| Basic Information | |
|---|---|
| Family ID | F012907 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 276 |
| Average Sequence Length | 42 residues |
| Representative Sequence | ENNNPDLARLSAEEALGRRPAEFAFTGELLVASQHVPLKPLEL |
| Number of Associated Samples | 209 |
| Number of Associated Scaffolds | 276 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.55 % |
| % of genes from short scaffolds (< 2000 bps) | 89.49 % |
| Associated GOLD sequencing projects | 194 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.63 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.609 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.029 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.449 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.246 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.54% β-sheet: 0.00% Coil/Unstructured: 77.46% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 276 Family Scaffolds |
|---|---|---|
| PF13646 | HEAT_2 | 9.78 |
| PF01546 | Peptidase_M20 | 8.33 |
| PF00206 | Lyase_1 | 3.99 |
| PF13620 | CarboxypepD_reg | 3.62 |
| PF07883 | Cupin_2 | 2.90 |
| PF07687 | M20_dimer | 2.54 |
| PF08281 | Sigma70_r4_2 | 1.81 |
| PF10397 | ADSL_C | 1.81 |
| PF11412 | DsbC | 1.45 |
| PF05173 | DapB_C | 1.45 |
| PF00701 | DHDPS | 1.09 |
| PF09424 | YqeY | 1.09 |
| PF13559 | DUF4129 | 0.72 |
| PF09970 | DUF2204 | 0.72 |
| PF01625 | PMSR | 0.72 |
| PF13289 | SIR2_2 | 0.72 |
| PF01113 | DapB_N | 0.72 |
| PF09285 | Elong-fact-P_C | 0.36 |
| PF07244 | POTRA | 0.36 |
| PF00999 | Na_H_Exchanger | 0.36 |
| PF03130 | HEAT_PBS | 0.36 |
| PF12681 | Glyoxalase_2 | 0.36 |
| PF13823 | ADH_N_assoc | 0.36 |
| PF00158 | Sigma54_activat | 0.36 |
| PF00285 | Citrate_synt | 0.36 |
| PF01381 | HTH_3 | 0.36 |
| PF07995 | GSDH | 0.36 |
| PF13614 | AAA_31 | 0.36 |
| PF01694 | Rhomboid | 0.36 |
| PF04072 | LCM | 0.36 |
| PF14384 | BrnA_antitoxin | 0.36 |
| PF13565 | HTH_32 | 0.36 |
| PF00535 | Glycos_transf_2 | 0.36 |
| PF03551 | PadR | 0.36 |
| PF01145 | Band_7 | 0.36 |
| PF00196 | GerE | 0.36 |
| PF00190 | Cupin_1 | 0.36 |
| PF05193 | Peptidase_M16_C | 0.36 |
| COG ID | Name | Functional Category | % Frequency in 276 Family Scaffolds |
|---|---|---|---|
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 2.17 |
| COG0289 | 4-hydroxy-tetrahydrodipicolinate reductase | Amino acid transport and metabolism [E] | 1.45 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.72 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.36 |
| COG0372 | Citrate synthase | Energy production and conversion [C] | 0.36 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.36 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.36 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.36 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.36 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.36 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.36 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.36 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.36 |
| COG3315 | O-Methyltransferase involved in polyketide biosynthesis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.36 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.36 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.97 % |
| Unclassified | root | N/A | 17.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_100258360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 876 | Open in IMG/M |
| 3300001471|JGI12712J15308_10026407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1506 | Open in IMG/M |
| 3300001471|JGI12712J15308_10041306 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100827865 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300002917|JGI25616J43925_10274742 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300003368|JGI26340J50214_10122325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300004082|Ga0062384_100970771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300004082|Ga0062384_101047901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 586 | Open in IMG/M |
| 3300004091|Ga0062387_100117138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1470 | Open in IMG/M |
| 3300004092|Ga0062389_100123970 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2360 | Open in IMG/M |
| 3300004092|Ga0062389_103587294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300004152|Ga0062386_101021672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300005167|Ga0066672_10193210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1294 | Open in IMG/M |
| 3300005167|Ga0066672_10318203 | Not Available | 1013 | Open in IMG/M |
| 3300005175|Ga0066673_10725224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300005175|Ga0066673_10749966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 560 | Open in IMG/M |
| 3300005439|Ga0070711_100116090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1972 | Open in IMG/M |
| 3300005467|Ga0070706_100279633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1558 | Open in IMG/M |
| 3300005468|Ga0070707_102088080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300005471|Ga0070698_101490454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300005534|Ga0070735_10144637 | Not Available | 1476 | Open in IMG/M |
| 3300005537|Ga0070730_10009939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 7838 | Open in IMG/M |
| 3300005537|Ga0070730_10258553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1148 | Open in IMG/M |
| 3300005537|Ga0070730_10289882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1074 | Open in IMG/M |
| 3300005542|Ga0070732_10172982 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300005542|Ga0070732_10270913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1018 | Open in IMG/M |
| 3300005542|Ga0070732_10554680 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300005547|Ga0070693_100222531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1237 | Open in IMG/M |
| 3300005552|Ga0066701_10837663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300005554|Ga0066661_10404000 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300005555|Ga0066692_10096423 | All Organisms → cellular organisms → Bacteria | 1745 | Open in IMG/M |
| 3300005557|Ga0066704_10211136 | Not Available | 1314 | Open in IMG/M |
| 3300005568|Ga0066703_10380525 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300005591|Ga0070761_10016553 | All Organisms → cellular organisms → Bacteria | 4096 | Open in IMG/M |
| 3300005591|Ga0070761_11023721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300005950|Ga0066787_10124193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 567 | Open in IMG/M |
| 3300005993|Ga0080027_10262768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 682 | Open in IMG/M |
| 3300006050|Ga0075028_100229253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1013 | Open in IMG/M |
| 3300006050|Ga0075028_100625157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300006052|Ga0075029_100972935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300006162|Ga0075030_100643168 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300006172|Ga0075018_10720701 | Not Available | 541 | Open in IMG/M |
| 3300006173|Ga0070716_100673472 | Not Available | 787 | Open in IMG/M |
| 3300006176|Ga0070765_100727359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 938 | Open in IMG/M |
| 3300006176|Ga0070765_101038466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 775 | Open in IMG/M |
| 3300006755|Ga0079222_12486067 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300006800|Ga0066660_10457627 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300006804|Ga0079221_10041103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2022 | Open in IMG/M |
| 3300006804|Ga0079221_11375817 | Not Available | 560 | Open in IMG/M |
| 3300006806|Ga0079220_12124616 | Not Available | 503 | Open in IMG/M |
| 3300006893|Ga0073928_10195394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1589 | Open in IMG/M |
| 3300006893|Ga0073928_10695183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas haemaphysalidis | 710 | Open in IMG/M |
| 3300006893|Ga0073928_10956395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300007076|Ga0075435_100091916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2505 | Open in IMG/M |
| 3300007265|Ga0099794_10441717 | Not Available | 682 | Open in IMG/M |
| 3300009012|Ga0066710_104318376 | Not Available | 531 | Open in IMG/M |
| 3300009012|Ga0066710_104744420 | Not Available | 508 | Open in IMG/M |
| 3300009038|Ga0099829_10516986 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300009088|Ga0099830_10284045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 1317 | Open in IMG/M |
| 3300009088|Ga0099830_10542160 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300009088|Ga0099830_11512495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300009089|Ga0099828_11362961 | Not Available | 627 | Open in IMG/M |
| 3300009093|Ga0105240_11316517 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300009137|Ga0066709_100752971 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300009444|Ga0114945_10621547 | Not Available | 656 | Open in IMG/M |
| 3300009523|Ga0116221_1275032 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300009638|Ga0116113_1204622 | Not Available | 511 | Open in IMG/M |
| 3300009698|Ga0116216_10756389 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300009792|Ga0126374_10322314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1046 | Open in IMG/M |
| 3300009824|Ga0116219_10585163 | Not Available | 614 | Open in IMG/M |
| 3300010321|Ga0134067_10068060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1174 | Open in IMG/M |
| 3300010325|Ga0134064_10096771 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300010343|Ga0074044_11139084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300010358|Ga0126370_11686099 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300010358|Ga0126370_12189489 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300010359|Ga0126376_10669115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 994 | Open in IMG/M |
| 3300010360|Ga0126372_12030328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300010360|Ga0126372_12727220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300010360|Ga0126372_13267470 | Not Available | 504 | Open in IMG/M |
| 3300010361|Ga0126378_10048548 | All Organisms → cellular organisms → Bacteria | 3943 | Open in IMG/M |
| 3300010361|Ga0126378_10063802 | All Organisms → cellular organisms → Bacteria | 3496 | Open in IMG/M |
| 3300010362|Ga0126377_11649722 | Not Available | 716 | Open in IMG/M |
| 3300010362|Ga0126377_12877793 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300010366|Ga0126379_10206369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1895 | Open in IMG/M |
| 3300010371|Ga0134125_12486942 | Not Available | 563 | Open in IMG/M |
| 3300010376|Ga0126381_104309815 | Not Available | 551 | Open in IMG/M |
| 3300010379|Ga0136449_100891570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 1451 | Open in IMG/M |
| 3300010379|Ga0136449_101701690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 950 | Open in IMG/M |
| 3300010379|Ga0136449_104473534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300010398|Ga0126383_10119450 | All Organisms → cellular organisms → Bacteria | 2398 | Open in IMG/M |
| 3300010400|Ga0134122_12474768 | Not Available | 568 | Open in IMG/M |
| 3300011120|Ga0150983_10343428 | Not Available | 506 | Open in IMG/M |
| 3300011120|Ga0150983_11451117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 642 | Open in IMG/M |
| 3300011270|Ga0137391_11522172 | Not Available | 514 | Open in IMG/M |
| 3300011271|Ga0137393_10085438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2547 | Open in IMG/M |
| 3300011271|Ga0137393_10522066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1019 | Open in IMG/M |
| 3300011271|Ga0137393_10685184 | Not Available | 878 | Open in IMG/M |
| 3300011271|Ga0137393_10722135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 853 | Open in IMG/M |
| 3300012096|Ga0137389_10112259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2184 | Open in IMG/M |
| 3300012096|Ga0137389_10134056 | All Organisms → cellular organisms → Bacteria | 2011 | Open in IMG/M |
| 3300012189|Ga0137388_10642026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 987 | Open in IMG/M |
| 3300012199|Ga0137383_10642032 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300012201|Ga0137365_10282969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1230 | Open in IMG/M |
| 3300012202|Ga0137363_10279997 | Not Available | 1364 | Open in IMG/M |
| 3300012202|Ga0137363_11788172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae → unclassified Halieaceae → gamma proteobacterium HIMB55 | 507 | Open in IMG/M |
| 3300012203|Ga0137399_11651263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300012207|Ga0137381_10648266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 919 | Open in IMG/M |
| 3300012209|Ga0137379_10050774 | All Organisms → cellular organisms → Bacteria | 3995 | Open in IMG/M |
| 3300012210|Ga0137378_10681942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 938 | Open in IMG/M |
| 3300012351|Ga0137386_10302774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1150 | Open in IMG/M |
| 3300012359|Ga0137385_11468519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300012361|Ga0137360_10402405 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300012362|Ga0137361_10103659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 2479 | Open in IMG/M |
| 3300012362|Ga0137361_11784576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae → unclassified Halieaceae → gamma proteobacterium HIMB55 | 533 | Open in IMG/M |
| 3300012363|Ga0137390_10231807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 1832 | Open in IMG/M |
| 3300012363|Ga0137390_10532727 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300012685|Ga0137397_10491203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 914 | Open in IMG/M |
| 3300012917|Ga0137395_10898272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300012918|Ga0137396_10385888 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300012918|Ga0137396_10523399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 878 | Open in IMG/M |
| 3300012924|Ga0137413_10829769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 712 | Open in IMG/M |
| 3300012927|Ga0137416_11482337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae → unclassified Halieaceae → gamma proteobacterium HIMB55 | 616 | Open in IMG/M |
| 3300012927|Ga0137416_11876587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300012929|Ga0137404_11543229 | Not Available | 615 | Open in IMG/M |
| 3300012957|Ga0164303_11053562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300012960|Ga0164301_10041685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2291 | Open in IMG/M |
| 3300012964|Ga0153916_10740533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geotalea → Geotalea uraniireducens | 1062 | Open in IMG/M |
| 3300012971|Ga0126369_13126324 | Not Available | 542 | Open in IMG/M |
| 3300012971|Ga0126369_13146962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300012972|Ga0134077_10314963 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300014154|Ga0134075_10010658 | All Organisms → cellular organisms → Bacteria | 3540 | Open in IMG/M |
| 3300014166|Ga0134079_10360609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300014166|Ga0134079_10363048 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300015051|Ga0137414_1018147 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300015051|Ga0137414_1125195 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300015053|Ga0137405_1267583 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300015054|Ga0137420_1100124 | All Organisms → cellular organisms → Bacteria | 1830 | Open in IMG/M |
| 3300015374|Ga0132255_102367738 | Not Available | 810 | Open in IMG/M |
| 3300016294|Ga0182041_11224534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300016357|Ga0182032_10504989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 995 | Open in IMG/M |
| 3300016387|Ga0182040_10325053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1184 | Open in IMG/M |
| 3300016404|Ga0182037_10139496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1811 | Open in IMG/M |
| 3300016445|Ga0182038_10804786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 824 | Open in IMG/M |
| 3300017823|Ga0187818_10066039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1558 | Open in IMG/M |
| 3300017928|Ga0187806_1119824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 852 | Open in IMG/M |
| 3300017930|Ga0187825_10014804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2609 | Open in IMG/M |
| 3300017959|Ga0187779_10915133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 604 | Open in IMG/M |
| 3300017972|Ga0187781_10273360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 1197 | Open in IMG/M |
| 3300017999|Ga0187767_10158646 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300018033|Ga0187867_10070128 | All Organisms → cellular organisms → Bacteria | 2071 | Open in IMG/M |
| 3300018040|Ga0187862_10218647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1241 | Open in IMG/M |
| 3300018058|Ga0187766_10211119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1228 | Open in IMG/M |
| 3300018062|Ga0187784_10498723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 981 | Open in IMG/M |
| 3300018086|Ga0187769_10871263 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 681 | Open in IMG/M |
| 3300018086|Ga0187769_11108070 | Not Available | 599 | Open in IMG/M |
| 3300018086|Ga0187769_11511306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300018088|Ga0187771_10734024 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300018431|Ga0066655_10532359 | Not Available | 782 | Open in IMG/M |
| 3300018433|Ga0066667_10261318 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
| 3300018468|Ga0066662_10109181 | All Organisms → cellular organisms → Bacteria | 1985 | Open in IMG/M |
| 3300018468|Ga0066662_10711606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 960 | Open in IMG/M |
| 3300018482|Ga0066669_11754215 | Not Available | 572 | Open in IMG/M |
| 3300020199|Ga0179592_10058563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1757 | Open in IMG/M |
| 3300020579|Ga0210407_10109325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 2106 | Open in IMG/M |
| 3300020579|Ga0210407_11423790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300020581|Ga0210399_10156999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1882 | Open in IMG/M |
| 3300020581|Ga0210399_10852107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 742 | Open in IMG/M |
| 3300020581|Ga0210399_11046684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300020583|Ga0210401_10662758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
| 3300021088|Ga0210404_10248732 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300021088|Ga0210404_10587544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae → unclassified Halieaceae → gamma proteobacterium HIMB55 | 632 | Open in IMG/M |
| 3300021088|Ga0210404_10731612 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300021088|Ga0210404_10808085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300021168|Ga0210406_10287768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 1339 | Open in IMG/M |
| 3300021170|Ga0210400_11100683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae → unclassified Halieaceae → gamma proteobacterium HIMB55 | 643 | Open in IMG/M |
| 3300021178|Ga0210408_10289406 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
| 3300021178|Ga0210408_11447740 | Not Available | 516 | Open in IMG/M |
| 3300021401|Ga0210393_10256656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 1418 | Open in IMG/M |
| 3300021405|Ga0210387_10331131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1343 | Open in IMG/M |
| 3300021420|Ga0210394_10147988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2040 | Open in IMG/M |
| 3300021420|Ga0210394_11289890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300021432|Ga0210384_11846870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300021433|Ga0210391_10110610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2164 | Open in IMG/M |
| 3300021433|Ga0210391_10260862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1360 | Open in IMG/M |
| 3300021433|Ga0210391_10831324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300021475|Ga0210392_10361615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1052 | Open in IMG/M |
| 3300021477|Ga0210398_10040829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3846 | Open in IMG/M |
| 3300021477|Ga0210398_11243988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300021478|Ga0210402_10088787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 2762 | Open in IMG/M |
| 3300021478|Ga0210402_11438040 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300021479|Ga0210410_11483521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300021559|Ga0210409_10254840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1588 | Open in IMG/M |
| 3300022557|Ga0212123_10436123 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300023259|Ga0224551_1104162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 502 | Open in IMG/M |
| 3300024330|Ga0137417_1134054 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300025155|Ga0209320_10366215 | Not Available | 586 | Open in IMG/M |
| 3300025922|Ga0207646_11641323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300025928|Ga0207700_10051590 | All Organisms → cellular organisms → Bacteria | 3070 | Open in IMG/M |
| 3300026315|Ga0209686_1123191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 860 | Open in IMG/M |
| 3300026481|Ga0257155_1055439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300026490|Ga0257153_1033686 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300026538|Ga0209056_10566455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300026551|Ga0209648_10186674 | All Organisms → cellular organisms → Bacteria | 1598 | Open in IMG/M |
| 3300026551|Ga0209648_10678407 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300026839|Ga0207764_112699 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300026941|Ga0207741_1011562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1016 | Open in IMG/M |
| 3300027034|Ga0209730_1033788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae → unclassified Halieaceae → gamma proteobacterium HIMB55 | 582 | Open in IMG/M |
| 3300027105|Ga0207944_1004158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1285 | Open in IMG/M |
| 3300027459|Ga0207505_113496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300027655|Ga0209388_1029982 | Not Available | 1552 | Open in IMG/M |
| 3300027684|Ga0209626_1112627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300027729|Ga0209248_10012368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 2690 | Open in IMG/M |
| 3300027729|Ga0209248_10158209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300027768|Ga0209772_10263243 | Not Available | 547 | Open in IMG/M |
| 3300027824|Ga0209040_10314580 | Not Available | 757 | Open in IMG/M |
| 3300027825|Ga0209039_10150223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 970 | Open in IMG/M |
| 3300027825|Ga0209039_10309056 | Not Available | 621 | Open in IMG/M |
| 3300027846|Ga0209180_10782114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300027853|Ga0209274_10012706 | All Organisms → cellular organisms → Bacteria | 3780 | Open in IMG/M |
| 3300027854|Ga0209517_10067105 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2572 | Open in IMG/M |
| 3300027857|Ga0209166_10421248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300027862|Ga0209701_10031786 | All Organisms → cellular organisms → Bacteria | 3425 | Open in IMG/M |
| 3300027875|Ga0209283_10849769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300027884|Ga0209275_10583059 | Not Available | 641 | Open in IMG/M |
| 3300027911|Ga0209698_10586061 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300028906|Ga0308309_10259019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1458 | Open in IMG/M |
| 3300028906|Ga0308309_10265220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 1442 | Open in IMG/M |
| 3300028906|Ga0308309_11171575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 663 | Open in IMG/M |
| 3300028906|Ga0308309_11586292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300029943|Ga0311340_10348076 | Not Available | 1386 | Open in IMG/M |
| 3300030524|Ga0311357_10812020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 839 | Open in IMG/M |
| 3300030580|Ga0311355_10463832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1224 | Open in IMG/M |
| 3300030580|Ga0311355_11147775 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300030739|Ga0302311_10931036 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300030760|Ga0265762_1134779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300031231|Ga0170824_104256138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300031236|Ga0302324_101926572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
| 3300031469|Ga0170819_17049838 | Not Available | 667 | Open in IMG/M |
| 3300031564|Ga0318573_10029526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 2554 | Open in IMG/M |
| 3300031708|Ga0310686_109036552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 1279 | Open in IMG/M |
| 3300031715|Ga0307476_10824193 | Not Available | 686 | Open in IMG/M |
| 3300031720|Ga0307469_10475876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1088 | Open in IMG/M |
| 3300031724|Ga0318500_10194785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 969 | Open in IMG/M |
| 3300031754|Ga0307475_11505893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300031781|Ga0318547_10781167 | Not Available | 595 | Open in IMG/M |
| 3300031792|Ga0318529_10216327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 890 | Open in IMG/M |
| 3300031798|Ga0318523_10386095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300031823|Ga0307478_10234473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1487 | Open in IMG/M |
| 3300031823|Ga0307478_10631933 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300031823|Ga0307478_11086914 | Not Available | 667 | Open in IMG/M |
| 3300031833|Ga0310917_10949929 | Not Available | 577 | Open in IMG/M |
| 3300031942|Ga0310916_11646123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300031947|Ga0310909_11304475 | Not Available | 584 | Open in IMG/M |
| 3300031962|Ga0307479_10955899 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300031962|Ga0307479_12118552 | Not Available | 510 | Open in IMG/M |
| 3300032001|Ga0306922_11678898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 629 | Open in IMG/M |
| 3300032042|Ga0318545_10297538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300032059|Ga0318533_10812212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 686 | Open in IMG/M |
| 3300032059|Ga0318533_11195816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300032076|Ga0306924_10871668 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300032180|Ga0307471_101379543 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300032180|Ga0307471_102129670 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300032205|Ga0307472_100718324 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300032892|Ga0335081_10375772 | All Organisms → cellular organisms → Bacteria | 1839 | Open in IMG/M |
| 3300032892|Ga0335081_10768665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1156 | Open in IMG/M |
| 3300032895|Ga0335074_10378139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1553 | Open in IMG/M |
| 3300032954|Ga0335083_10218096 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1731 | Open in IMG/M |
| 3300032955|Ga0335076_11156853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300033134|Ga0335073_10410155 | Not Available | 1580 | Open in IMG/M |
| 3300033158|Ga0335077_10495991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1292 | Open in IMG/M |
| 3300033158|Ga0335077_12033987 | Not Available | 532 | Open in IMG/M |
| 3300033289|Ga0310914_10061774 | All Organisms → cellular organisms → Bacteria | 3124 | Open in IMG/M |
| 3300033290|Ga0318519_10156561 | Not Available | 1277 | Open in IMG/M |
| 3300033755|Ga0371489_0537951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium capsulatum | 512 | Open in IMG/M |
| 3300033806|Ga0314865_091186 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300033983|Ga0371488_0570636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.80% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.99% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.62% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.62% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.26% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.90% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.90% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.54% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.17% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.17% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.45% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.45% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.09% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.09% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.72% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.72% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.72% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.36% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.36% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.36% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.36% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.36% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.36% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.36% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.36% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.36% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.36% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.36% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025155 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4 | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026839 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 52 (SPAdes) | Environmental | Open in IMG/M |
| 3300026941 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 39 (SPAdes) | Environmental | Open in IMG/M |
| 3300027034 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027105 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF018 (SPAdes) | Environmental | Open in IMG/M |
| 3300027459 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-A (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| 3300033806 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20 | Environmental | Open in IMG/M |
| 3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1002583602 | 3300000955 | Soil | VKISAEQALERRPAECAFAGELLLASQHVPLKSLEL* |
| JGI12712J15308_100264071 | 3300001471 | Forest Soil | YLVLGHVSAENNHPDVARISAEEALGRRPAESAFGGELLIASQAEPLQTIEL* |
| JGI12712J15308_100413061 | 3300001471 | Forest Soil | NPDLVRISAEEALNRRPAGFEFLGQLLVASQQVPLKPLDL* |
| JGIcombinedJ26739_1008278652 | 3300002245 | Forest Soil | PDLVRISAEEALNRRPAGFEFLGQLLVASQQVPLKPLDL* |
| JGI25616J43925_102747421 | 3300002917 | Grasslands Soil | PDLVRLSAEEALKRRPAESAFTGELLVASQHVPLKPLEL* |
| JGI26340J50214_101223251 | 3300003368 | Bog Forest Soil | LAHVSQENNNPYLVKLSAEEALERRPAESAFRGELMIASQTVPLKPLQL* |
| Ga0062384_1009707711 | 3300004082 | Bog Forest Soil | TPDLARICAEEALNRRPGESAFRGTLHVASQRIPLGPFDL* |
| Ga0062384_1010479011 | 3300004082 | Bog Forest Soil | PDLARICAEEALGRRPGEFAFRGTLHVASQRIPLGPFEL* |
| Ga0062387_1001171382 | 3300004091 | Bog Forest Soil | SQENNNPDVARISAEEALGRRPAEVAFTGELLVASQQFPLRTIDL* |
| Ga0062389_1001239703 | 3300004092 | Bog Forest Soil | LARFLILAHVSLENNNPDVVRISAEEALGRRPAERAFRGELLIANQHTPLQPLNL* |
| Ga0062389_1035872942 | 3300004092 | Bog Forest Soil | HVSLENNNPDVVRISAEEALRRRPADHPNARPFTGEVIVAHQHAPIAPLHL* |
| Ga0062386_1010216722 | 3300004152 | Bog Forest Soil | HLSQENNNPDLARLSAEEALNRRPAECAFRGELLVATQDRPLKPLEL* |
| Ga0066672_101932102 | 3300005167 | Soil | NPDVARICAEEALGRRPAPTAFRGELLVASQRVPLGPLVL* |
| Ga0066672_103182033 | 3300005167 | Soil | ENNNPDLVRLSAEEALKRRPAETAFAGELLVASQHVPLKPLEL* |
| Ga0066673_107252241 | 3300005175 | Soil | NPDLVRLSAEEALKRRPAETAFAGELLVASQHVPLKPLEL* |
| Ga0066673_107499661 | 3300005175 | Soil | LSQENNNPDVARISAEEALGHRPSECAFGGQLLIASQDTPLKPLEL* |
| Ga0070711_1001160901 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | QENNNPDVVKISAEQALQKRPTEAAFSGELLLASQSVPLEPLEL* |
| Ga0070706_1002796333 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | ENNNPDVVRICAEQALGCRPAEAAFTGELLLASQQVPLKPLEL* |
| Ga0070707_1020880801 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | NNNPYTARISAEEALNRRPAEAAFHGELLLASQRVPLKPLEL* |
| Ga0070698_1014904541 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | AHISQENNNPDVVRICAEQALACRPAEAAFTGELLLASQQVPLKPLQL* |
| Ga0070735_101446371 | 3300005534 | Surface Soil | HPDVARISAEEALGRRPAESAFGGELLIASQAEPLQTIEL* |
| Ga0070730_100099391 | 3300005537 | Surface Soil | RLSAEEALNCRPTECAFTGELLIANQHEPLKPLQL* |
| Ga0070730_102585531 | 3300005537 | Surface Soil | SQENNNPDLARLSAEEALGRRPAECAFTGELLIATQREPLKPLQL* |
| Ga0070730_102898821 | 3300005537 | Surface Soil | HISAENNNPDVARISAEEALGRRPAECAFGGELLIASQAEPLQTIEL* |
| Ga0070732_101729821 | 3300005542 | Surface Soil | NPDVARICAEEALGRRPSLFAFRGELLIASQHEPLAPLQL* |
| Ga0070732_102709131 | 3300005542 | Surface Soil | AHLSQENNNPDLARLSAEEALGRRPADSAFRGELLIASQHVPLRPLEL* |
| Ga0070732_105546801 | 3300005542 | Surface Soil | LARISAEEALGRRPAECAFGGHLLVASQEVPLTPIQL* |
| Ga0070693_1002225312 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | LAHISQENNNPDLVRLSAEEALGRRPAENRFAGELLVATQDAPMKPLEL* |
| Ga0066701_108376632 | 3300005552 | Soil | EENNDPDLVRLSAEEALKRRPIESAFTGKLLVASQQVPLKPLQL* |
| Ga0066661_104040003 | 3300005554 | Soil | LSAEEALKRRPAETAFAGELLVASQHVPLKPLEL* |
| Ga0066692_100964234 | 3300005555 | Soil | LVRLSAEEALKRRPAESAFTGELLVASQHVPLKPLEL* |
| Ga0066704_102111364 | 3300005557 | Soil | AHVSQENNNPDLVRLSAEEALKRRPAETAFAGELLVASQHVPLKPLEL* |
| Ga0066703_103805251 | 3300005568 | Soil | VSQENNNPDLVRLSAEEALKRRPAETAFAGELLVASQHVPLKPLEL* |
| Ga0070761_100165531 | 3300005591 | Soil | ARICAEEALGRRPGEFAFRGTLHVASQRIPLGPFDL* |
| Ga0070761_110237211 | 3300005591 | Soil | YDVVRICAEEALNRRPAESTFRGELIIASQTIPVGPLHI* |
| Ga0066787_101241931 | 3300005950 | Soil | GRAQYIVLAHLSQENNNPYTARISAQFALERRPLDCAFRGELMIATQEAPLKTLQL* |
| Ga0080027_102627682 | 3300005993 | Prmafrost Soil | DGRAQYIVLAHLSQENNNPYTARISAQFALERRPLDCAFRGELMIATQEAPLKTLQL* |
| Ga0075028_1002292533 | 3300006050 | Watersheds | VSQENNNPDLVRISAEEALKRRPAEAAFTGELLVASQHIPLKPLEL* |
| Ga0075028_1006251572 | 3300006050 | Watersheds | NPDLVRLSAEEALKRRPVEFAFTGELLVASQHVPLKPLEL* |
| Ga0075029_1009729353 | 3300006052 | Watersheds | AENNNPDLAKLSAEEALGRRPAECAFRGELLVATQDLPLKPLEL* |
| Ga0075030_1006431681 | 3300006162 | Watersheds | ENNNPDLVRLSAEEALKRRPAESAFTGELLVASQHVPLKPLEL* |
| Ga0075018_107207011 | 3300006172 | Watersheds | ENNNPDVARISAEEALRRRPAECAFAGELLVATQGTPMKPLEL* |
| Ga0070716_1006734721 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LAHISQENNNPDLARISAEEALGRRPAENRFTGELLVATQDAPMKPLQL* |
| Ga0070765_1007273591 | 3300006176 | Soil | HLSLENNNPDVARISAEEALGRRPAHCPFTGELLVATQGTPLKPLEL* |
| Ga0070765_1010384661 | 3300006176 | Soil | AHLSQENNNPDLARLSAEEALRRRPAECAFHGELLIATQDRPLEPLEF* |
| Ga0079222_124860671 | 3300006755 | Agricultural Soil | NNNNPDVARICAEEALGRRPSLFSFRGELLIASQHQPLAPIQL* |
| Ga0066660_104576271 | 3300006800 | Soil | NNPDTARESAKEALGRRPVDSTFTGELLVASQHIPLRPLEL* |
| Ga0079221_100411031 | 3300006804 | Agricultural Soil | NPDVARICAEEALGRRPSLFAFRGELLIASQHEPLAPIQL* |
| Ga0079221_113758171 | 3300006804 | Agricultural Soil | LAHLSQENNNPYTAEISAKEALNRRPAECAFQGELLIASQEKPLKPLDL* |
| Ga0079220_121246162 | 3300006806 | Agricultural Soil | ARLSAEEALGRRPAENAFRGELLIATQDAPIRTLQL* |
| Ga0073928_101953943 | 3300006893 | Iron-Sulfur Acid Spring | SQENNNPDLVRLSAEEALNRRPSGFEFLGKLLVASQQVPLKPLDL* |
| Ga0073928_106951831 | 3300006893 | Iron-Sulfur Acid Spring | VRLSAEDALNRRPTGFEFLGQLLVASQQVPLKPLDL* |
| Ga0073928_109563952 | 3300006893 | Iron-Sulfur Acid Spring | SQENNNPDLVRLSAEEALNRRPLGFEFLGKLLVASQQVPLKPLDL* |
| Ga0075435_1000919161 | 3300007076 | Populus Rhizosphere | TAEICAQEALGRRPAEAAFTGQLLVASQSKPLKPLEL* |
| Ga0099794_104417172 | 3300007265 | Vadose Zone Soil | SQENNNPDLVLLSAEEALGRRPAECAFTGELLVASQHVPLKPLEL* |
| Ga0066710_1043183761 | 3300009012 | Grasslands Soil | SRARYLVLAPLSEENNNPDLARLSAEEALSRRPAEATFRGELLIATQRVPLKPLTL |
| Ga0066710_1047444201 | 3300009012 | Grasslands Soil | AVARISAEEALNRRPVETVFRGEMLVATQREPVRPLEL |
| Ga0099829_105169863 | 3300009038 | Vadose Zone Soil | RYLVLAHLSQENNNPHTARISAQEALNRRPSERAFTGHLLIASQQEALTPIQL* |
| Ga0099830_102840452 | 3300009088 | Vadose Zone Soil | YLVLAHISEENNNPDTLRISAEEALARRPVDSAFRGELLVASQHVPLRPLEL* |
| Ga0099830_105421601 | 3300009088 | Vadose Zone Soil | QENNNPDLVRLSAEEALKRRPAESGFTGELLVASQHVPLKPLQL* |
| Ga0099830_115124952 | 3300009088 | Vadose Zone Soil | EENNNPDTARISAQEALSRRPAECAFRGELLVASQHVPLQPLEL* |
| Ga0099828_113629612 | 3300009089 | Vadose Zone Soil | RLCAEEALGRRSTECAFRGELHIASQRTPLGPFAL* |
| Ga0105240_113165171 | 3300009093 | Corn Rhizosphere | ILAHISQENNNPDLARLSAEEALGRRPAENRFTGELLVATQDAPMKPLEL* |
| Ga0066709_1007529711 | 3300009137 | Grasslands Soil | HVSQENNNPDLVRLSAEEALKRRPAETAFAGELLVASQHVPLKPLEL* |
| Ga0114945_106215472 | 3300009444 | Thermal Springs | ARLSAEEALGRRPAEAAFRGELLVASQQIPLGPFELG* |
| Ga0116221_12750321 | 3300009523 | Peatlands Soil | LAHMSEENNNPYTATISATEALSRRPAEAAFSGELLLASQHVPLRPLDL* |
| Ga0116113_12046221 | 3300009638 | Peatland | ISAEEALGRRPAERAFRGELLIADQHTPLQPLNL* |
| Ga0116216_107563891 | 3300009698 | Peatlands Soil | NNPDVARISAEEALGRRPAECAFAGELIIAMQHQPLAPIQL* |
| Ga0126374_103223141 | 3300009792 | Tropical Forest Soil | NNNIYTAEICAKEALTRRAGEVAFTGELLVASQHVPLKPLEL* |
| Ga0116219_105851632 | 3300009824 | Peatlands Soil | YTATISATEALSRRPAEAAFSGELLLASQHVPLRPLDL* |
| Ga0134067_100680603 | 3300010321 | Grasslands Soil | LSEENNNPFTAEICAQEALGRRPTEAAFTGQLLVASQHEPLKPMEL* |
| Ga0134064_100967711 | 3300010325 | Grasslands Soil | ESAKEALGRRPVDSTFTGELLVASQHIPLRPLEL* |
| Ga0074044_111390841 | 3300010343 | Bog Forest Soil | LVRLSAEEALNRRPAESPFSGELLIASQHVPLKPLEL* |
| Ga0126370_116860992 | 3300010358 | Tropical Forest Soil | LSAEEALGRRPSEFAFTGELLVASQHVPLKPLQL* |
| Ga0126370_121894891 | 3300010358 | Tropical Forest Soil | NNHPEVARISAEEALNRRPAEAAFRGEMLVATQTQPLRPLEL* |
| Ga0126376_106691151 | 3300010359 | Tropical Forest Soil | VVKISAEQALARRPAECAFAGELLLASQHVPLKPLEL* |
| Ga0126372_120303282 | 3300010360 | Tropical Forest Soil | ENNNPDLARLSAEEALGRRPSEFAFTGELLVASQHVPLKPLQL* |
| Ga0126372_127272201 | 3300010360 | Tropical Forest Soil | PDLVRLSAEEALRRRPADSTFSGELLVASQDVPLRPLEL* |
| Ga0126372_132674702 | 3300010360 | Tropical Forest Soil | RISAEQALRRRPAECEFAGELLLASQQVPLKPLEL* |
| Ga0126378_100485481 | 3300010361 | Tropical Forest Soil | VARISAEEALNRRPAEAAFRGEMLVATQTQPLRPLEL* |
| Ga0126378_100638024 | 3300010361 | Tropical Forest Soil | LARLSAEEALGRRPAEAAFTGELLVASQTVPLKPLEL* |
| Ga0126377_116497221 | 3300010362 | Tropical Forest Soil | ISAEQALEKRPAECAFSGELLLASQRAPLKPLEL* |
| Ga0126377_128777931 | 3300010362 | Tropical Forest Soil | NNPDVVKISAEQALERRPAECAFAGELLLASQRVPLKPLEL* |
| Ga0126379_102063691 | 3300010366 | Tropical Forest Soil | LLCAEEALGRRPREFSFTGELLVASQDVPLKPLEL* |
| Ga0134125_124869421 | 3300010371 | Terrestrial Soil | PDVARISAEEALGRRPAESAFGGELRIASQAEPLATIEL* |
| Ga0126381_1043098152 | 3300010376 | Tropical Forest Soil | ICAEEALGRRPAESVFTGELLVTSQQVPLKPLQL* |
| Ga0136449_1008915701 | 3300010379 | Peatlands Soil | ICAEEALRRRPSECAFAGELLIASQDEPLRPMQL* |
| Ga0136449_1017016901 | 3300010379 | Peatlands Soil | NHPEVARISAQEALGRRPGEHAFRGQLLIASQREPLPPMQL* |
| Ga0136449_1044735341 | 3300010379 | Peatlands Soil | ICAEEALGRRPGEAAFRGELLVASQHEPLAPIQL* |
| Ga0126383_101194504 | 3300010398 | Tropical Forest Soil | VLAHISQENNNPDLALLCAEEALGRRPREFAFTGELLVASQDVPLKPLEL* |
| Ga0134122_124747681 | 3300010400 | Terrestrial Soil | NNPDVARICAAEALDRRASSSAPFSGQLLIAEQHQPLLPLQL* |
| Ga0150983_103434281 | 3300011120 | Forest Soil | EICAKQALSRRPSEAAFRGELLIASQHEPLAPIQL* |
| Ga0150983_114511171 | 3300011120 | Forest Soil | NNNPHTARISAVEALNRRPAESAFSGELLIASQHVPLKPLEL* |
| Ga0137391_115221722 | 3300011270 | Vadose Zone Soil | ARISAEEALGRRPSDAAFHGELRIASQHIPLPLEL* |
| Ga0137393_100854381 | 3300011271 | Vadose Zone Soil | LSAEEALKRRPTESTFTGELLVASQHVPLKPLEL* |
| Ga0137393_105220662 | 3300011271 | Vadose Zone Soil | NNPDLARISAEEALSRRPAECAFGGQLLVASQEVPLSPIQL* |
| Ga0137393_106851842 | 3300011271 | Vadose Zone Soil | DVVKICAEQALDCRPAEGAFAGELLLASQQVPLKPMNL* |
| Ga0137393_107221351 | 3300011271 | Vadose Zone Soil | LAHISQENNNPDTLRISAEEALARRPVDSAFRGELLVASQHVPLRPLEL* |
| Ga0137389_101122591 | 3300012096 | Vadose Zone Soil | ARYLVLAHISQENNNPDTLRISAEEALARRPVDSAFRGELLVASQHVPLRPLEL* |
| Ga0137389_101340563 | 3300012096 | Vadose Zone Soil | RLSAEEALRRRPADSAFTGELLVASQHVPLKPLEL* |
| Ga0137388_106420262 | 3300012189 | Vadose Zone Soil | LAHVSQENNNPDLVRISAEEALMRRPAESTFTGELLVASQHVPLKPLEL* |
| Ga0137383_106420322 | 3300012199 | Vadose Zone Soil | VLAHISQENNNPDVVRICAEQALGCRPAEAAFTGELLLASQQVPLKPLEL* |
| Ga0137365_102829693 | 3300012201 | Vadose Zone Soil | LAHVSQENNNPDLVRLSAEEALKRRPTESTFTGELLVASQHIPLKPLEL* |
| Ga0137363_102799971 | 3300012202 | Vadose Zone Soil | MTIKEPFQQSNNPDLVLLSAEEALRRRPAECEFTGELLVASQHVPLKPLEL* |
| Ga0137363_117881721 | 3300012202 | Vadose Zone Soil | RISAEEALGRRPAECAFGGQLLVASQQVPLTPIQL* |
| Ga0137399_116512632 | 3300012203 | Vadose Zone Soil | HLSEENNNPDLARISAQEALNRRPAECAFRGELLVASQHIPLKPLEL* |
| Ga0137381_106482662 | 3300012207 | Vadose Zone Soil | NNPFTAEICAQEALGRRPAESAFTGQLLVASQHAPLKPMEL* |
| Ga0137379_100507746 | 3300012209 | Vadose Zone Soil | QENNNPDLVRISAEEALGRRPAESAFTGELLVASQQVPLKPLEL* |
| Ga0137378_106819423 | 3300012210 | Vadose Zone Soil | QENNNPDLVRLSAEEALNRRPAESAFNGELLVASQQVPLRPLEL* |
| Ga0137386_103027742 | 3300012351 | Vadose Zone Soil | VVRICAEQALGCRPAEAAFTGELLLASQQVPLKPLEL* |
| Ga0137385_114685191 | 3300012359 | Vadose Zone Soil | AHLSEENNNPFTAEICAQEALGRRPAESAFTGQLLVASQHAPLKPMEL* |
| Ga0137360_104024051 | 3300012361 | Vadose Zone Soil | ISAEEALMRRPAESTFTGELLVASQHVPLRPLEL* |
| Ga0137361_101036591 | 3300012362 | Vadose Zone Soil | VRISAEEALRRRPTESPFTGELLIASQHIPLKPLQF* |
| Ga0137361_117845762 | 3300012362 | Vadose Zone Soil | QISAEEALNRRPAESAFGGQLLVASQLVPLAPIQL* |
| Ga0137390_102318071 | 3300012363 | Vadose Zone Soil | LRISAEEALARRPVDSAFRGELLVASQHVPLRPLEL* |
| Ga0137390_105327271 | 3300012363 | Vadose Zone Soil | RLSAEQALKRRPAESAFTGELLVASQHVPLKPLEL* |
| Ga0137397_104912031 | 3300012685 | Vadose Zone Soil | QENNNPDLVLLSAEEALGRRPAECAFTGELLVASQHVPLKPLEL* |
| Ga0137395_108982722 | 3300012917 | Vadose Zone Soil | VKISAEQALGCRPAESAFAGELLLASQQVPLKPLEL* |
| Ga0137396_103858883 | 3300012918 | Vadose Zone Soil | AHLSLENNNPDLARISAEEALGRRPAECAFGGQLLVASQQVPLRPIQL* |
| Ga0137396_105233992 | 3300012918 | Vadose Zone Soil | HVSEENNNPDLVRLSAEEALNRRSAESAFTGELLVASQHVPLKPLEL* |
| Ga0137413_108297691 | 3300012924 | Vadose Zone Soil | NNPDLVRISAEEALRRRPTESPFTGELLIASQHVPLKPLEL* |
| Ga0137416_114823372 | 3300012927 | Vadose Zone Soil | AHLSQENNNPDLARISAEEALSRRPAECAFGGQLLVASQEVPLTPIQL* |
| Ga0137416_118765871 | 3300012927 | Vadose Zone Soil | QENNNPDVVKICAEQALGCRPAESTFAGELLLASQQVPLKPLNL* |
| Ga0137404_115432291 | 3300012929 | Vadose Zone Soil | VLLSAEEALGRRPAECAFTGELLVASQHVPLKPLEL* |
| Ga0164303_110535622 | 3300012957 | Soil | HISQENNNPDLARLSAEEALGRRPAENRFTGELLVATQDAPMKPLEL* |
| Ga0164301_100416853 | 3300012960 | Soil | AHLSQENNNPYTAEISAKEALDRRPAECAFHGELLIASQEKPLKPLEL* |
| Ga0153916_107405331 | 3300012964 | Freshwater Wetlands | LSAEEALGRRPGECAFRGTLHIASQRTPLGPFEL* |
| Ga0126369_131263241 | 3300012971 | Tropical Forest Soil | DVVKISAEQALERRPPECAFAGELLLASQQVPLKPLEL* |
| Ga0126369_131469621 | 3300012971 | Tropical Forest Soil | HISQENNNPDVVKICAEQALARRPAERAFAGELLLASQHVPLKPLEL* |
| Ga0134077_103149631 | 3300012972 | Grasslands Soil | LVRLSAEEALKRRPAETAFAGELLVASQHVPLKPLEL* |
| Ga0134075_100106581 | 3300014154 | Grasslands Soil | NNNPDLVRLSAEEALTRRPAESAFTGELLVASQQVPLKPLQL* |
| Ga0134079_103606091 | 3300014166 | Grasslands Soil | HLSEENNNPDTARESAKEALGRRPAFTGELLVASQHVPLKPLEL* |
| Ga0134079_103630481 | 3300014166 | Grasslands Soil | LAHLSEENNNPDTARESAKEALGRRPAGSPFTGELLVASQHIPLRPLEL* |
| Ga0137414_10181472 | 3300015051 | Vadose Zone Soil | AHVSQENNNPDLVRLSAEEALKRRPAESAFTGELLVASQYIPLKPLQL* |
| Ga0137414_11251951 | 3300015051 | Vadose Zone Soil | AHVSQENNNPDLVRLSAEEALKRRPAESAFTGELLVAVASQYIPLKPLQL* |
| Ga0137405_12675831 | 3300015053 | Vadose Zone Soil | ARYLVLGHVSLENNNPDVARISAEEALNRRPAERAFRGELFVATQREPMQPLEL* |
| Ga0137420_11001241 | 3300015054 | Vadose Zone Soil | LSAEEALRRRPAESAFSGELLIASQREPLKPLEL* |
| Ga0132255_1023677382 | 3300015374 | Arabidopsis Rhizosphere | ARLSAEEALNRRPAEQAFRGELLVATQDQPMKPLEL* |
| Ga0182041_112245341 | 3300016294 | Soil | YLVLAHISQENNNPDLALLCAEEALGRRPAEFAFTGELLVASQDVPLKPLEL |
| Ga0182032_105049892 | 3300016357 | Soil | SQENNNPDLARLSAEEALGQRPAEAAFRGELLIASQHAPLKPLEL |
| Ga0182040_103250532 | 3300016387 | Soil | YLVLAHMSQENNNPDLALLSAEEALRRRPAEAAFAGQLLLASQYVPLKPLEL |
| Ga0182037_101394961 | 3300016404 | Soil | YLVLAHISQENNNPDLARLCAEEALGRRPAEFAFSGELLVASQHAPLKPLEL |
| Ga0182038_108047862 | 3300016445 | Soil | RISAEEALRRRPSESSFTGELLITSQRTPLRPLEL |
| Ga0187818_100660391 | 3300017823 | Freshwater Sediment | VLAHISQENNNPDLARLSAEEALRRRPAEAAFTGELFVASQHVPLNPLEL |
| Ga0187806_11198241 | 3300017928 | Freshwater Sediment | RISAEEALSRRPAEAAFAGELLVASQQVPLKPLDL |
| Ga0187825_100148043 | 3300017930 | Freshwater Sediment | RICAEEALGRRPSLFAFRGELQIPSQHEPLAPIQL |
| Ga0187779_109151331 | 3300017959 | Tropical Peatland | RITAEEALNRRPVEAAFRGEMLVATQTAPVRPLEL |
| Ga0187781_102733602 | 3300017972 | Tropical Peatland | LSAEEALGRRPAGPAAFAGELYIASQRTPLGPFVF |
| Ga0187767_101586461 | 3300017999 | Tropical Peatland | VLAHISQENNNPDLAHLSAREALDRRPADAAFKGQLLVASQHIPLQPLEL |
| Ga0187867_100701284 | 3300018033 | Peatland | LARICAEEALARRPGEFAFRGTLHVASQRIPLGPFEL |
| Ga0187862_102186471 | 3300018040 | Peatland | LVRLSAEEALRRRPAESAFTGEVLIASQHVPLRPLEL |
| Ga0187766_102111193 | 3300018058 | Tropical Peatland | LAHISQENNHPALVRLSAEEALNRRPAECAFTGELLVASQHVPLKPLEL |
| Ga0187784_104987232 | 3300018062 | Tropical Peatland | TPDLARISAEEALNRRPSECAFRGELLLASQDTPLGPLLL |
| Ga0187769_108712631 | 3300018086 | Tropical Peatland | NNHPDVARLSAEEALGRRPSGPAAFAGELYVASQRAPLGPFLF |
| Ga0187769_111080702 | 3300018086 | Tropical Peatland | YTATISATEALSRRPAEAAFRGELLLASQRVPLKPLEL |
| Ga0187769_115113061 | 3300018086 | Tropical Peatland | LVLAHISQENNNPDVARISAEEALHRRPAEVAFAGELLVASQHTPLRPLEL |
| Ga0187771_107340241 | 3300018088 | Tropical Peatland | RISAEEALGRRAPECAFRGELLVASQRVPLKPLEL |
| Ga0066655_105323591 | 3300018431 | Grasslands Soil | GGRICGEQAPGCRPAEAAFTGELLLASQQVPLKPLEL |
| Ga0066667_102613181 | 3300018433 | Grasslands Soil | AHVSQENNNPDLVRLSAEEALKRRPAETAFAGELLVASQHVPLKPLEL |
| Ga0066662_101091813 | 3300018468 | Grasslands Soil | NNPDVARICAEEALGRRPAPTAFRGELLVASQRVPLGPLVL |
| Ga0066662_107116061 | 3300018468 | Grasslands Soil | NPDVARICAEEALGRRPAPTAFRGELLVASQRVPLGPLVL |
| Ga0066669_117542152 | 3300018482 | Grasslands Soil | RLSAEQALEKRPAECAFHGQLMLASQAAPLKPLEL |
| Ga0179592_100585631 | 3300020199 | Vadose Zone Soil | QENNNPDLVRLSAEEALKRRPAESAFSGELLVASQHVPLKPLEL |
| Ga0210407_101093251 | 3300020579 | Soil | HLSQENNNPDLARLSAEEALGRRPAECAFHGELLVAQQGAPLKTLEL |
| Ga0210407_114237901 | 3300020579 | Soil | HLSQENNNPDLARLSAEEALSRRPAECAFHGELLVAQQGTPLKTLEL |
| Ga0210399_101569991 | 3300020581 | Soil | HVSQENNNPDLVRLSAEEALGRRPAESPFTGELLIASQHIPLKPLEL |
| Ga0210399_108521072 | 3300020581 | Soil | NIHTARISAEEALGRRPAEAAFTGELLIASQHTPLKPLEL |
| Ga0210399_110466841 | 3300020581 | Soil | SQENNNPDLVRLSAEEALKRRPAECAFTGELLVASQHVPLKPLEL |
| Ga0210401_106627582 | 3300020583 | Soil | ENNNPDLARLSAEEALSRRPAEMAFAGELLVASQHVPLKPLDL |
| Ga0210404_102487321 | 3300021088 | Soil | HLSLENNNPDLARISAEEALGRRPAECAFGGQLLVASQEVPLAPIQL |
| Ga0210404_105875441 | 3300021088 | Soil | DLARISAEEALNRRPAECAFGGQLLVASQEVPLNPIQL |
| Ga0210404_107316122 | 3300021088 | Soil | HISQENNNPDLARISAEEALNRRPAECAFGGQLLVASQEVPLNPIQL |
| Ga0210404_108080851 | 3300021088 | Soil | LAHLSQANNNPDLARLSAEEALNRRPAECAFRGELLVATQDVPLKPLEL |
| Ga0210406_102877682 | 3300021168 | Soil | NNNNPDVARICAEEALGRRPSLFAFRGELLIASQHEPLAPLQL |
| Ga0210400_111006831 | 3300021170 | Soil | NPDLARISAEEALGRRPAECAFGGQLLMASQQVPLAPIQL |
| Ga0210408_102894061 | 3300021178 | Soil | QENNNPDLVRLSAEEALKRRPAESTFTGELLVASQHAPLKSLEL |
| Ga0210408_114477402 | 3300021178 | Soil | RLSAEEALNRRPAEHAFRGELLVATQDQPMKPLEL |
| Ga0210393_102566561 | 3300021401 | Soil | PDLARICAEEALNRRASDFPFRGTLHVASQRIPLGPFEL |
| Ga0210387_103311312 | 3300021405 | Soil | LAHLSLENNNPDVARISAEEALRRRPAECAFSGELLVATQGTPMKPLEL |
| Ga0210394_101479883 | 3300021420 | Soil | AHLSEENNNPDAARISAKEALDRRPTFAGELLVASQVHPLTPIEL |
| Ga0210394_112898901 | 3300021420 | Soil | ILAHVSLENNNPDVVRISAEEALRRRPAERAFTGELLIANQHTPLQPLNL |
| Ga0210384_118468702 | 3300021432 | Soil | ISQENNNPDLVRLSAEEALGRRPAENRFAGELLVATQDAPMKPLEL |
| Ga0210391_101106101 | 3300021433 | Soil | YLVLAHLSLENNNPDVARISAEEALHRRPAECAFNGELLVATQGTPMKPLEL |
| Ga0210391_102608621 | 3300021433 | Soil | DLVRISAEEALRRRPAECAFTGELLVASQCVPLKPLEL |
| Ga0210391_108313242 | 3300021433 | Soil | LSLENNNPDVARISAEEALRRRPAECAFNGELLVATQGTPMKPLEL |
| Ga0210392_103616151 | 3300021475 | Soil | LVLLSAEEALRRRPSESPFTGELLIASQHVPLKPLEL |
| Ga0210398_100408291 | 3300021477 | Soil | DLARLSAEEALGRRPAEAAFTGELLVASQRVPLKPLNL |
| Ga0210398_112439881 | 3300021477 | Soil | NNPDLARLSAEEALDRRPAECAFRGELLIATQEVPLKPLEL |
| Ga0210402_100887874 | 3300021478 | Soil | LENNNPDVARISAEEALRRRPAECAFTGELLVATQGTPMKSLEL |
| Ga0210402_114380401 | 3300021478 | Soil | PDLVRISAEEALGRRPAECAFGGELLVASQHVPLKSLEL |
| Ga0210410_114835211 | 3300021479 | Soil | DLVRLSAEEALNRRPAECAFGGELLVASQHVPLKPLEL |
| Ga0210409_102548402 | 3300021559 | Soil | VRLSAEEALRRRPSESPFTGELLIASQHVPLKPLEL |
| Ga0212123_104361232 | 3300022557 | Iron-Sulfur Acid Spring | VVRISAEEALGRRPAERAFSGQLFIADQRTPLASLQL |
| Ga0224551_11041621 | 3300023259 | Soil | LVLAHISENNNNPHLARLCAEEALERRPAEAKFHGQLFITSQHAPLAGFDL |
| Ga0137417_11340541 | 3300024330 | Vadose Zone Soil | RPPLSAEEALKRRPAESAFSGELLVASQHVPLKLLQL |
| Ga0209320_103662152 | 3300025155 | Soil | DVARICAEEALGRRPSECAFLGQLLLASQDQPLPPIQL |
| Ga0207646_116413231 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | SEENNNPYTARISAEEALNRRPAEAAFHGELLLASQRVPLKPLEL |
| Ga0207700_100515904 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VVKISAEQALGCRPVECAFTGELLLASQQVPLKPLNL |
| Ga0209686_11231912 | 3300026315 | Soil | PDLVRLSAEEALKRRPAETAFAGELLVASQHVPLRPLEL |
| Ga0257155_10554391 | 3300026481 | Soil | NNNPDLARLSAEEALNRRPAECAFHGELLIATQDRPLKPLEL |
| Ga0257153_10336862 | 3300026490 | Soil | ISQENNNPDVVKICAEQALGCRPAESTFAGELLLASQQVPLKPLNL |
| Ga0209056_105664551 | 3300026538 | Soil | HLSEENNNPFTAEICAQEALDRRPAEAAFTGELLVASQHVPLKPLEL |
| Ga0209648_101866743 | 3300026551 | Grasslands Soil | HVSQENNNPDLVRLSAEEALGRRPAECAFTGELLVASQHVPLKSLEL |
| Ga0209648_106784071 | 3300026551 | Grasslands Soil | LVRLSAEEALKRRPAESGFTGELLVASQHVPLKPLQL |
| Ga0207764_1126992 | 3300026839 | Tropical Forest Soil | HLSAKEALDRRPAEAAFTGELLVASQVVPLKPIEL |
| Ga0207741_10115622 | 3300026941 | Tropical Forest Soil | LVLAHISQENNNPDLAHLSAKEALDRRPAEAAFTGELLVASQVVPLKPIEL |
| Ga0209730_10337881 | 3300027034 | Forest Soil | LTRISAEEALSRRPAECAFSGQLMVASQEVPLNPIQL |
| Ga0207944_10041582 | 3300027105 | Forest Soil | HMSQENNNPDLALLSAEEALRRRPAEAAFAGQLLLASQHAPLKPLEL |
| Ga0207505_1134963 | 3300027459 | Soil | DLARLSAEEALGRRPAECAFTGELLIANQHEPLKPLQL |
| Ga0209388_10299823 | 3300027655 | Vadose Zone Soil | MTIKEPFQQRSNPDLVLLSAEEALRRRPAECAFTGELLVASQHVPLKPLEL |
| Ga0209626_11126272 | 3300027684 | Forest Soil | ENNNPDLVRLSAEEALNRRPAGFEFLGQLLVASQQVPLKPLDL |
| Ga0209248_100123681 | 3300027729 | Bog Forest Soil | SQENNNPYLVRISAEEALGRRSAECAFHGELLVASQEVPLKPLEL |
| Ga0209248_101582091 | 3300027729 | Bog Forest Soil | SQENNNPYLVRISAEEALGRRSAECAFHGELLVASQDRPLRPLEL |
| Ga0209772_102632431 | 3300027768 | Bog Forest Soil | PDVVRISAEEALGRRPAERAFRGELLIANQHTPLQPLNL |
| Ga0209040_103145802 | 3300027824 | Bog Forest Soil | PDLVRLSAEEALHRRPAEAAFTGEVLIASQHVPLKTLDL |
| Ga0209039_101502231 | 3300027825 | Bog Forest Soil | ENNNPDLARLSAEEALNRRPAECAFHGELLIATQDRPLKPLEL |
| Ga0209039_103090561 | 3300027825 | Bog Forest Soil | MSEENNNPYTATISATEALSRRPAEAAFSGELLLASQHVPLRPLDL |
| Ga0209180_107821142 | 3300027846 | Vadose Zone Soil | AHLSQENNNPDLARLSAEEALGRRPIECAFTGELLIANQREPLKPLQL |
| Ga0209274_100127061 | 3300027853 | Soil | ARICAEEALGRRPGEFAFRGTLHVASQRIPLGPFDL |
| Ga0209517_100671051 | 3300027854 | Peatlands Soil | HMSEENNNPYTATISATEALSRRPAEAAFSGELLLASQHVPLRPLDL |
| Ga0209166_104212481 | 3300027857 | Surface Soil | SQENNNPDLARLSAEEALGRRPAECAFTGELLIATQREPLKPLQL |
| Ga0209701_100317865 | 3300027862 | Vadose Zone Soil | HLSLENNNPDLARISAEEALGRRPAECTFGGQLLVASQQVPLRPIQL |
| Ga0209283_108497693 | 3300027875 | Vadose Zone Soil | LSQENNSPDLARLSAEEALNRRPAEAAFRGELLLALQRVPLKPLELG |
| Ga0209275_105830591 | 3300027884 | Soil | VARISAEEALGRRPAESAFGGELLIASQAEPLQTIEL |
| Ga0209698_105860613 | 3300027911 | Watersheds | ENNNPDLVRLSAEEALKRRPAESAFTGELLVASQHVPLKPLEL |
| Ga0308309_102590191 | 3300028906 | Soil | NPDLARLSAEEALGRRPAECAFRGELLVATQDVPLKPLQL |
| Ga0308309_102652202 | 3300028906 | Soil | AHLSEINNNPWVAEICAKQALSRRPSEAAFRGELLIASQHEPLAPIQL |
| Ga0308309_111715751 | 3300028906 | Soil | RICAEEALGRRPGEFAFRGTLHVASQRIPLGPFEL |
| Ga0308309_115862921 | 3300028906 | Soil | VLAHLSLENNNPDLARLSAEEALNRRPTECAFHGELMIATQDRPLKPLEL |
| Ga0311340_103480762 | 3300029943 | Palsa | RLSAEEALGRRADDFAFRGTLHIASQRVPLGPFEL |
| Ga0311357_108120202 | 3300030524 | Palsa | PDVVRISAEEALRRRPADRPFNGELLIANQHTPLAPLNL |
| Ga0311355_104638321 | 3300030580 | Palsa | AHVSLENNNPDVVRISAEEALRRRPADRPFNGELLIANQHTPLAPLNL |
| Ga0311355_111477751 | 3300030580 | Palsa | VRICAEEALNRRPAESTFRGELIIASQTIPIGPLHI |
| Ga0302311_109310361 | 3300030739 | Palsa | LARISAEEALGRRPGEYAFRGTLHVASQRTPLGPFEL |
| Ga0265762_11347791 | 3300030760 | Soil | TNNNYDVVRICAEEALNRRPAESTFRGELIIASQTIPIGPLNI |
| Ga0170824_1042561381 | 3300031231 | Forest Soil | ARYLVLAHISQENNNPDVVRICAEQALGCRPAESTFSGELLLASQHVPLKPLQL |
| Ga0302324_1019265721 | 3300031236 | Palsa | ETNNNYDVVRICAEEALNRRPAESSFRGELIIASQTIPVGPLHI |
| Ga0170819_170498381 | 3300031469 | Forest Soil | AENNHPDVARISAEEALGRRPAESAFGGELLIASQAEPLQTIEL |
| Ga0318573_100295261 | 3300031564 | Soil | EENNNPFAAEICAQEALNRRPPEAAFTGELLVASQHVPLKPLEL |
| Ga0310686_1090365521 | 3300031708 | Soil | PDVVRISAEEALRRRPADRAFTGELLIANQHTPLQPLNL |
| Ga0307476_108241931 | 3300031715 | Hardwood Forest Soil | SNNNPDVARICAEEALGRRQAASAFHGELLVASQHEPLPPIQL |
| Ga0307469_104758761 | 3300031720 | Hardwood Forest Soil | PYLARISAEEALDRRPAESAFTGELLIASQHIPLKPLDL |
| Ga0318500_101947853 | 3300031724 | Soil | ENNNPDLARLSAEEALGRRPAEFAFTGELLVASQHVPLKPLEL |
| Ga0307475_115058931 | 3300031754 | Hardwood Forest Soil | RLSAEEALRRRPAESAFTGELLVASQHVPLKPLEL |
| Ga0318547_107811673 | 3300031781 | Soil | DENNNVHTATISAEEALGRRPAGAAFTGELLVASQQYALRPLEL |
| Ga0318529_102163271 | 3300031792 | Soil | NNPDLARLSAEEALGRRPAEFAFTGELLVASQHVPLKPLEL |
| Ga0318523_103860951 | 3300031798 | Soil | LVLAHISQENNNPDLARLSAEEALNRRPSEAAFAGELLIASQHVPLTPLEL |
| Ga0307478_102344731 | 3300031823 | Hardwood Forest Soil | VRISAEEALRRRPTESPFTGELLVASQHVPLKPLQF |
| Ga0307478_106319331 | 3300031823 | Hardwood Forest Soil | NNNPDLARISAEEALGRRPAECAFGGQLLVASQEVPLAPIQL |
| Ga0307478_110869142 | 3300031823 | Hardwood Forest Soil | RISAEEALGRRPAERAFSGQLLIADQRTPLASLQL |
| Ga0310917_109499291 | 3300031833 | Soil | NNPDVVRICAEQALGRRPAECAFSGELLLASQFVPLKPLEL |
| Ga0310916_116461231 | 3300031942 | Soil | DLARLSAEEALGQRPAEAAFRGELLIASQHAPLKPLEL |
| Ga0310909_113044751 | 3300031947 | Soil | AEICAREALNRRPAESAFTGELLVAQQHLALASIEL |
| Ga0307479_109558992 | 3300031962 | Hardwood Forest Soil | RLSAEEALNRRPAECAFRGELLTASQHVPLRPLEL |
| Ga0307479_121185521 | 3300031962 | Hardwood Forest Soil | VVKISAEQALGGRPAECAFVGELLLASQQVPLKPLNL |
| Ga0306922_116788981 | 3300032001 | Soil | LALLCAEEALGRRPAEFAFTGELLVASQDVPLKPLEL |
| Ga0318545_102975381 | 3300032042 | Soil | AHISQENNNPDLARLSAEEALNRRPSEAAFAGELLIASQHVPLTPLEL |
| Ga0318533_108122121 | 3300032059 | Soil | ENNNPDLALLCAEEALGRRPAEFAFTGELLVASQDVPLKPLEL |
| Ga0318533_111958161 | 3300032059 | Soil | VLAHISQENNNPDLALLCAEEALGRRPAEFAFTGELLVASQDVPLKPLEL |
| Ga0306924_108716681 | 3300032076 | Soil | RISAQEALSRRPSETAFRGEMLVATQNAPVRPLQL |
| Ga0307471_1013795433 | 3300032180 | Hardwood Forest Soil | LAHLSLENNNPDLARISAEEALGRRPAECAFGGQLLMASQQVPLAPIQL |
| Ga0307471_1021296702 | 3300032180 | Hardwood Forest Soil | RYLVLGHVSQENNHPDVARISAEEALNRRPTETAFRGEMLVATQREPVRPLEL |
| Ga0307472_1007183241 | 3300032205 | Hardwood Forest Soil | PDLVRLSAEEALKRRPAESMFTGELLVASQREPLKPLEL |
| Ga0335081_103757723 | 3300032892 | Soil | ARYLVLAHISQENNNPDLAKLSAEEALGRRPAENAFAGELLIASQHTPLRPLEL |
| Ga0335081_107686652 | 3300032892 | Soil | DLVRLSAEEALKRRPAECAFSGELLVASQHVPLRPLEL |
| Ga0335074_103781391 | 3300032895 | Soil | ENNNPDLARLSAEEALNRRPAECAFQGELLIASQEKPLKPLEL |
| Ga0335083_102180963 | 3300032954 | Soil | NPDLARICAEEALGRRPAESVFTGELLVASQYVPLKPLEL |
| Ga0335076_111568532 | 3300032955 | Soil | KVRYLVLAHLSQENNNPYTAEISAKEALSRRPAEHAFAGELLIASQEKPMRTLEL |
| Ga0335073_104101551 | 3300033134 | Soil | LARLSAEQALDRRPGAFSFRGQLHVASQRIPLGPFEL |
| Ga0335077_104959912 | 3300033158 | Soil | QENNNPEVVRISAEEALGRRPAEAAFTGELLLASQHVPLKPLQL |
| Ga0335077_120339872 | 3300033158 | Soil | LAHLSQENNDPYLARLSAEVALGRRPSEQAFRGQLLIATQDAPMPPLEL |
| Ga0310914_100617745 | 3300033289 | Soil | ISQENNNPDVVRICADQALGRRPAECAFSGELLLASQFVPLKPLEL |
| Ga0318519_101565611 | 3300033290 | Soil | SQENNNPDVVRICAEQALGRRPAECAFSGELLLASQFVPLKPLEL |
| Ga0371489_0537951_350_511 | 3300033755 | Peat Soil | RYLVLAHISQENNNPDLVRLSAEEALRRRPAEAAFSGELLLASQHVPLKPLEL |
| Ga0314865_091186_590_703 | 3300033806 | Peatland | MARLSAEEALGRRPECAAFRGELHVASQHTPLGPFVF |
| Ga0371488_0570636_359_502 | 3300033983 | Peat Soil | HISQENNNPDLVRLSAEEALRRRPAEAAFSGELLLASQHVPLKPLEL |
| ⦗Top⦘ |