| Basic Information | |
|---|---|
| Family ID | F013009 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 275 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MCPICKKKLIEHSELQDKICKMITIKQFANNSPGFDVQFRPFFED |
| Number of Associated Samples | 180 |
| Number of Associated Scaffolds | 275 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 9.45 % |
| % of genes near scaffold ends (potentially truncated) | 40.00 % |
| % of genes from short scaffolds (< 2000 bps) | 79.64 % |
| Associated GOLD sequencing projects | 169 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (95.273 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil (14.909 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.545 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.62% β-sheet: 0.00% Coil/Unstructured: 64.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 275 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 4.36 |
| PF00106 | adh_short | 2.18 |
| PF01467 | CTP_transf_like | 1.45 |
| PF00011 | HSP20 | 1.45 |
| PF00211 | Guanylate_cyc | 1.09 |
| PF01547 | SBP_bac_1 | 1.09 |
| PF01841 | Transglut_core | 1.09 |
| PF00881 | Nitroreductase | 0.73 |
| PF01179 | Cu_amine_oxid | 0.73 |
| PF01545 | Cation_efflux | 0.73 |
| PF13649 | Methyltransf_25 | 0.73 |
| PF07995 | GSDH | 0.73 |
| PF01131 | Topoisom_bac | 0.73 |
| PF06271 | RDD | 0.73 |
| PF05050 | Methyltransf_21 | 0.73 |
| PF14947 | HTH_45 | 0.73 |
| PF09334 | tRNA-synt_1g | 0.73 |
| PF00464 | SHMT | 0.36 |
| PF13185 | GAF_2 | 0.36 |
| PF07819 | PGAP1 | 0.36 |
| PF02800 | Gp_dh_C | 0.36 |
| PF10282 | Lactonase | 0.36 |
| PF13683 | rve_3 | 0.36 |
| PF13531 | SBP_bac_11 | 0.36 |
| PF02353 | CMAS | 0.36 |
| PF13238 | AAA_18 | 0.36 |
| PF09360 | zf-CDGSH | 0.36 |
| PF07040 | DUF1326 | 0.36 |
| PF01910 | Thiamine_BP | 0.36 |
| PF13365 | Trypsin_2 | 0.36 |
| PF01396 | zf-C4_Topoisom | 0.36 |
| PF07366 | SnoaL | 0.36 |
| PF00924 | MS_channel | 0.36 |
| PF13473 | Cupredoxin_1 | 0.36 |
| PF00226 | DnaJ | 0.36 |
| PF00571 | CBS | 0.36 |
| PF00582 | Usp | 0.36 |
| PF00795 | CN_hydrolase | 0.36 |
| PF01436 | NHL | 0.36 |
| PF06736 | TMEM175 | 0.36 |
| PF00122 | E1-E2_ATPase | 0.36 |
| PF00583 | Acetyltransf_1 | 0.36 |
| PF04182 | B-block_TFIIIC | 0.36 |
| PF08264 | Anticodon_1 | 0.36 |
| PF04343 | DUF488 | 0.36 |
| PF04266 | ASCH | 0.36 |
| PF07859 | Abhydrolase_3 | 0.36 |
| PF05899 | Cupin_3 | 0.36 |
| PF01487 | DHquinase_I | 0.36 |
| PF00561 | Abhydrolase_1 | 0.36 |
| PF02826 | 2-Hacid_dh_C | 0.36 |
| PF09335 | SNARE_assoc | 0.36 |
| PF08327 | AHSA1 | 0.36 |
| PF00589 | Phage_integrase | 0.36 |
| COG ID | Name | Functional Category | % Frequency in 275 Family Scaffolds |
|---|---|---|---|
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 1.45 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.09 |
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.73 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.73 |
| COG3733 | Cu2+-containing amine oxidase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.73 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.73 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.73 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.73 |
| COG1110 | Reverse gyrase | Replication, recombination and repair [L] | 0.73 |
| COG0550 | DNA topoisomerase IA | Replication, recombination and repair [L] | 0.73 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.73 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.73 |
| COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.73 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.73 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.73 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.73 |
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 0.36 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.36 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.36 |
| COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 0.36 |
| COG2267 | Lysophospholipase, alpha-beta hydrolase superfamily | Lipid transport and metabolism [I] | 0.36 |
| COG2411 | Predicted RNA-binding protein, contains PUA-like ASCH domain | General function prediction only [R] | 0.36 |
| COG3097 | Uncharacterized conserved protein YqfB, UPF0267 family | Function unknown [S] | 0.36 |
| COG2216 | K+ transport ATPase, ATPase subunit KdpB | Inorganic ion transport and metabolism [P] | 0.36 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.36 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.36 |
| COG0011 | Thiamin-binding stress-response protein YqgV, UPF0045 family | Coenzyme transport and metabolism [H] | 0.36 |
| COG4405 | Predicted RNA-binding protein YhfF, contains PUA-like ASCH domain | General function prediction only [R] | 0.36 |
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.36 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.36 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.36 |
| COG0057 | Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase | Carbohydrate transport and metabolism [G] | 0.36 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.36 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.36 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.36 |
| COG1075 | Triacylglycerol esterase/lipase EstA, alpha/beta hydrolase fold | Lipid transport and metabolism [I] | 0.36 |
| COG0710 | 3-dehydroquinate dehydratase | Amino acid transport and metabolism [E] | 0.36 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.36 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.36 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.36 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.36 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.36 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.09 % |
| Unclassified | root | N/A | 2.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459015|G14TP7Y02GVF0T | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 572 | Open in IMG/M |
| 2170459019|G14TP7Y02G18I0 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 641 | Open in IMG/M |
| 2228664021|ICCgaii200_c0747887 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 926 | Open in IMG/M |
| 3300000156|NODE_c0736605 | All Organisms → cellular organisms → Archaea | 10318 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1018541 | All Organisms → cellular organisms → Archaea | 1112 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1061671 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 572 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1007575 | All Organisms → cellular organisms → Archaea | 2077 | Open in IMG/M |
| 3300000858|JGI10213J12805_10176297 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1014 | Open in IMG/M |
| 3300000953|JGI11615J12901_10142995 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 537 | Open in IMG/M |
| 3300002090|JGI24806J26614_1011306 | All Organisms → cellular organisms → Archaea | 1301 | Open in IMG/M |
| 3300002090|JGI24806J26614_1024914 | All Organisms → cellular organisms → Archaea | 585 | Open in IMG/M |
| 3300002099|JGI24808J26613_1013160 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1507 | Open in IMG/M |
| 3300002568|C688J35102_120729126 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera | 1435 | Open in IMG/M |
| 3300003319|soilL2_10057661 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1650 | Open in IMG/M |
| 3300003987|Ga0055471_10149071 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 713 | Open in IMG/M |
| 3300003999|Ga0055469_10134109 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 740 | Open in IMG/M |
| 3300003999|Ga0055469_10273154 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 543 | Open in IMG/M |
| 3300004052|Ga0055490_10257692 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 539 | Open in IMG/M |
| 3300004114|Ga0062593_100605689 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1046 | Open in IMG/M |
| 3300004114|Ga0062593_102004483 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 643 | Open in IMG/M |
| 3300004156|Ga0062589_102035507 | All Organisms → cellular organisms → Archaea | 583 | Open in IMG/M |
| 3300004156|Ga0062589_102844650 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 505 | Open in IMG/M |
| 3300004157|Ga0062590_100054886 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 2241 | Open in IMG/M |
| 3300004157|Ga0062590_100177630 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1504 | Open in IMG/M |
| 3300004463|Ga0063356_100922029 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1237 | Open in IMG/M |
| 3300004463|Ga0063356_101110626 | All Organisms → cellular organisms → Archaea | 1140 | Open in IMG/M |
| 3300004479|Ga0062595_100134175 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1403 | Open in IMG/M |
| 3300004479|Ga0062595_100516019 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 903 | Open in IMG/M |
| 3300004479|Ga0062595_100690854 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → unclassified Nitrososphaera → Nitrososphaera sp. AFS | 817 | Open in IMG/M |
| 3300004479|Ga0062595_101198526 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 674 | Open in IMG/M |
| 3300004479|Ga0062595_102384170 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 524 | Open in IMG/M |
| 3300004643|Ga0062591_101750448 | All Organisms → cellular organisms → Archaea | 632 | Open in IMG/M |
| 3300005184|Ga0066671_10045751 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 2177 | Open in IMG/M |
| 3300005184|Ga0066671_10598806 | All Organisms → cellular organisms → Archaea | 715 | Open in IMG/M |
| 3300005289|Ga0065704_10206139 | All Organisms → cellular organisms → Archaea | 1127 | Open in IMG/M |
| 3300005339|Ga0070660_101345233 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 606 | Open in IMG/M |
| 3300005366|Ga0070659_101690097 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 566 | Open in IMG/M |
| 3300005436|Ga0070713_101260969 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 716 | Open in IMG/M |
| 3300005437|Ga0070710_10207714 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1240 | Open in IMG/M |
| 3300005439|Ga0070711_100000615 | All Organisms → cellular organisms → Archaea | 18578 | Open in IMG/M |
| 3300005439|Ga0070711_101030522 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 707 | Open in IMG/M |
| 3300005558|Ga0066698_10856141 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 585 | Open in IMG/M |
| 3300005561|Ga0066699_11180623 | All Organisms → cellular organisms → Archaea | 526 | Open in IMG/M |
| 3300005616|Ga0068852_100770253 | All Organisms → cellular organisms → Archaea | 975 | Open in IMG/M |
| 3300005718|Ga0068866_10224461 | Not Available | 1135 | Open in IMG/M |
| 3300006028|Ga0070717_11343881 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 649 | Open in IMG/M |
| 3300006173|Ga0070716_100261362 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → unclassified Nitrososphaera → Nitrososphaera sp. AFS | 1184 | Open in IMG/M |
| 3300006173|Ga0070716_101740947 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 515 | Open in IMG/M |
| 3300006175|Ga0070712_101744691 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 545 | Open in IMG/M |
| 3300006755|Ga0079222_10064315 | All Organisms → cellular organisms → Archaea | 1773 | Open in IMG/M |
| 3300006755|Ga0079222_10357306 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 991 | Open in IMG/M |
| 3300006806|Ga0079220_11622637 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 561 | Open in IMG/M |
| 3300006806|Ga0079220_11984189 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 518 | Open in IMG/M |
| 3300006844|Ga0075428_100229260 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 2004 | Open in IMG/M |
| 3300006844|Ga0075428_100337582 | All Organisms → cellular organisms → Archaea | 1618 | Open in IMG/M |
| 3300006844|Ga0075428_101208712 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 797 | Open in IMG/M |
| 3300006845|Ga0075421_100029300 | Not Available | 6954 | Open in IMG/M |
| 3300006845|Ga0075421_101476886 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 744 | Open in IMG/M |
| 3300006845|Ga0075421_101728331 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → unclassified Nitrososphaera → Nitrososphaera sp. AFS | 676 | Open in IMG/M |
| 3300006847|Ga0075431_100078253 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 3413 | Open in IMG/M |
| 3300006847|Ga0075431_100330711 | All Organisms → cellular organisms → Archaea | 1534 | Open in IMG/M |
| 3300006847|Ga0075431_100700162 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 991 | Open in IMG/M |
| 3300006852|Ga0075433_11144368 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 676 | Open in IMG/M |
| 3300006853|Ga0075420_101771164 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 528 | Open in IMG/M |
| 3300006854|Ga0075425_100429809 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1521 | Open in IMG/M |
| 3300006871|Ga0075434_100118763 | Not Available | 2658 | Open in IMG/M |
| 3300006871|Ga0075434_100164455 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 2239 | Open in IMG/M |
| 3300006876|Ga0079217_10075539 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1441 | Open in IMG/M |
| 3300006876|Ga0079217_10086773 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1370 | Open in IMG/M |
| 3300006876|Ga0079217_10232666 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 969 | Open in IMG/M |
| 3300006876|Ga0079217_10564173 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 728 | Open in IMG/M |
| 3300006876|Ga0079217_10688176 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 685 | Open in IMG/M |
| 3300006894|Ga0079215_11258259 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 568 | Open in IMG/M |
| 3300006894|Ga0079215_11259404 | All Organisms → cellular organisms → Archaea | 568 | Open in IMG/M |
| 3300006903|Ga0075426_10060422 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 2707 | Open in IMG/M |
| 3300006904|Ga0075424_100179403 | All Organisms → cellular organisms → Archaea | 2246 | Open in IMG/M |
| 3300006914|Ga0075436_100401686 | All Organisms → cellular organisms → Archaea | 993 | Open in IMG/M |
| 3300006918|Ga0079216_10077235 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1541 | Open in IMG/M |
| 3300006918|Ga0079216_10149245 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1215 | Open in IMG/M |
| 3300006918|Ga0079216_10275604 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 978 | Open in IMG/M |
| 3300006918|Ga0079216_10291313 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 960 | Open in IMG/M |
| 3300006918|Ga0079216_10374164 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 882 | Open in IMG/M |
| 3300006918|Ga0079216_10994485 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 647 | Open in IMG/M |
| 3300007076|Ga0075435_100547477 | All Organisms → cellular organisms → Archaea | 1002 | Open in IMG/M |
| 3300007790|Ga0105679_10693128 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1117 | Open in IMG/M |
| 3300009012|Ga0066710_100489288 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → unclassified Nitrososphaera → Nitrososphaera sp. AFS | 1852 | Open in IMG/M |
| 3300009034|Ga0115863_1012318 | All Organisms → cellular organisms → Archaea | 12115 | Open in IMG/M |
| 3300009034|Ga0115863_1120355 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 3245 | Open in IMG/M |
| 3300009081|Ga0105098_10602617 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 572 | Open in IMG/M |
| 3300009094|Ga0111539_10031609 | All Organisms → cellular organisms → Archaea | 6430 | Open in IMG/M |
| 3300009157|Ga0105092_10065684 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1960 | Open in IMG/M |
| 3300009157|Ga0105092_10109277 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1521 | Open in IMG/M |
| 3300009174|Ga0105241_10674153 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 941 | Open in IMG/M |
| 3300009789|Ga0126307_10000029 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 81264 | Open in IMG/M |
| 3300009789|Ga0126307_10042618 | All Organisms → cellular organisms → Archaea | 3528 | Open in IMG/M |
| 3300009789|Ga0126307_10186048 | All Organisms → cellular organisms → Archaea | 1666 | Open in IMG/M |
| 3300009789|Ga0126307_10217320 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1534 | Open in IMG/M |
| 3300009806|Ga0105081_1040581 | All Organisms → cellular organisms → Archaea | 649 | Open in IMG/M |
| 3300009840|Ga0126313_10003684 | All Organisms → cellular organisms → Archaea | 8872 | Open in IMG/M |
| 3300009840|Ga0126313_10120431 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1952 | Open in IMG/M |
| 3300009840|Ga0126313_11435438 | All Organisms → cellular organisms → Archaea | 572 | Open in IMG/M |
| 3300010036|Ga0126305_10012597 | All Organisms → cellular organisms → Archaea | 4292 | Open in IMG/M |
| 3300010036|Ga0126305_10013037 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae | 4226 | Open in IMG/M |
| 3300010036|Ga0126305_10074998 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera | 1980 | Open in IMG/M |
| 3300010036|Ga0126305_10287747 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1064 | Open in IMG/M |
| 3300010036|Ga0126305_11231815 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 517 | Open in IMG/M |
| 3300010037|Ga0126304_10002402 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 9239 | Open in IMG/M |
| 3300010037|Ga0126304_10051881 | All Organisms → cellular organisms → Archaea | 2493 | Open in IMG/M |
| 3300010038|Ga0126315_10002088 | All Organisms → cellular organisms → Archaea | 8153 | Open in IMG/M |
| 3300010038|Ga0126315_10087267 | Not Available | 1768 | Open in IMG/M |
| 3300010038|Ga0126315_10183958 | All Organisms → cellular organisms → Archaea | 1252 | Open in IMG/M |
| 3300010038|Ga0126315_10373212 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 892 | Open in IMG/M |
| 3300010038|Ga0126315_10419046 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 844 | Open in IMG/M |
| 3300010038|Ga0126315_10651888 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 684 | Open in IMG/M |
| 3300010039|Ga0126309_10423849 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 802 | Open in IMG/M |
| 3300010040|Ga0126308_10159856 | All Organisms → cellular organisms → Archaea | 1428 | Open in IMG/M |
| 3300010040|Ga0126308_10673343 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 710 | Open in IMG/M |
| 3300010041|Ga0126312_10000022 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 56731 | Open in IMG/M |
| 3300010041|Ga0126312_10079459 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera | 2220 | Open in IMG/M |
| 3300010041|Ga0126312_10692585 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 735 | Open in IMG/M |
| 3300010041|Ga0126312_11349769 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 528 | Open in IMG/M |
| 3300010042|Ga0126314_10011826 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 5010 | Open in IMG/M |
| 3300010042|Ga0126314_10228214 | All Organisms → cellular organisms → Archaea | 1317 | Open in IMG/M |
| 3300010042|Ga0126314_10311509 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1125 | Open in IMG/M |
| 3300010042|Ga0126314_10467242 | All Organisms → cellular organisms → Archaea | 913 | Open in IMG/M |
| 3300010044|Ga0126310_10097659 | Not Available | 1772 | Open in IMG/M |
| 3300010044|Ga0126310_10424432 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 953 | Open in IMG/M |
| 3300010045|Ga0126311_10033015 | All Organisms → cellular organisms → Archaea | 3200 | Open in IMG/M |
| 3300010045|Ga0126311_10997125 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 685 | Open in IMG/M |
| 3300010045|Ga0126311_11002083 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 683 | Open in IMG/M |
| 3300010045|Ga0126311_11170975 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 635 | Open in IMG/M |
| 3300010045|Ga0126311_11215282 | All Organisms → cellular organisms → Archaea | 624 | Open in IMG/M |
| 3300010047|Ga0126382_10249133 | All Organisms → cellular organisms → Archaea | 1300 | Open in IMG/M |
| 3300010047|Ga0126382_12285114 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon | 522 | Open in IMG/M |
| 3300010166|Ga0126306_10019957 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 4414 | Open in IMG/M |
| 3300010166|Ga0126306_10041207 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae | 3166 | Open in IMG/M |
| 3300010166|Ga0126306_11465513 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 566 | Open in IMG/M |
| 3300010361|Ga0126378_10372460 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → unclassified Nitrososphaera → Nitrososphaera sp. AFS | 1539 | Open in IMG/M |
| 3300010371|Ga0134125_10883404 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 982 | Open in IMG/M |
| 3300010396|Ga0134126_10115586 | All Organisms → cellular organisms → Archaea | 3284 | Open in IMG/M |
| 3300010396|Ga0134126_10240218 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 2147 | Open in IMG/M |
| 3300010403|Ga0134123_11293267 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 764 | Open in IMG/M |
| 3300011400|Ga0137312_1079388 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 570 | Open in IMG/M |
| 3300012201|Ga0137365_10186445 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1553 | Open in IMG/M |
| 3300012204|Ga0137374_10031740 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae | 5764 | Open in IMG/M |
| 3300012211|Ga0137377_10175418 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotenuis | 2057 | Open in IMG/M |
| 3300012354|Ga0137366_10598706 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 791 | Open in IMG/M |
| 3300012356|Ga0137371_10743949 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 749 | Open in IMG/M |
| 3300012507|Ga0157342_1074509 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 522 | Open in IMG/M |
| 3300012884|Ga0157300_1005191 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
| 3300012884|Ga0157300_1008582 | All Organisms → Viruses → Predicted Viral | 1177 | Open in IMG/M |
| 3300012885|Ga0157287_1100631 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 536 | Open in IMG/M |
| 3300012893|Ga0157284_10104410 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 745 | Open in IMG/M |
| 3300012896|Ga0157303_10072250 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 769 | Open in IMG/M |
| 3300012912|Ga0157306_10207023 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 664 | Open in IMG/M |
| 3300012915|Ga0157302_10135627 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 820 | Open in IMG/M |
| 3300012943|Ga0164241_10101205 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae | 2070 | Open in IMG/M |
| 3300012958|Ga0164299_10170640 | All Organisms → cellular organisms → Archaea | 1226 | Open in IMG/M |
| 3300012960|Ga0164301_10176994 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1335 | Open in IMG/M |
| 3300012989|Ga0164305_11825112 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 550 | Open in IMG/M |
| 3300014263|Ga0075324_1049854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales | 814 | Open in IMG/M |
| 3300014487|Ga0182000_10285993 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → unclassified Nitrososphaera → Nitrososphaera sp. AFS | 680 | Open in IMG/M |
| 3300014497|Ga0182008_10004754 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 7862 | Open in IMG/M |
| 3300014497|Ga0182008_10005785 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus → Candidatus Nitrosocosmicus oleophilus | 6996 | Open in IMG/M |
| 3300014497|Ga0182008_10235269 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 941 | Open in IMG/M |
| 3300014497|Ga0182008_10283416 | All Organisms → cellular organisms → Archaea | 863 | Open in IMG/M |
| 3300014497|Ga0182008_10437622 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 709 | Open in IMG/M |
| 3300015077|Ga0173483_10008020 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus | 3560 | Open in IMG/M |
| 3300015077|Ga0173483_10117420 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1133 | Open in IMG/M |
| 3300015077|Ga0173483_10131532 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1082 | Open in IMG/M |
| 3300015077|Ga0173483_10207317 | All Organisms → cellular organisms → Archaea | 906 | Open in IMG/M |
| 3300015261|Ga0182006_1295611 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 531 | Open in IMG/M |
| 3300015371|Ga0132258_10682060 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 2586 | Open in IMG/M |
| 3300015372|Ga0132256_103180034 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 552 | Open in IMG/M |
| 3300015373|Ga0132257_100339116 | All Organisms → cellular organisms → Archaea | 1814 | Open in IMG/M |
| 3300017999|Ga0187767_10307315 | Not Available | 543 | Open in IMG/M |
| 3300018028|Ga0184608_10240448 | Not Available | 796 | Open in IMG/M |
| 3300018031|Ga0184634_10110765 | All Organisms → cellular organisms → Archaea | 1206 | Open in IMG/M |
| 3300018064|Ga0187773_10504534 | All Organisms → cellular organisms → Archaea | 722 | Open in IMG/M |
| 3300018067|Ga0184611_1190000 | All Organisms → cellular organisms → Archaea | 730 | Open in IMG/M |
| 3300018072|Ga0184635_10004999 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus | 4257 | Open in IMG/M |
| 3300018072|Ga0184635_10310226 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 615 | Open in IMG/M |
| 3300018073|Ga0184624_10055507 | All Organisms → cellular organisms → Archaea | 1615 | Open in IMG/M |
| 3300018075|Ga0184632_10241372 | All Organisms → cellular organisms → Archaea | 791 | Open in IMG/M |
| 3300018076|Ga0184609_10211415 | All Organisms → cellular organisms → Archaea | 905 | Open in IMG/M |
| 3300018085|Ga0187772_10140623 | All Organisms → cellular organisms → Archaea | 1589 | Open in IMG/M |
| 3300018432|Ga0190275_10093416 | All Organisms → cellular organisms → Archaea | 2646 | Open in IMG/M |
| 3300018465|Ga0190269_10781528 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 683 | Open in IMG/M |
| 3300018466|Ga0190268_11371182 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 603 | Open in IMG/M |
| 3300018469|Ga0190270_13441602 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 502 | Open in IMG/M |
| 3300018481|Ga0190271_10382996 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1496 | Open in IMG/M |
| 3300018481|Ga0190271_12956555 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 570 | Open in IMG/M |
| 3300019356|Ga0173481_10008081 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 2903 | Open in IMG/M |
| 3300019356|Ga0173481_10096631 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1127 | Open in IMG/M |
| 3300019356|Ga0173481_10130528 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1010 | Open in IMG/M |
| 3300019356|Ga0173481_10821087 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 516 | Open in IMG/M |
| 3300019361|Ga0173482_10049882 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1355 | Open in IMG/M |
| 3300019362|Ga0173479_10008465 | All Organisms → cellular organisms → Archaea | 2582 | Open in IMG/M |
| 3300019487|Ga0187893_10171180 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus | 1723 | Open in IMG/M |
| 3300019767|Ga0190267_10892304 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 607 | Open in IMG/M |
| 3300019868|Ga0193720_1016520 | All Organisms → cellular organisms → Archaea | 1038 | Open in IMG/M |
| 3300019873|Ga0193700_1062966 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 563 | Open in IMG/M |
| 3300019875|Ga0193701_1031404 | All Organisms → Viruses → Predicted Viral | 1090 | Open in IMG/M |
| 3300019884|Ga0193741_1003415 | All Organisms → cellular organisms → Archaea | 4396 | Open in IMG/M |
| 3300019884|Ga0193741_1054862 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1027 | Open in IMG/M |
| 3300021078|Ga0210381_10134065 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 830 | Open in IMG/M |
| 3300021445|Ga0182009_10016885 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae | 2684 | Open in IMG/M |
| 3300021445|Ga0182009_10041207 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1909 | Open in IMG/M |
| 3300021445|Ga0182009_10285421 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 828 | Open in IMG/M |
| 3300021445|Ga0182009_10353925 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 750 | Open in IMG/M |
| 3300021445|Ga0182009_10536216 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 620 | Open in IMG/M |
| 3300021560|Ga0126371_11851317 | All Organisms → cellular organisms → Archaea | 724 | Open in IMG/M |
| 3300022557|Ga0212123_10304332 | All Organisms → cellular organisms → Archaea | 1113 | Open in IMG/M |
| 3300025537|Ga0210061_1000006 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus | 20392 | Open in IMG/M |
| 3300025898|Ga0207692_10504175 | All Organisms → cellular organisms → Archaea | 768 | Open in IMG/M |
| 3300025899|Ga0207642_10267147 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 978 | Open in IMG/M |
| 3300025904|Ga0207647_10316153 | All Organisms → cellular organisms → Archaea | 887 | Open in IMG/M |
| 3300025905|Ga0207685_10004225 | Not Available | 3619 | Open in IMG/M |
| 3300025905|Ga0207685_10409570 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 697 | Open in IMG/M |
| 3300025916|Ga0207663_10000157 | All Organisms → cellular organisms → Archaea | 31596 | Open in IMG/M |
| 3300026078|Ga0207702_10903066 | All Organisms → cellular organisms → Archaea | 875 | Open in IMG/M |
| 3300026142|Ga0207698_11289281 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 745 | Open in IMG/M |
| 3300026535|Ga0256867_10043577 | All Organisms → cellular organisms → Archaea | 1835 | Open in IMG/M |
| 3300027360|Ga0209969_1027147 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 867 | Open in IMG/M |
| 3300027636|Ga0214469_1178330 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 589 | Open in IMG/M |
| 3300027637|Ga0209818_1045438 | All Organisms → Viruses → Predicted Viral | 1049 | Open in IMG/M |
| 3300027637|Ga0209818_1056908 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 960 | Open in IMG/M |
| 3300027637|Ga0209818_1058901 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 947 | Open in IMG/M |
| 3300027650|Ga0256866_1021651 | All Organisms → cellular organisms → Archaea | 1644 | Open in IMG/M |
| 3300027717|Ga0209998_10107390 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 695 | Open in IMG/M |
| 3300027718|Ga0209795_10179104 | All Organisms → cellular organisms → Archaea | 596 | Open in IMG/M |
| 3300027722|Ga0209819_10036663 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1666 | Open in IMG/M |
| 3300027743|Ga0209593_10009378 | All Organisms → cellular organisms → Archaea | 4047 | Open in IMG/M |
| 3300027880|Ga0209481_10592026 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 575 | Open in IMG/M |
| 3300027886|Ga0209486_10660880 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 670 | Open in IMG/M |
| 3300027909|Ga0209382_10019904 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 8158 | Open in IMG/M |
| 3300027909|Ga0209382_10107376 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 3265 | Open in IMG/M |
| 3300027909|Ga0209382_10777238 | All Organisms → cellular organisms → Archaea | 1022 | Open in IMG/M |
| 3300028705|Ga0307276_10001500 | All Organisms → cellular organisms → Archaea | 3278 | Open in IMG/M |
| 3300028705|Ga0307276_10065095 | All Organisms → cellular organisms → Archaea | 833 | Open in IMG/M |
| 3300028828|Ga0307312_11095110 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 527 | Open in IMG/M |
| 3300030006|Ga0299907_10478463 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 988 | Open in IMG/M |
| 3300030496|Ga0268240_10083537 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 729 | Open in IMG/M |
| 3300030511|Ga0268241_10028563 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → unclassified Nitrososphaera → Nitrososphaera sp. AFS | 1126 | Open in IMG/M |
| 3300030511|Ga0268241_10059048 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 836 | Open in IMG/M |
| 3300031093|Ga0308197_10443102 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 519 | Open in IMG/M |
| 3300031229|Ga0299913_12004271 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 525 | Open in IMG/M |
| 3300031274|Ga0307442_1002916 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 8199 | Open in IMG/M |
| 3300031538|Ga0310888_10768738 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 595 | Open in IMG/M |
| 3300031548|Ga0307408_100272124 | All Organisms → cellular organisms → Archaea | 1407 | Open in IMG/M |
| 3300031562|Ga0310886_10509276 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 727 | Open in IMG/M |
| 3300031585|Ga0315534_1020731 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae | 3184 | Open in IMG/M |
| 3300031824|Ga0307413_10120896 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 1774 | Open in IMG/M |
| 3300031824|Ga0307413_10535690 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 947 | Open in IMG/M |
| 3300031847|Ga0310907_10065630 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1462 | Open in IMG/M |
| 3300031852|Ga0307410_10365831 | All Organisms → cellular organisms → Archaea | 1156 | Open in IMG/M |
| 3300031854|Ga0310904_10885192 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 630 | Open in IMG/M |
| 3300031854|Ga0310904_10915791 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 620 | Open in IMG/M |
| 3300031903|Ga0307407_10166732 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 1447 | Open in IMG/M |
| 3300031911|Ga0307412_10924221 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 766 | Open in IMG/M |
| 3300031938|Ga0308175_100123099 | All Organisms → cellular organisms → Archaea | 2437 | Open in IMG/M |
| 3300031938|Ga0308175_102591777 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 567 | Open in IMG/M |
| 3300031944|Ga0310884_10431347 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 763 | Open in IMG/M |
| 3300031996|Ga0308176_11727670 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 668 | Open in IMG/M |
| 3300032002|Ga0307416_100110870 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 2417 | Open in IMG/M |
| 3300032002|Ga0307416_101546100 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 769 | Open in IMG/M |
| 3300032004|Ga0307414_10115934 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 2050 | Open in IMG/M |
| 3300032005|Ga0307411_10886427 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 792 | Open in IMG/M |
| 3300032013|Ga0310906_10211441 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1184 | Open in IMG/M |
| 3300032074|Ga0308173_11214795 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 705 | Open in IMG/M |
| 3300032075|Ga0310890_10740443 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 773 | Open in IMG/M |
| 3300032122|Ga0310895_10393032 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 677 | Open in IMG/M |
| 3300032782|Ga0335082_10264285 | All Organisms → cellular organisms → Archaea | 1600 | Open in IMG/M |
| 3300034113|Ga0364937_004024 | All Organisms → cellular organisms → Archaea | 1942 | Open in IMG/M |
| 3300034377|Ga0334931_089859 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 712 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 14.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.55% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.36% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 7.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.36% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.36% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.64% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.55% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.18% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.82% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.82% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.82% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.45% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.45% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.09% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.09% |
| Sediment, Intertidal | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal | 0.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.73% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.73% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.73% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.73% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.36% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.36% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.36% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.36% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.36% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.36% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.36% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.36% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.36% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.36% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.36% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.36% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.36% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.36% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.36% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.36% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.36% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.36% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.36% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.36% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459015 | Litter degradation PV4 | Engineered | Open in IMG/M |
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300002090 | Soil microbial communities from Manhattan, Kansas, USA - Sample 200um MDA | Environmental | Open in IMG/M |
| 3300002099 | Soil microbial communities from Manhattan, Kansas, USA - Sample 400um MDA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
| 3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004052 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009034 | Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, Korea | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009806 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011400 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 | Environmental | Open in IMG/M |
| 3300012885 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 | Environmental | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300019868 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1 | Environmental | Open in IMG/M |
| 3300019873 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1 | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025537 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027636 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeq | Environmental | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027650 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq | Environmental | Open in IMG/M |
| 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027718 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031274 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-30 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031585 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-40 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300034113 | Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17 | Environmental | Open in IMG/M |
| 3300034377 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 27HNS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4PV_00443100 | 2170459015 | Switchgrass, Maize And Mischanthus Litter | ICKKRLFEHSRLQDRICKMITIKQFANNSPGFDVQFRPFFEKEGD |
| 4MG_04340220 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | MHMASCPICKKKMSEHSELQDKICKMITIKQFANYSPGYDVQFRPFFEE |
| ICCgaii200_07478871 | 2228664021 | Soil | MNCEAACPICKKKLIEHSELQDKICKMITIKEFANNSPGFDVQFRPFFEEEED |
| NODE_07366053 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MNDDDKAICPICKNKLKEHSELQDKICNMIIIKQFANNCPGFDVQFRPFFVKKEEEDN* |
| AF_2010_repII_A01DRAFT_10185413 | 3300000580 | Forest Soil | MTYWYIVNRQPICPICKQKITEHTEFQDKICKMITIKQFANNCPGFDVQFRPFFED* |
| AF_2010_repII_A01DRAFT_10616712 | 3300000580 | Forest Soil | MSSWCIVNRQPICLICKQKLTEHTELQDKICKMITVKQFANNCPGFDVQFRPFFED* |
| AF_2010_repII_A100DRAFT_10075751 | 3300000655 | Forest Soil | MANHNQWCPICKKNLSEHSKLQYKICEMITIKQFANVCPGYDVQFR |
| JGI10213J12805_101762971 | 3300000858 | Soil | MCPICKKKLIEHSELQDKICKMITIKQFANNSPGFDVQFRPFFED* |
| JGI11615J12901_101429951 | 3300000953 | Soil | ELQDKICNMIIIKQFANNCPGFDVQFRPFFGKEDEEGEVDE* |
| JGI24806J26614_10113061 | 3300002090 | Soil | HSELQDKICEMITIKQFANESPGFDIQFRPFFEDN* |
| JGI24806J26614_10249142 | 3300002090 | Soil | HSELQDKICEMITIKQFANESPGFDIQFRPFFEEN* |
| JGI24808J26613_10131603 | 3300002099 | Soil | MSHETMISPVCKKKLAEHSKLQDKICEMITIKQFANDSPGFDIQFRPFFKED* |
| C688J35102_1207291263 | 3300002568 | Soil | MEHSQLQDRICKMITIKQFANNSPGFDAQFRPFFEKEED* |
| soilL2_100576612 | 3300003319 | Sugarcane Root And Bulk Soil | MNIGRDTKCPICKKKFIEHSELQDKICEMITIKQFANISPGFDVQHRPFFED* |
| Ga0055471_101490712 | 3300003987 | Natural And Restored Wetlands | MMNVGKETKCPICKKKFIEHSELQDKICKMITIKQFANISPGFDVQHRPFFED* |
| Ga0055469_101341092 | 3300003999 | Natural And Restored Wetlands | NVGKETKCPICKKKFIEHSELQDKICKMITIKQFANISPGFDVQHRPFFED* |
| Ga0055469_102731541 | 3300003999 | Natural And Restored Wetlands | MCPICKKKFIEHSELQDKICKMITIKQFANNSPGFDVQFRPFFED* |
| Ga0055490_102576921 | 3300004052 | Natural And Restored Wetlands | MNIMKIGKETKCPICKKKFIEHSELQDKICNMITIKQFANISPGFDVQHRPFFDD* |
| Ga0062593_1006056891 | 3300004114 | Soil | MYMASCPICKKKLSEHSDLQDKICKMITIKQFANYSPGYDVQFRPFLEE* |
| Ga0062593_1020044831 | 3300004114 | Soil | MHMASCPICKKKMSEHSELQDKICKMITIKQFANYSPGYDVQFRPFFEE* |
| Ga0062589_1020355072 | 3300004156 | Soil | VFIAVDYKSMCPICKKKFIEHSELQDKICRMITIKQFANNSPGFDVQFRPFFKED* |
| Ga0062589_1028446501 | 3300004156 | Soil | MALCPICKKKLSEHTESQEKICKMITIKQFANNSPGYDIQFRPFFEE* |
| Ga0062590_1000548863 | 3300004157 | Soil | MNNDDTAICPICKNKLKEHSELQDKICNMIIIKQFANNCRGFDIQFRPFFEKGDEQV* |
| Ga0062590_1001776302 | 3300004157 | Soil | MNNDYRAICPICKNKLKQHSELQDKIYNMIIIKQFANNCPGFDIQFRPFFEKGEAED* |
| Ga0063356_1009220293 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MNCEAACPICKKKLIEHSELQDKICKMITIKEFANNSPGFDVQFRPFFEEEED* |
| Ga0063356_1011106261 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LIEHSQLQDKICKMITIKQFANNSPNFDVQFRPFFEEEGGGV* |
| Ga0062595_1001341753 | 3300004479 | Soil | LIEHSQLQDKICKMITIKQFANNSPNFDVQFRPFFEEEEGGGV* |
| Ga0062595_1005160193 | 3300004479 | Soil | MNCEAACHICKKKLIEHSQLQDKIYKMITIKQFANNSPGFDVQFRPFFEEEED* |
| Ga0062595_1006908542 | 3300004479 | Soil | MNNNNDKAICPICKNKLKEHSELQDKICNMVIIKQFANNCPGFDVQYRPFFEKEEEQV* |
| Ga0062595_1011985262 | 3300004479 | Soil | MSHKAICPICKKRLFEHSMLQDRICKMITIKQFANNSPGFDVQFRPFFEKEGD* |
| Ga0062595_1023841701 | 3300004479 | Soil | MASCPICKKKMSEHSELQDKICKMITIKQFANYSPGYDVQFRPFFEE* |
| Ga0062591_1017504481 | 3300004643 | Soil | MNNNNRAMCPICKNKLTEHSELQDKICNMIIKNPGFDLHFRPFFDKEEALDINSLDVGTK |
| Ga0066671_100457515 | 3300005184 | Soil | MNNDRAICPICKNKLKEHSELKDKICNMIIIKQFGNNCPGFDILFRPFFEKEGEQD* |
| Ga0066671_105988061 | 3300005184 | Soil | MNHHKAVCPICKKKLIEHSELQNRICKMITIKQFANNCPGFDVQFRPFFGKEED* |
| Ga0065704_102061392 | 3300005289 | Switchgrass Rhizosphere | MNHEAMCPVCKEKLAEHSELQDKICEMITIKQFANESPGFDIQFRPFFEEN* |
| Ga0070660_1013452332 | 3300005339 | Corn Rhizosphere | MNSQTMCPICKKKLIEHSELQEKICKMITIKQFANNSPGFDVQFRPFFED* |
| Ga0070659_1016900971 | 3300005366 | Corn Rhizosphere | MMNVGKETKCPICKKRFIDHSELQDKICKMITIKQFANISPGFDVQHRPFFED* |
| Ga0070713_1012609692 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MNHKAICPICKKRLFEHSRLQDRICKMITIKQFANNSPGFDVQFRPFSEKEGD* |
| Ga0070710_102077142 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MHMASCPICKKKMSEHSELQDKICKMITIKQFANYSPDYDVQFRPFFEE* |
| Ga0070711_1000006158 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MPDIKHLMTNIFIMYFDYFCYVLQMNNNRAICPICKNKLTEHSELQDKICNMIIIKQFANNCPGFDVQFRPFFEKEES* |
| Ga0070711_1010305221 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MNNDRAICSICKNKLTEHSELQDKICNMIIIKQFANNCPGFDVQFRPFFEKEEEEG* |
| Ga0066698_108561411 | 3300005558 | Soil | EHSEFQDKICKMVTIKQFANNSPGFDVAFRPFFEDE* |
| Ga0066699_111806232 | 3300005561 | Soil | KKLIKHSKLQEKICKMITIKEFSNNSPGFDVQFRPFFED* |
| Ga0068852_1007702531 | 3300005616 | Corn Rhizosphere | VDHSEFQDKICRMITIKQFTNNSPGFDVPFRPFFEDDI* |
| Ga0068866_102244614 | 3300005718 | Miscanthus Rhizosphere | MNVGKETKCPICKKKFIDHSELQDKICKMITIKQFANISPGFDVQHRPFFED* |
| Ga0070717_113438812 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MNHKAICPICKKRLFEHSRLQDRICKMITIKQFANNSPGFDVKFRPFSEKEGD* |
| Ga0070716_1002613621 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MNHKAICPICKKRLFEHSRLQDRICKMITIKQFANNSPGFDVQFRPFFEKEGD* |
| Ga0070716_1017409471 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MHKHNRAICPICKIKLTDHSELQDKICNMIIIKQFANNCPGFDVQFRPFLEKEEES* |
| Ga0070712_1017446912 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MNHHKAVCPICKKKLIEHSELQDRICKMITIKQFANNCPGFDVQFRPFFGKEED* |
| Ga0079222_100643153 | 3300006755 | Agricultural Soil | MNHKDICPICKKRLFEHSKLQGRICKMITIKQFANNSPGFDVQFRPFFEKEGD* |
| Ga0079222_103573061 | 3300006755 | Agricultural Soil | MNDDKTICPICTNKLKEHSELQDKICNMIIIKQFANNCPGFDVQFRPFFGKEEEQ* |
| Ga0079220_116226371 | 3300006806 | Agricultural Soil | SEHSDLQDKICKMITIKQFANYSPGYDVQFRPFLV* |
| Ga0079220_119841892 | 3300006806 | Agricultural Soil | MNERLCPICKKKLLEHSELQDKICKMITIKQFANNSPGFDVQFR |
| Ga0075428_1002292602 | 3300006844 | Populus Rhizosphere | VFIEVDYKSMCPICKKKFIEHSELQDKICRMITIKQFANNSPGFDVQFRPFFED* |
| Ga0075428_1003375822 | 3300006844 | Populus Rhizosphere | MNIGKETKCPICKKKFIEHSELQDNICEMITIKQFANISPGFDVQFRPFFED* |
| Ga0075428_1012087122 | 3300006844 | Populus Rhizosphere | MLNVGKETKCPICKKKFIEHSELQDKICKMITIKQFANISPGFDVQHRPFFED* |
| Ga0075421_10002930013 | 3300006845 | Populus Rhizosphere | MMTCPICKNKLKKHSELQDKICNMIIIKQFANNCPGFDVQLWPFFE* |
| Ga0075421_1014768861 | 3300006845 | Populus Rhizosphere | MCPICKKKLIEHSELQEKICEMITIKQFANNSPGFDVQFRPFF |
| Ga0075421_1017283312 | 3300006845 | Populus Rhizosphere | MNKDKAICPICKNKLKEHSELQDKICNMIIIKQFANNYCPSFDVQFRP |
| Ga0075431_1000782532 | 3300006847 | Populus Rhizosphere | MCPICKKKFIEHSELQDKICRMITIKQFANNSPGFDVQFRPFFED* |
| Ga0075431_1003307111 | 3300006847 | Populus Rhizosphere | DKICNMIIIKQFANNYCPSFDVQFRPFFEKEEEQV* |
| Ga0075431_1007001622 | 3300006847 | Populus Rhizosphere | MNNNNDKAICPICKNKLKEHSELQDKICNMVIIKQFANNCPGFDVQLWPFFE* |
| Ga0075433_111443682 | 3300006852 | Populus Rhizosphere | MNSQTMCPICKKKLIEHSELQEKICKMITIKQFANNSPGFDVQFRPFFE |
| Ga0075420_1017711641 | 3300006853 | Populus Rhizosphere | GKETKCPICKKKFIEHSELQDNICEMITIKQFANISPGFDVQFRPFFED* |
| Ga0075425_1004298092 | 3300006854 | Populus Rhizosphere | MNNDNKATCPICKNKLKQHSELQGKICNMIIIKQFANNCPDFDVQFRPFFEKQEQEG* |
| Ga0075434_1001187631 | 3300006871 | Populus Rhizosphere | MSEHSELQDKICKMITIKQFANYSPGYDVQFRPFFEE* |
| Ga0075434_1001644553 | 3300006871 | Populus Rhizosphere | MNNNDDKAICPICKNKLKHHSELQDKICNMIIIKQFANNCPGFDVQFRPFFGKEEQED* |
| Ga0079217_100755394 | 3300006876 | Agricultural Soil | MNVGKETRCPICKKKFIEHSELQDKICKMITIKQFANISPGFDVQHRPFFED* |
| Ga0079217_100867731 | 3300006876 | Agricultural Soil | MNIGKETKCPICKKKFIEHSELQDKICRMITIQQFSNYSPGFDVQHRPFFED* |
| Ga0079217_102326662 | 3300006876 | Agricultural Soil | MNVGKETKCPICKKKFIEHSELQDKICEMITIKQFANISPGFNVQHRPFFRD* |
| Ga0079217_105641731 | 3300006876 | Agricultural Soil | MCPICKNKFIEHSELQDKICKMITIKQFANISPGFDVQYRPFFED* |
| Ga0079217_106881761 | 3300006876 | Agricultural Soil | MNPQTMCPICKKKLIEHSELQDKICKMITIKQFANNSPGFDVQHRPFFED* |
| Ga0079215_112582592 | 3300006894 | Agricultural Soil | MNVGKETKCPICKKKFIEHSELQDKICKMITIKQFANISPGFDVQHRHFFED* |
| Ga0079215_112594041 | 3300006894 | Agricultural Soil | MNVGKETKCPICKKKFIEHSELQDKICKMITMKQFANISPGFDVQHRPFFED* |
| Ga0075426_100604222 | 3300006903 | Populus Rhizosphere | MHKHNRTICPICKIKLTDHSELQDKICNMIIIKQFANNCPGFDVQFRPFFEKQEQEG* |
| Ga0075424_1001794033 | 3300006904 | Populus Rhizosphere | MNHKDICPICKKRLFEHSKLQDRICKMITIKQFANNSPGFDVQFRPFFEKEGD* |
| Ga0075436_1004016862 | 3300006914 | Populus Rhizosphere | CKKRLFEHSKLQDRICKMITIKQFANNSPGFDVQFRPFFEKEGD* |
| Ga0079216_100772352 | 3300006918 | Agricultural Soil | IEHSELQDKICRMITIKQFANNSPGFDVQHRPFFED* |
| Ga0079216_101492451 | 3300006918 | Agricultural Soil | MMNVGKETKCPICKKKFIEHSELQDKICKMMTIKQFANISPGFDVQHRPFFED* |
| Ga0079216_102756042 | 3300006918 | Agricultural Soil | MNIGEETKCPICKKKFIEHSELQDKICRMITIQQFSNYCLGFDVQHRPFFED* |
| Ga0079216_102913131 | 3300006918 | Agricultural Soil | MNYNPMCPICKKKFIEHSELQDKICRMITIKQFANNSPGFDVQFRPFFED* |
| Ga0079216_103741641 | 3300006918 | Agricultural Soil | MCPICKKKFIEHSELQDKICRMITIQQFANYSPGFDVQHRPF |
| Ga0079216_109944851 | 3300006918 | Agricultural Soil | MNIGKETKCPICKKKFIEHSELQDKICRMITIQQFSNY |
| Ga0075435_1005474772 | 3300007076 | Populus Rhizosphere | MNNDNKATCPICKNKLKQHSELQGKICNMIIIKQFANNCPGFDVQFRPFFEKVEEEEG* |
| Ga0105679_106931282 | 3300007790 | Soil | MCSVCKKKLSEHSELQDKICEMITIKQFANDSPGFDIQFRPFFEED* |
| Ga0066710_1004892881 | 3300009012 | Grasslands Soil | MIYWYIVNRKPLCPICKQRITEHSELQDKICKMITVKQLANNCPGFDAQFRPFFED |
| Ga0115863_10123182 | 3300009034 | Sediment, Intertidal | MKIGKETKCPICKKKFIEHSELQDKICKMITIKQFANNSPGFDVQHRPFFED* |
| Ga0115863_11203555 | 3300009034 | Sediment, Intertidal | MKVGKETKCPICKKKFIEHSELQDKICKMITIKQFANNSPGFDVQHRPFFED* |
| Ga0105098_106026172 | 3300009081 | Freshwater Sediment | FDSVFIAVDYKSMCPICKKKFFEHSELQDKICRMITIKQFANNSPGFDVQFRPFFED* |
| Ga0111539_100316094 | 3300009094 | Populus Rhizosphere | MCPICKKKLIEHSELQEKICKMITIKQFANNSPGFDVQFRPFFED* |
| Ga0105092_100656843 | 3300009157 | Freshwater Sediment | MNIGKETKCPICKKKFIEHSELQDNICEMITIKQFANISPGFDVQHRPFFED* |
| Ga0105092_101092772 | 3300009157 | Freshwater Sediment | CKKKFIEHSELQDKICKMITIKQFANNSPGFDVQHRPFFED* |
| Ga0105241_106741531 | 3300009174 | Corn Rhizosphere | VCCYVIMHTASCPICKKKMSEHSELQDKICKMITIKQFANYSPGYDVQFRPFFEE* |
| Ga0126307_1000002953 | 3300009789 | Serpentine Soil | MKYNLMCPICKKKIIEHSELQDKICRMITIKQFANNSPGFDVQYRPFFED* |
| Ga0126307_100426186 | 3300009789 | Serpentine Soil | MCPICKKKFLEHSELQDKICRMITINQFANNSPGFDVQFRPFFED* |
| Ga0126307_101860482 | 3300009789 | Serpentine Soil | EHSELQDKICEMITIKQFANDSPGFDIQFRPFFED* |
| Ga0126307_102173202 | 3300009789 | Serpentine Soil | MNHEMMCPVCKKKLDEHSELQDKICEMITIKQFANDFPGFDIQFRPFFEED* |
| Ga0105081_10405812 | 3300009806 | Groundwater Sand | QVKCPICKMKFTEHSEFQDKICKMITIKQFANNSPGFDVQFRPFFED* |
| Ga0126313_100036849 | 3300009840 | Serpentine Soil | MCPICKKKIIEHSELQDKICRMITIKQFANNSPGFDVQYRPFFED* |
| Ga0126313_101204312 | 3300009840 | Serpentine Soil | MNHERMCPVCKKKLAEHSELQDKICEMITIKQFANDSPGFDIQFRPFFED* |
| Ga0126313_114354381 | 3300009840 | Serpentine Soil | MICPVCKKKLSEHSELQDKICEMITIKQFANDSPGFDIQFRPF |
| Ga0126305_100125974 | 3300010036 | Serpentine Soil | LLFQDICDHDMNPQTMCPICKKKLIEHSELQDKICKMITIKQYANNSPGFDVQHRPFFED |
| Ga0126305_100130374 | 3300010036 | Serpentine Soil | MKPQFIFPICKKKFSEHSELQDKICKMITIKQFANISPGFDVQHRPFFED* |
| Ga0126305_100749983 | 3300010036 | Serpentine Soil | EHSELQDKICEMITIKQFANDSPGFDIKFRPFFED* |
| Ga0126305_102877471 | 3300010036 | Serpentine Soil | RKLIDHSELQDKICEMITIKQFANNSPGFDVQFRPFFED* |
| Ga0126305_112318152 | 3300010036 | Serpentine Soil | KLAEHSELQDKICEMITIKQFANDSPGFDIQFRPFFEED* |
| Ga0126304_100024023 | 3300010037 | Serpentine Soil | VNHEAMCLVCKKKLAEHSELQDKICEMITIKQFANDSPGFDIKFRPFFED* |
| Ga0126304_100518812 | 3300010037 | Serpentine Soil | MCPVCKKKLAEHSELQDKICEMITIKQFANDSPGFDIQFRPFFED* |
| Ga0126315_100020888 | 3300010038 | Serpentine Soil | LNLFWAHSMKYNLMCPICKKKIIEHSELQDKICRMITIKQFANNSPGFDVQYRPFFED* |
| Ga0126315_100872672 | 3300010038 | Serpentine Soil | MNNDDRAICPICKKKLKEHSELQDKICNMIIIKQFANNCPGFDVQFRPFFEKGEEEDD* |
| Ga0126315_101839582 | 3300010038 | Serpentine Soil | VNHEAMCLVCKKKLAEHSELQDKICEMITIKQFANDSAGFDIKFRPFFED* |
| Ga0126315_103732121 | 3300010038 | Serpentine Soil | VNHEAMCPVCKKKLAEHSELQDKICEMIIIKQFANDSPGFDIQFRPFFEED* |
| Ga0126315_104190463 | 3300010038 | Serpentine Soil | VSKSKNFCPICKRKLIDHSELQDKICEMITIKQFANNSPGFDVQFRPFFGD* |
| Ga0126315_106518882 | 3300010038 | Serpentine Soil | MNHEAMCPVCKKKLAEHSELQDKICEMITIKQFANDSPGFDIKFRPFFED* |
| Ga0126309_104238491 | 3300010039 | Serpentine Soil | VCKKKLAEHSELQDKICEMITIKQFANDSPGFDIQFRPFFED* |
| Ga0126308_101598562 | 3300010040 | Serpentine Soil | SVFIVMDYKSMCPICKKKFLEHSELQDKICRMITINQFANNSPGFDVQFRPFFED* |
| Ga0126308_106733431 | 3300010040 | Serpentine Soil | MNHEAMCPVCKKKLAEHSELQDKICEMITIKQFANDSPGFDIQFRPFFEED* |
| Ga0126312_1000002258 | 3300010041 | Serpentine Soil | MNYNLMCPICKKKIIEHSELQDKICRMITIKQFANNSPGFDVQYRPFFED* |
| Ga0126312_100794591 | 3300010041 | Serpentine Soil | LVCKKKLAEHSELQDKICEMITIKQFANDSPGFDIKFRPFFED* |
| Ga0126312_106925851 | 3300010041 | Serpentine Soil | MNHEAMCPVCKKKLAEHSELQDKICEMITIKQFANDSPGFDIQFRPFFED* |
| Ga0126312_113497691 | 3300010041 | Serpentine Soil | VNHEAMCVVCKKKLAEHSELQEKICEMITIKQFANESPGFDIQFRPFFEG* |
| Ga0126314_100118262 | 3300010042 | Serpentine Soil | MNNDDKVICSICKNKLEEHSELQDKICNMIIIKQFANNCPDFDVQFRPFFEKGEKED* |
| Ga0126314_102282141 | 3300010042 | Serpentine Soil | KKKLAEHSELQDKICEMITIKQFANDSPGFDIQFRPFFED* |
| Ga0126314_103115092 | 3300010042 | Serpentine Soil | VNHEAMCHVCKKKLAEHSELQDKICEIITIKQFANDSPGFDIQFRPFFEED* |
| Ga0126314_104672422 | 3300010042 | Serpentine Soil | MICPVCKKKLSEHSELQDKICEMITIKQFANDSPGFDIQFRPFFKD |
| Ga0126310_100976591 | 3300010044 | Serpentine Soil | DHYCCYIVNHEAMCLVCKKKLAEHSELQDKIYEMITIKQFANVSPGFDIQFRPFFED* |
| Ga0126310_104244322 | 3300010044 | Serpentine Soil | CYRCYIVNHEAICPVCKKKLAEHSELQDKICEMITIKQFANDSPGFDIQFRPFFEED* |
| Ga0126311_100330152 | 3300010045 | Serpentine Soil | MNHEAICPVCKKKLAEHSELQDKICEMITIKQFANDSPGFDIQFRPFFEED* |
| Ga0126311_109971252 | 3300010045 | Serpentine Soil | MKQNVSCAVCKKKLAEHSEFQDKICEMITIKQFANDSPGFDIQFRLFFEED* |
| Ga0126311_110020832 | 3300010045 | Serpentine Soil | PVCKKKLAEHSELQDKICEMITIKQFANDSPGFDIQFRPFFED* |
| Ga0126311_111709751 | 3300010045 | Serpentine Soil | CKKKLSEHSELQDKICEMITIKQFANDSPGFDIQFRPFFKD* |
| Ga0126311_112152822 | 3300010045 | Serpentine Soil | MNNDDKVICSICKNKLEEHSELQDKICNMIIIKQFANNCPDFDVQFRPFFGKEEKED* |
| Ga0126382_102491331 | 3300010047 | Tropical Forest Soil | MHSRDMCPICKSKISEHSELQDKICRMITIKEFSNNSPGFDIQFRP |
| Ga0126382_122851141 | 3300010047 | Tropical Forest Soil | SLNSKIVCPICKIKMVEHTEFQDKICRMITIKQFANNSPGFDVGFRPFFEDE* |
| Ga0126306_100199573 | 3300010166 | Serpentine Soil | VNHEAMCLVCKKKLAEHSELQDKICEMITIKQFANDSPGFDIQFRPFFED* |
| Ga0126306_100412074 | 3300010166 | Serpentine Soil | MCPVCKKKLAEHSEQQDKICEMITIKQFANDSPGFDIQFRPF |
| Ga0126306_114655131 | 3300010166 | Serpentine Soil | MKQNVSCPICKKKLAEHSELQDKICEMITIKQFANDSPGFDIQFR |
| Ga0126378_103724601 | 3300010361 | Tropical Forest Soil | PICPICKQKITEHTEFQDKICKMITIKQFANNCPGFDVQFRPFFED* |
| Ga0134125_108834041 | 3300010371 | Terrestrial Soil | MMNVGKETKCPICKKKFIDHSELQDKICKMITIKQFANISPGFDVQHRPFFED* |
| Ga0134126_101155864 | 3300010396 | Terrestrial Soil | MSHKAICPICKKRLFEHSRLQDRICKIITIKQFANNSPGFDVQFRPFFEKEGD* |
| Ga0134126_102402181 | 3300010396 | Terrestrial Soil | MNHHKAVCPICKKKLIEHSEFQDRICKMITIKQFANNCPGFDVQFRPFFGNEED* |
| Ga0134123_112932671 | 3300010403 | Terrestrial Soil | MMNVGKETKCPICKKRFIDHSELQDKICKMITIKQFANISPGFDV |
| Ga0137312_10793881 | 3300011400 | Soil | MNVGKETKCPICKKKFIEHSELQDKICKMITIKQFANISPGFDVQHRPFFED* |
| Ga0137365_101864452 | 3300012201 | Vadose Zone Soil | MNHGPACPICKKKLIEHSELQDKICKMITIKQFANNSPSFDVQFRPFFEEEED* |
| Ga0137374_100317407 | 3300012204 | Vadose Zone Soil | KTKIVEHSVFQVKICRVLTIKQFAINSPGFDVSFRPFFEDDLSIE* |
| Ga0137377_101754181 | 3300012211 | Vadose Zone Soil | PQPMCPICKQRITEHLELQDKICKMITIKQFENNCPGFDVQFRPFFED* |
| Ga0137366_105987061 | 3300012354 | Vadose Zone Soil | MNHGPACPICKKKLIEHSELQDKICKMITIKQFANNSPGFDVQFRPFFEEEED* |
| Ga0137371_107439491 | 3300012356 | Vadose Zone Soil | MNHGPACPICKKKLIERSELQDKICKMITIKQFANNSPGFDVQFRPFFEEEED* |
| Ga0157342_10745091 | 3300012507 | Arabidopsis Rhizosphere | ICKKKMSEHSELQDKICKMITIKQFANYSPGYDVQFRPFFEE* |
| Ga0157300_10051911 | 3300012884 | Soil | MLQMNRGAICHICKKKLIEHSELQDKICKMITIKQFANNSPGFDVQFRSFFEEEED* |
| Ga0157300_10085822 | 3300012884 | Soil | MNCEAACPICKKKLIEHSQLQDKICKMITIKQFANNSPGFDVQFRPFFEEEED* |
| Ga0157287_11006312 | 3300012885 | Soil | MNCEAACPICKKKLIEHSQLQDKICKMITIKQFANNSPGFDVKFRPFFEKE |
| Ga0157284_101044102 | 3300012893 | Soil | MLQMNRGAICHICKKKLIEHSQLQDKIYKMITIKQFANNSPGFDVQFRPFFEEEED* |
| Ga0157303_100722502 | 3300012896 | Soil | MNCEAACPICKKKLIEHSQLQDKIYKMITIKQFANNSPGFDVQFRPFFEEEED* |
| Ga0157306_102070231 | 3300012912 | Soil | MNCEAACHICKKKLIEHSQLQDKICKMITIKQFANNSPGFDVQFRPFFEKGEEEDD* |
| Ga0157302_101356271 | 3300012915 | Soil | RNRSNKYLLVCCYVIMHMASCPICKKKMSEHSELQDKICKMITIKQFANYSPGYDVQFRPFFEE* |
| Ga0164241_101012051 | 3300012943 | Soil | KFIEHSELQDKICKMITIKQFANISPGFDVQHRPFFED* |
| Ga0164299_101706401 | 3300012958 | Soil | HSEFQDKICRMITIKQFTNNSPGFDVPFRPFFEDDI* |
| Ga0164301_101769941 | 3300012960 | Soil | MLSILMNDRALCPICKKKLIEHSELQDKICKVITIKQFANNCPGFDVQFRPFFKKEEEEEG* |
| Ga0164305_118251121 | 3300012989 | Soil | LQDKICNMIIIKQFANNCPGFDVQFRPFFEKEEEEG* |
| Ga0075324_10498541 | 3300014263 | Natural And Restored Wetlands | MMNVGKETKCPICKKKFIEHSELQDKICKMITIKQFANISPGFDVQHRPF |
| Ga0182000_102859932 | 3300014487 | Soil | MNNNDDKAICPICKNKLKEHSELQNKICNMIIIKQFANNCPGFDVQFRPFFGKEEQD* |
| Ga0182008_100047542 | 3300014497 | Rhizosphere | MNNDNKATCPICKNKLKQHSELQGKICNMIIIKQFANNCPGFDVQFRPFFEKQEQEG* |
| Ga0182008_100057854 | 3300014497 | Rhizosphere | MNNDRAICPICKNKLREHSELQDKICNMIIIKQFTNNCPGFDVQFRPFFQKKEED* |
| Ga0182008_102352692 | 3300014497 | Rhizosphere | MNNARALCPICKNKLTEHSELQDKICNMIIIKQFANNCPGFDVQFRPFFEKEED* |
| Ga0182008_102834161 | 3300014497 | Rhizosphere | MNNDNKATCPICKNKLNQHSELQGKICNMIIIKQFANNCPGFDVQFRPFFEKQE |
| Ga0182008_104376222 | 3300014497 | Rhizosphere | MKDRAVCPICKKKLIEHSELQDKICKMITIMQFASNCPGFDVQYRPFFEKEDEG* |
| Ga0173483_100080201 | 3300015077 | Soil | TMCPICKKKFIEHSELQDKICRMITIKQFANNSPGFDVQFRPFFED* |
| Ga0173483_101174201 | 3300015077 | Soil | VIMHMASCPICKKKMSEHSELQDKICKMITIKQFANYSPGYDVQFRPFFEE* |
| Ga0173483_101315321 | 3300015077 | Soil | MLQMNLGAKCPICKRKLIEHSQLQDKICKMITIKQFANNSPGFD |
| Ga0173483_102073172 | 3300015077 | Soil | MLQMNRGAICHICKKKLIEHSELQDKICKMITIKQFANNSPGFDVQFR |
| Ga0182006_12956111 | 3300015261 | Rhizosphere | MNNDRAICPICKNKLREHSELQDKICDMIIIKQFTNNCPGFDVQFRPFFQKEEED* |
| Ga0132258_106820601 | 3300015371 | Arabidopsis Rhizosphere | MNIGRDTKCPICKKKFIEHSELQDKICEMITIKQFANISPGFDVQHRSFFED* |
| Ga0132256_1031800341 | 3300015372 | Arabidopsis Rhizosphere | KYMCPICKKKFIEHSELQDKICRMITIKQFANNSPGFDVKFRPFF* |
| Ga0132257_1003391161 | 3300015373 | Arabidopsis Rhizosphere | MASCPICKKKMSEHSELQDKICKMITIKQFANYSPGYDVQFRPFF |
| Ga0187767_103073151 | 3300017999 | Tropical Peatland | KFSEHSELQDKICKIITIKEFAAYCPGFDVQYRPTFES |
| Ga0184608_102404482 | 3300018028 | Groundwater Sediment | HSEFQDKICKMVTIKQFANNSPGFDVAFRPFFEDE |
| Ga0184634_101107652 | 3300018031 | Groundwater Sediment | PICKMKFTEHSEFQDKICKMITIKQFANNSPGFDVQFRPFFED |
| Ga0187773_105045341 | 3300018064 | Tropical Peatland | FLEHSELQMKICKIITIKEFAGICPGFDVNFRPSF |
| Ga0184611_11900001 | 3300018067 | Groundwater Sediment | TMCPICKKKFIEHSELQDKICRMITIKQFANNSPGFDVQFRPFFED |
| Ga0184635_100049994 | 3300018072 | Groundwater Sediment | MNREVKCPICKMKFTEHSEFQDKICKMITIKQFANNSPGFDVQFRPFFED |
| Ga0184635_103102261 | 3300018072 | Groundwater Sediment | IVCPICKIKLVEHSVFQDKICKMVTIKQFANNSPGFDVAFRPFFEDE |
| Ga0184624_100555071 | 3300018073 | Groundwater Sediment | MNCQTMCPICKKKFIEHSELQDKICRMITIKQFANNSPGFDVQFRPFFED |
| Ga0184632_102413721 | 3300018075 | Groundwater Sediment | NREVKCPICKMKFTEHSEFQDKICKMITIKQFANNSPGFDVQFRPFFED |
| Ga0184609_102114151 | 3300018076 | Groundwater Sediment | NIWFIVIIMNREVKCPICKMKFTEHSEFQDKICKMITIKQFANNSPGFDVQFRPFFED |
| Ga0187772_101406233 | 3300018085 | Tropical Peatland | EHTELQDKICEMITIKQFANNCPGFDVQFRPFFED |
| Ga0190275_100934163 | 3300018432 | Soil | MLNVGKETKCPICKKKFIEHSELQDKICKMITIKQFANISPGFDVQHRPFFED |
| Ga0190269_107815281 | 3300018465 | Soil | MKLAEHSELQDKICEMITIKQFANDSPGFDIQFSPFFEED |
| Ga0190268_113711821 | 3300018466 | Soil | EHSELQDKICRMITIKQFANNSPGFDVQHRPFFED |
| Ga0190270_134416021 | 3300018469 | Soil | KKKFIEHSELQDKICRMITIKQFANNSPGFDVQFRPFFED |
| Ga0190271_103829963 | 3300018481 | Soil | MNVGKETKCPICKKKFIEHSELQDKICKMITIKQFASIPPGFDVQHRPFFED |
| Ga0190271_129565551 | 3300018481 | Soil | YNMLNVGKETKCPICKKKFIEHSELQDKICKMITIKQFANISPGFDVQHRPFFED |
| Ga0173481_100080812 | 3300019356 | Soil | MLQMNRGAICHICKKKLIEHSELQDKICKMITIKQFANNSPGFDVQFRPFFEEEED |
| Ga0173481_100966311 | 3300019356 | Soil | MNNDYRAICPICKNKLKQHSELQDKIYNMIIIKQFANNCPGFDIQFRPFFEKGEAED |
| Ga0173481_101305281 | 3300019356 | Soil | MNCEAACHICKKKLIEHSQLQDKIYKMITIKQFANNSPGFDVQFRPFFEEEED |
| Ga0173481_108210871 | 3300019356 | Soil | MNDDRAICPVCKNKLKEHSELQDKICYMITIKQFANNCPGFDVQFRPFFEKEEEEE |
| Ga0173482_100498822 | 3300019361 | Soil | MLQMNLGAECPICKKKLIEHSQLQDKICKMITIKQFANNSPGFDVQFRPFFEEEED |
| Ga0173479_100084652 | 3300019362 | Soil | MNCEAACPICKKKLIEHSQLQDKICKMITIKQFANNSPGFDVQFRPFFEEEED |
| Ga0187893_101711803 | 3300019487 | Microbial Mat On Rocks | TEHSELQDKVCKMITIKQFSNNSPGFDVQFRPFFEDL |
| Ga0190267_108923041 | 3300019767 | Soil | MNVGKETKCPICKKKFIEHSELQDKICEMITIKQFANISPGFDVQHRPFFED |
| Ga0193720_10165202 | 3300019868 | Soil | KIVEHSEFQDKICRMITIKQFTNNSPGFDVPFRPFFEDDI |
| Ga0193700_10629661 | 3300019873 | Soil | CKTKISEHSEFQDKICRMITIKSIKQFANNSPGFDMPFRPFFEDE |
| Ga0193701_10314042 | 3300019875 | Soil | IEHSEFQDKICKMVTIKQFANNSPGFDVAFRPFFEDE |
| Ga0193741_10034154 | 3300019884 | Soil | MNYNSMCPICKKKFIEHSELQDKICKMITIKQFANISPGFDVQHRPFFED |
| Ga0193741_10548621 | 3300019884 | Soil | MNVGKETKCPICKKKFIEHSELQDKICEMITIKQFANISPGFDVQHRPFFRD |
| Ga0210381_101340651 | 3300021078 | Groundwater Sediment | NPRTVCPICNTKIVEHSEFQDKICRMITIKQFTNNSPGFDVPFRPFFEDDI |
| Ga0182009_100168853 | 3300021445 | Soil | MNNDRAICPICKNKLREHSELQDKICDMIIIKQFTNNCPGFDVQFRPFFQKEEED |
| Ga0182009_100412072 | 3300021445 | Soil | MNNDNKATCPICKNKLKQHSELQGKICNMIIIKQFANNCPGFDVQFRPFFEKQEQEG |
| Ga0182009_102854211 | 3300021445 | Soil | VVTCYWSILQMNNDDKAICPICKNKLKEHSELQDKIIKMIIIKQFANNCPGFDVQFRPFFGKEEEQ |
| Ga0182009_103539251 | 3300021445 | Soil | MNCEAACPICKKKLIEHSQLQDKICKMITIKPGFDVQFRPFFEEEED |
| Ga0182009_105362161 | 3300021445 | Soil | MNHHKAVCPICKKKLIEHSELQNRICKMITIKQFANNCPGFDVQFRPFFGKEED |
| Ga0126371_118513173 | 3300021560 | Tropical Forest Soil | PICKQKIAEHTELQDKICKMITIKQFANNWPGFDVQFRPFFED |
| Ga0212123_103043321 | 3300022557 | Iron-Sulfur Acid Spring | YPICKHRITEHSELQDKICRMITIKQFANNCPGFDVQLRPFFED |
| Ga0210061_100000617 | 3300025537 | Natural And Restored Wetlands | MMNVGKETKCPICKKKFIEHSELQDKICKMITIKQFANISPGFDVQHRPFFED |
| Ga0207692_105041751 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MASCPICKKKMSEHSELQDKICKMITIKQFANYSPGYDVQFRP |
| Ga0207642_102671471 | 3300025899 | Miscanthus Rhizosphere | MMNVGKETKCPICKKKFIDHSELQDKICKMITIKQFANISPGFDVQHRPFFED |
| Ga0207647_103161532 | 3300025904 | Corn Rhizosphere | MCPICKKKLIEHSELQEKICKMITIKQFANNSPGFDVQFRPFFED |
| Ga0207685_100042251 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEHSELQDKICKMITIKQFANYSPGYDVQFRPFFEE |
| Ga0207685_104095701 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MNHKAICPICKKRLFEHSRLQDRICKMITIKQFANNSPGFDVQFRPFSEKEGD |
| Ga0207663_1000015710 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MYFDYFCYVLQMNNNRAICPICKNKLTEHSELQDKICNMIIIKQFANNCPGFDVQFRPFFEKEES |
| Ga0207702_109030661 | 3300026078 | Corn Rhizosphere | MASCPICKKKMSEHSELQDKICKMITIKQFANYSPGYDVQF |
| Ga0207698_112892811 | 3300026142 | Corn Rhizosphere | TQIFYNMMNVGKETKCPICKKKFIDHSELQDKICKMITIKQFTNNSPGFDVPFRPFFEDD |
| Ga0256867_100435771 | 3300026535 | Soil | MNYNSMCPICKKKFIEHSELQDKICKMITIKQFANNSPGFDVQFRPFFED |
| Ga0209969_10271472 | 3300027360 | Arabidopsis Thaliana Rhizosphere | MNIGKETKCPICKKKFIEHSELQDNICEMITIKQFANISPGFDVQFRPFFED |
| Ga0214469_11783301 | 3300027636 | Soil | CAHSMNYNSMCPICKKKFIEHSELQDKICKMITIKQFANNSPGFDVQFRPFFED |
| Ga0209818_10454381 | 3300027637 | Agricultural Soil | MNYNSMCPICKKKFIEHSELQDKICRMITIKQFANISPGFDVQFRPFFED |
| Ga0209818_10569081 | 3300027637 | Agricultural Soil | MNIGKETKCPICKKKFIEHSELQDKICRMITIQQFSNYSPGFDVQHRPFFED |
| Ga0209818_10589012 | 3300027637 | Agricultural Soil | MNVGKETRCPICKKKFIEHSELQDKICKMITIKQFANISPGFDVQHRPFFED |
| Ga0256866_10216512 | 3300027650 | Soil | CKKKFIEHSELQDKICKMITIKQFANNSPGFDVQFRPFFED |
| Ga0209998_101073901 | 3300027717 | Arabidopsis Thaliana Rhizosphere | IKNIMNIGKETKCPICKKKFIEHSELQDNICEMITIKQFANISPGFDVQFRPFFED |
| Ga0209795_101791041 | 3300027718 | Agave | KDKAICPICKTKLKEHSELQDKICNMIIIKQFANNCPGFDVQFRPFFEKGEEQV |
| Ga0209819_100366631 | 3300027722 | Freshwater Sediment | MKVGKETKCPICKKKFIEHSELQDNICEMITIKQFANISPGFDVQHRPFFED |
| Ga0209593_100093782 | 3300027743 | Freshwater Sediment | MNCQTMCPICKNKLIEHSELQDKTCNMIIIKQFANNSQVFDIQFRPFFKD |
| Ga0209481_105920261 | 3300027880 | Populus Rhizosphere | VNHQSMCPICKKKLIEHSELQEKICKMITIKQFANNSPGFDVQF |
| Ga0209486_106608801 | 3300027886 | Agricultural Soil | MNYNSMCSICKKKFIEHSELQDKICRMITIKQFANNSPGFDVQFRPFFED |
| Ga0209382_100199042 | 3300027909 | Populus Rhizosphere | MCPICKKKFIEHSELQDKICRMITIKQFANNSPGFDVQFRPFFED |
| Ga0209382_101073763 | 3300027909 | Populus Rhizosphere | MSNNDDKAICPICKTKLKEHSELQDKICNMIIIKQFANNCPGFDVQFRPFFEKGEEEEDD |
| Ga0209382_107772382 | 3300027909 | Populus Rhizosphere | TCYWSILRMNKDKAICPICKNKLKEHSELQDKICNMIIIKQFANNYCPSFDVQFRPFFEKEEEQV |
| Ga0307276_100015005 | 3300028705 | Soil | MNNDRAICPICKNKLKEHSDLQDKICNMIIIKQFTNNCLGFDVQFRPFFEKEGED |
| Ga0307276_100650951 | 3300028705 | Soil | KLSEHHELQDKICKMITIKQFANNCPGFDVQFRPFFKED |
| Ga0307312_110951101 | 3300028828 | Soil | CKIKLVEHSEFQDKICKMVTIKQFANNSPGFDVAFRPFFEDE |
| Ga0299907_104784632 | 3300030006 | Soil | FVLIMNYNSMCPICKKKFIEHSELQDKICKMITIKQFANNSPGFDVQFRPFFED |
| Ga0268240_100835371 | 3300030496 | Soil | MCPVCKKKLVEHSELQDKICEMITIKQFANDSPGFDIQFRPFFEED |
| Ga0268241_100285632 | 3300030511 | Soil | MNNDKAICPICKNKLKAHSELQDKICNMIIIKQFANNCPGFDVQFRPFFGKEEEEEG |
| Ga0268241_100590482 | 3300030511 | Soil | MNNDDKAICPICKNKLKEHSELQDKICNMIIIKQFANNCPGFDVKYRPFFEKGEKEV |
| Ga0308197_104431022 | 3300031093 | Soil | YVIIHMALCPICKKKMSEHSELQDKICKMITIKQFANYSPGYDVQFRPFFEE |
| Ga0299913_120042712 | 3300031229 | Soil | MNVGKETKCPICKKKFIEHSELQDKICKMITIKQFANICPGFDVQFRPFFEN |
| Ga0307442_10029161 | 3300031274 | Salt Marsh | MDSNATCLICKKKPNEHSELQDKICKMITLKQFANNNPGFDVQFRPFFEQ |
| Ga0310888_107687382 | 3300031538 | Soil | MSDSIIMNVGKETKCPICKKKFIEHSELQDKICKMITIMQFANISPGFDVQHRPFFED |
| Ga0307408_1002721241 | 3300031548 | Rhizosphere | MISDHYCCYIVNHEAMCPVCKKKLAEHSELQDKICEMITIKQFANDSPGFDIKFRP |
| Ga0310886_105092761 | 3300031562 | Soil | CPICKKKFIEHSELQDKICKMITIKQFANISPGFDVQHRPFFED |
| Ga0315534_10207313 | 3300031585 | Salt Marsh Sediment | MNIIKIGKETKCPICKKKFIEHSELQDKICKMITIKQFANNSPGFDVQHRPFFED |
| Ga0307413_101208963 | 3300031824 | Rhizosphere | MISDHYCCYIVNHEAMCPVCKKKLAEHSELQDKICEMITIKQFANDSPGFDIKFRPFFED |
| Ga0307413_105356901 | 3300031824 | Rhizosphere | MNHERMCPVCKKKLAEHSELQDKICEMITIKQFANDSPGFDIQFRPFFED |
| Ga0310907_100656301 | 3300031847 | Soil | MSDSIIMNVGKETKCPICKKKFIEHSELQDKICKMITIKQFANISPGFDVQHRPFFED |
| Ga0307410_103658311 | 3300031852 | Rhizosphere | EHSELQDKICEMITIKQFANDSPGFDIKFRPFFED |
| Ga0310904_108851921 | 3300031854 | Soil | KETKCPICKKKFIEHSELQDKICKMITIKQFANISPGFDVQHRPFFED |
| Ga0310904_109157911 | 3300031854 | Soil | MLNVGKETKCPICKKKFIEHSELQDKICKMITIKQFANISPGFD |
| Ga0307407_101667321 | 3300031903 | Rhizosphere | IFIIMISDHYCCYIVNHEAMCLVCKKKLAEHSELQDKICEMITIKQFANDSPGFDIKFRPFFED |
| Ga0307412_109242212 | 3300031911 | Rhizosphere | VNHEAMCPVCKKKLAEHSELQDKICEMITIKQFANDSPGFDIQFRPFFED |
| Ga0308175_1001230994 | 3300031938 | Soil | MNNDRAICPICKNKLKEHSELQDKICDMIITKQFANNCPGFDVQFRPFFQKEEED |
| Ga0308175_1025917772 | 3300031938 | Soil | MNCEAACPICKKKLIEHSQLQDKICKMITIKQFANNSPGFDVQFRPFFKKEEED |
| Ga0310884_104313471 | 3300031944 | Soil | MSDSIIMNVGKETKCPICKKKFIDHSELQDKICKMITIKQFANISPGFDVQHRPFFED |
| Ga0308176_117276702 | 3300031996 | Soil | MSNNDDKAICPICKNKLKEHSELQDKICDMIITKQFANNCPGFDVQFRPFFQKEEED |
| Ga0307416_1001108701 | 3300032002 | Rhizosphere | MNHERMCPVCKKKLAEHSELQDKICEMITIKQFANDSPGFDIKFRPFFED |
| Ga0307416_1015461002 | 3300032002 | Rhizosphere | MCPVCKKKLAEHSELQDKICEMITIKQFANNSPGFDIQFRPFFED |
| Ga0307414_101159343 | 3300032004 | Rhizosphere | MNHETMCPVCKKKLAEHSELQDKICEMITIKQFANDSPGFDIKFRPFFED |
| Ga0307411_108864272 | 3300032005 | Rhizosphere | MCPVCKKKLAEHSELQDKICEMITIKQFANDSPGFDIQFRPFFED |
| Ga0310906_102114412 | 3300032013 | Soil | MNCHTMCPICKKKFIEHSELQDKICRMITIKQFANNSPGFDVQFRPFFED |
| Ga0308173_112147951 | 3300032074 | Soil | MNCEAACPICKKKLIEHSQLQDKICKMITIKQFANNSPGFDVQFRPFFEEEEY |
| Ga0310890_107404431 | 3300032075 | Soil | KKFIEHSELQDKICKMITIKQFANISPGFDVQHRPFFED |
| Ga0310895_103930321 | 3300032122 | Soil | IDHSELQDKICKMITIKQFANISPGFDVQHRPFFED |
| Ga0335082_102642853 | 3300032782 | Soil | RQKFSEHSELQDKICKIITIKEFAAYCPGFDVQYRPSFEISR |
| Ga0364937_004024_3_131 | 3300034113 | Sediment | ICKRKLIEHSELQDKICEMITIKQFANNCPGFDVQFRPFFED |
| Ga0334931_089859_267_422 | 3300034377 | Sub-Biocrust Soil | VNHEAMCLVCKKKLAEHSELQDKICEMITIKQFANDSPGFDIQFRPFFEED |
| ⦗Top⦘ |