747 | Soil | MFLAAFTSALQAYPQAVQAKTAWLLRDFASTCPHAEQRW |
| Ga0318494_105386632 | 3300031751 | Soil | MFLAAFTSALQAKPQAVQAKRAWLSRDSASTRPHAEHRWLVNAGLIFS |
| Ga0307475_105457903 | 3300031754 | Hardwood Forest Soil | MFWAAFTSALQAYPQAVHANRAWLSREFASTRPHADQRWLV |
| Ga0318526_100135143 | 3300031769 | Soil | MFFAALTSALSVYAQATQWKRAWLSRLSDATCPHAEQRWLVNAGLTRW |
| Ga0318526_103225892 | 3300031769 | Soil | MFKAAFTSAWPAYPQAVHANHAWLSREFASTCPHAEHRWLVNAGLILSTRPGALSS |
| Ga0318498_104638552 | 3300031778 | Soil | MFLAAFTSAFSVFPQAAQRNRAWLSRLPAATCPHAEHRW |
| Ga0318552_101641301 | 3300031782 | Soil | MFFAAFTSAFSVFPQAAQRNRAWLSRLPAAMCPHAEHRWLVYA |
| Ga0318523_100254753 | 3300031798 | Soil | MFLAAFTSALQANPQAVHRKTAWLSRDFPSTCPHALH |
| Ga0318565_105354172 | 3300031799 | Soil | MFLAAFTSALQLYRQAVQAKTAWLLRFSLATWPHQLQRWLVNEGLIFSIRPGAFCSNRLTRI |
| Ga0318564_102062381 | 3300031831 | Soil | MLRAAFTSAWLAYPQAVHANRAWLSREFVSTCPHAEQRWLVNA |
| Ga0318512_106169332 | 3300031846 | Soil | MFRAAFTSAWQAYPQAVHRKTAWLSRDFGSTRPHAEHRWLVNAGLIF |
| Ga0318495_102063523 | 3300031860 | Soil | MFFAALTSAFSVYAQATQRKRAWLSRLSDATCPHAEQRWLLNAGLTLS |
| Ga0306919_108501422 | 3300031879 | Soil | MFRAAFTSALQANPQAVHTNRAWLSRDFASTYPHAEH |
| Ga0318522_100978331 | 3300031894 | Soil | MFLAAFTSAWQAYPQAVHRKTAWLSRDFRSTCPHALQRWLV |
| Ga0318522_103786911 | 3300031894 | Soil | MFLAAFTSALQAYPQAVHAKRAWLSREFASTCPLAEQR |
| Ga0318551_100472443 | 3300031896 | Soil | MFLAAFTSAWQANPQAVHRKTAWLSRDFPSTCPHAEHRWLVNAGLIFS |
| Ga0318551_102830923 | 3300031896 | Soil | MFLAAFTSAWQANPQAVHRKTAWLSRDFRSTRPHAEQRWLVNAALIFSTR |
| Ga0318520_106143902 | 3300031897 | Soil | MFLAAFTSALQAYPQATQRKRAWLSRLSAAMCPHAEQHWLVYAGLTFSTRPGALS |
| Ga0306921_109746842 | 3300031912 | Soil | MFLAAFTSALHAYPQAVHANRAWLSREFASTCPHAGQRWLVNAGLT |
| Ga0310916_101691022 | 3300031942 | Soil | ERPRAVTACPAAMLMAAFTSALQAKPQATQRYKAWLSRLPAAMCPHAEQRWLVKAG |
| Ga0310909_106273791 | 3300031947 | Soil | MLIAAFTSALQAKPQATQRYEAWLSRLPAAMCPDAEQR |
| Ga0307409_1014298951 | 3300031995 | Rhizosphere | MFRAAFRSALAEYPQDRHRKTAWLSRAFLSTVPHSEQRLLVNAGFTFSN |
| Ga0306922_104384141 | 3300032001 | Soil | MFFAALTSALSVYAQATQRKRAWLSRLSGARCPHAEQRWLV |
| Ga0306922_108131881 | 3300032001 | Soil | MFLAAFTSAFSVFPQAAQRNRAWLSRLPAAMCPHAE |
| Ga0306922_117239142 | 3300032001 | Soil | MFLAAFTSAWQAYPQAVHRKTAWLSRDFRSTCPHALQR |
| Ga0318562_100291644 | 3300032008 | Soil | MFLAAFTSAWQANPQAVHRKTAWLSRDFPSTCPHAEHRWLVNAGLIFSTRPGAF |
| Ga0310911_107741282 | 3300032035 | Soil | MLIAAFTSALQAKPQATQRYEAWLSRLPAAMCPHAEQRWLVKA |
| Ga0318545_102020162 | 3300032042 | Soil | MFLAAFTSAWQANPQAVHRKTAWLSRDFPSTCPHAEHRW |
| Ga0318556_100839173 | 3300032043 | Soil | MFLAAFTSALQVYPQAVHRKTAWLSRDFPSTCPHAEHRWLVNAGLIFSTRP |
| Ga0318506_103400501 | 3300032052 | Soil | MFFAALTSALSVYAQATQRKRAWLSRLSDATCPHAEQRWLVNA |
| Ga0318575_100100701 | 3300032055 | Soil | MFLAAFTSAWQAYPQAVHRKTAWLSRDFRSTCPHALQRWLVKYGVIFSTRPGA |
| Ga0318575_103722272 | 3300032055 | Soil | MFLAAFTSALQVYPQAVHRKTAWLSRDFPSTCPHAEHRWLVNAGLIFSTR |
| Ga0318533_108651482 | 3300032059 | Soil | MFLAAFTSALQVYPQAAQMKTAWLLRFSPATCPHTEQR |
| Ga0318513_101508332 | 3300032065 | Soil | MFRAAFTSAWQAYPQAVHRKTAWLSRDFGSTRPHAEHRWLVNAGLIFST |
| Ga0318524_104826012 | 3300032067 | Soil | MFLAAFTSALQAKPQAVHTKRAWLSRDFPSTRPHAEQRWLVNTGLTFSTR |
| Ga0318524_107643591 | 3300032067 | Soil | MFLAAFTSALQAKPQAVHWKAAWLSRDFLSTCPHA |
| Ga0318553_107165281 | 3300032068 | Soil | MFLAAFTSALQVYPQAAQMKTAWLLRFSPATCPHTEQRWLV |
| Ga0308173_116347701 | 3300032074 | Soil | MFLAAFTSAFSVKLQAVHRNSAWLSRLFRSTRPHAE |
| Ga0306924_100233818 | 3300032076 | Soil | MFLAAFTSAWQANPQAVHRKTAWLSRDFPSTCPHAEHRWLVNAG |
| Ga0318518_105841722 | 3300032090 | Soil | MFLAAFTSAFSVFPQAAQRNRAWLSRLPAAMCPHAEHRWLVYAAST |
| Ga0311301_118167221 | 3300032160 | Peatlands Soil | MFLAAFTSALQAYPQATQQNRAWLSRLPAAMCPHAEQRWLVNAGLTFSTRPGALS |
| Ga0307470_111699051 | 3300032174 | Hardwood Forest Soil | MFLAAFTSALQAFLQATQRKRAWLSRLSGATCPHAEHRWLVYAGL |
| Ga0306920_1014202472 | 3300032261 | Soil | MFLAAFTSALQAKPQAVHTKRAWLSRDFPSTRPHAEQRWLVNTGLT |
| Ga0335085_113610161 | 3300032770 | Soil | MFLAAFTSALATYLQAVHRKTAWLSRDFGSTCPHAEH |
| Ga0335085_123425072 | 3300032770 | Soil | MFFAAFTSAWQAYPQAVHRKPAWLSRDFGSTCPHAEHRWLVNAGLIF |
| Ga0335079_122097462 | 3300032783 | Soil | MFRAAFTSAWQANPQAVHRKTAWLSRDFGSICPHAEHRWLVNAGLILRV |
| Ga0335080_113920412 | 3300032828 | Soil | MFLAAFTSALQVNPQDLHAKSAWLLRDFASTVLHTLQRCEVNAGLTFCTRPTALSSSRRT |
| Ga0335069_119600891 | 3300032893 | Soil | MLMAAFTSAWQANPQAVQQKRAWLSRDLASTCPHAEHRWLVNAALTFSTRPG |
| Ga0335083_114286572 | 3300032954 | Soil | MFLAAFTSALQAYPQATQQNRAWLLRLPAAMRPHAEQRWLVNA |
| Ga0335073_104670051 | 3300033134 | Soil | MLRAAFTSALQAKLQAVHRKTAWLLRFSLATCPHAEQRWLVYAGG |
| Ga0335073_113958292 | 3300033134 | Soil | MFLAAFTSALQAKPQAVQRKSAWLSRDFPSTCPHAEQRWLV |
| Ga0310914_102449343 | 3300033289 | Soil | MFFAALTSAFSVYAQATQRKRAWLLRLSGAMCPHAEQRWLVNA |
| Ga0310914_107212261 | 3300033289 | Soil | MFLAAFTSALPAKPQAVHRKTAWLSRDFPSTCPHAEQRWLVNAGVTFS |
| Ga0310914_111949442 | 3300033289 | Soil | MFLAAFTSALQAKPQAVQAKRAWLSRDSASTRPHAEHRWLVNAGL |
| Ga0310811_108325992 | 3300033475 | Soil | MFLAAFTSAWQAKPQAVHRNRAWLSRDFGSTCPHAEHRWLVNAGLIFSTRPGALSS |
| Ga0370483_0194770_2_148 | 3300034124 | Untreated Peat Soil | MLMAAFTSALQAKPQAVHRNTAWLSREPRSTRPHAEHRWLVNAGLIFST |
| ⦗Top⦘ |