| Basic Information | |
|---|---|
| Family ID | F012891 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 276 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MHGMLSAAILICVFAAVAVACLYVAGRVYLAGSRRGDSS |
| Number of Associated Samples | 189 |
| Number of Associated Scaffolds | 276 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 6.88 % |
| % of genes near scaffold ends (potentially truncated) | 21.74 % |
| % of genes from short scaffolds (< 2000 bps) | 82.97 % |
| Associated GOLD sequencing projects | 172 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (69.203 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.551 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.449 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.696 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 50.75% β-sheet: 0.00% Coil/Unstructured: 49.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 276 Family Scaffolds |
|---|---|---|
| PF08768 | THAP4_heme-bd | 55.43 |
| PF02635 | DrsE | 26.81 |
| PF01475 | FUR | 3.62 |
| PF07685 | GATase_3 | 2.17 |
| PF01571 | GCV_T | 1.45 |
| PF01619 | Pro_dh | 0.72 |
| PF00069 | Pkinase | 0.72 |
| PF08669 | GCV_T_C | 0.72 |
| PF08353 | MurT_C | 0.72 |
| PF01790 | LGT | 0.72 |
| PF00702 | Hydrolase | 0.36 |
| PF03807 | F420_oxidored | 0.36 |
| PF12973 | Cupin_7 | 0.36 |
| PF05140 | ResB | 0.36 |
| PF08241 | Methyltransf_11 | 0.36 |
| PF02788 | RuBisCO_large_N | 0.36 |
| PF03243 | MerB | 0.36 |
| PF00654 | Voltage_CLC | 0.36 |
| PF00485 | PRK | 0.36 |
| PF12728 | HTH_17 | 0.36 |
| PF13189 | Cytidylate_kin2 | 0.36 |
| PF02720 | DUF222 | 0.36 |
| PF00850 | Hist_deacetyl | 0.36 |
| PF08213 | COX24_C | 0.36 |
| COG ID | Name | Functional Category | % Frequency in 276 Family Scaffolds |
|---|---|---|---|
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 3.62 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.90 |
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.72 |
| COG0506 | Proline dehydrogenase | Amino acid transport and metabolism [E] | 0.72 |
| COG0682 | Prolipoprotein diacylglyceryltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| COG0769 | UDP-N-acetylmuramyl tripeptide synthase | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 0.36 |
| COG1333 | Cytochrome c biogenesis protein ResB | Posttranslational modification, protein turnover, chaperones [O] | 0.36 |
| COG1850 | Ribulose 1,5-bisphosphate carboxylase, large subunit, or a RuBisCO-like protein | Carbohydrate transport and metabolism [G] | 0.36 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 69.20 % |
| Unclassified | root | N/A | 30.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10087497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1606 | Open in IMG/M |
| 3300001356|JGI12269J14319_10198542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 792 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101190497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 651 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10075733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1317 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10310428 | Not Available | 641 | Open in IMG/M |
| 3300004082|Ga0062384_100798545 | Not Available | 659 | Open in IMG/M |
| 3300004092|Ga0062389_101714426 | Not Available | 809 | Open in IMG/M |
| 3300004152|Ga0062386_100014314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata | 5694 | Open in IMG/M |
| 3300005435|Ga0070714_100453990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1218 | Open in IMG/M |
| 3300005467|Ga0070706_100126435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2384 | Open in IMG/M |
| 3300005533|Ga0070734_10012438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 6102 | Open in IMG/M |
| 3300005537|Ga0070730_10141102 | Not Available | 1640 | Open in IMG/M |
| 3300005538|Ga0070731_10708805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 669 | Open in IMG/M |
| 3300005538|Ga0070731_11150005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 513 | Open in IMG/M |
| 3300005541|Ga0070733_10970887 | Not Available | 570 | Open in IMG/M |
| 3300005542|Ga0070732_10096160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1742 | Open in IMG/M |
| 3300005591|Ga0070761_10204462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1171 | Open in IMG/M |
| 3300005591|Ga0070761_10276093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1008 | Open in IMG/M |
| 3300005591|Ga0070761_10389797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 849 | Open in IMG/M |
| 3300005591|Ga0070761_11109743 | Not Available | 504 | Open in IMG/M |
| 3300005602|Ga0070762_10147800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1404 | Open in IMG/M |
| 3300005610|Ga0070763_10341374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 831 | Open in IMG/M |
| 3300005610|Ga0070763_10675256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 603 | Open in IMG/M |
| 3300005712|Ga0070764_10385341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 825 | Open in IMG/M |
| 3300005712|Ga0070764_10852297 | Not Available | 569 | Open in IMG/M |
| 3300005764|Ga0066903_102170608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1070 | Open in IMG/M |
| 3300005764|Ga0066903_108736335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → unclassified Nocardioidaceae → Nocardioidaceae bacterium | 515 | Open in IMG/M |
| 3300005921|Ga0070766_10804658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 640 | Open in IMG/M |
| 3300006059|Ga0075017_101198160 | Not Available | 595 | Open in IMG/M |
| 3300006102|Ga0075015_100558614 | Not Available | 666 | Open in IMG/M |
| 3300006176|Ga0070765_100233680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1680 | Open in IMG/M |
| 3300006176|Ga0070765_100952020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 812 | Open in IMG/M |
| 3300006893|Ga0073928_10297069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1215 | Open in IMG/M |
| 3300007982|Ga0102924_1015428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora | 5966 | Open in IMG/M |
| 3300009520|Ga0116214_1006533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4167 | Open in IMG/M |
| 3300009521|Ga0116222_1074809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1462 | Open in IMG/M |
| 3300009524|Ga0116225_1228033 | Not Available | 839 | Open in IMG/M |
| 3300009525|Ga0116220_10355650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 650 | Open in IMG/M |
| 3300009525|Ga0116220_10547837 | Not Available | 528 | Open in IMG/M |
| 3300009698|Ga0116216_10078044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2038 | Open in IMG/M |
| 3300009698|Ga0116216_10218400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1168 | Open in IMG/M |
| 3300009700|Ga0116217_10125815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1730 | Open in IMG/M |
| 3300009700|Ga0116217_10993335 | Not Available | 514 | Open in IMG/M |
| 3300010048|Ga0126373_11569572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata | 723 | Open in IMG/M |
| 3300010048|Ga0126373_11706523 | Not Available | 694 | Open in IMG/M |
| 3300010048|Ga0126373_12630271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 561 | Open in IMG/M |
| 3300010339|Ga0074046_10714466 | Not Available | 588 | Open in IMG/M |
| 3300010341|Ga0074045_10438436 | Not Available | 844 | Open in IMG/M |
| 3300010343|Ga0074044_11163999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → unclassified Nocardioidaceae → Nocardioidaceae bacterium | 503 | Open in IMG/M |
| 3300010358|Ga0126370_12326859 | Not Available | 531 | Open in IMG/M |
| 3300010360|Ga0126372_12153479 | Not Available | 606 | Open in IMG/M |
| 3300010361|Ga0126378_10967304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 956 | Open in IMG/M |
| 3300010379|Ga0136449_100064815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora | 7935 | Open in IMG/M |
| 3300010379|Ga0136449_100191192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 3915 | Open in IMG/M |
| 3300010379|Ga0136449_101183212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1206 | Open in IMG/M |
| 3300010379|Ga0136449_101527405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1020 | Open in IMG/M |
| 3300010379|Ga0136449_101529843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1019 | Open in IMG/M |
| 3300010398|Ga0126383_12662268 | Not Available | 583 | Open in IMG/M |
| 3300010866|Ga0126344_1177356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1454 | Open in IMG/M |
| 3300010867|Ga0126347_1142082 | Not Available | 1261 | Open in IMG/M |
| 3300010876|Ga0126361_10774828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1354 | Open in IMG/M |
| 3300010880|Ga0126350_10698187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2037 | Open in IMG/M |
| 3300011120|Ga0150983_15099679 | Not Available | 815 | Open in IMG/M |
| 3300016270|Ga0182036_10281689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1257 | Open in IMG/M |
| 3300017821|Ga0187812_1014408 | All Organisms → cellular organisms → Bacteria | 2737 | Open in IMG/M |
| 3300017821|Ga0187812_1065793 | Not Available | 1207 | Open in IMG/M |
| 3300017821|Ga0187812_1173910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 690 | Open in IMG/M |
| 3300017822|Ga0187802_10070649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1294 | Open in IMG/M |
| 3300017822|Ga0187802_10194226 | Not Available | 780 | Open in IMG/M |
| 3300017823|Ga0187818_10066688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1550 | Open in IMG/M |
| 3300017924|Ga0187820_1021794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1615 | Open in IMG/M |
| 3300017924|Ga0187820_1303854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 526 | Open in IMG/M |
| 3300017926|Ga0187807_1089406 | Not Available | 965 | Open in IMG/M |
| 3300017926|Ga0187807_1098281 | Not Available | 920 | Open in IMG/M |
| 3300017926|Ga0187807_1105355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 888 | Open in IMG/M |
| 3300017926|Ga0187807_1193509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 658 | Open in IMG/M |
| 3300017926|Ga0187807_1220877 | Not Available | 617 | Open in IMG/M |
| 3300017928|Ga0187806_1049358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1278 | Open in IMG/M |
| 3300017928|Ga0187806_1293445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 572 | Open in IMG/M |
| 3300017928|Ga0187806_1347956 | Not Available | 530 | Open in IMG/M |
| 3300017928|Ga0187806_1389588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 501 | Open in IMG/M |
| 3300017930|Ga0187825_10202578 | Not Available | 715 | Open in IMG/M |
| 3300017932|Ga0187814_10216065 | Not Available | 722 | Open in IMG/M |
| 3300017934|Ga0187803_10145807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 930 | Open in IMG/M |
| 3300017936|Ga0187821_10415046 | Not Available | 553 | Open in IMG/M |
| 3300017937|Ga0187809_10284856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 605 | Open in IMG/M |
| 3300017939|Ga0187775_10158969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 811 | Open in IMG/M |
| 3300017942|Ga0187808_10007698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 4136 | Open in IMG/M |
| 3300017942|Ga0187808_10243849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 803 | Open in IMG/M |
| 3300017943|Ga0187819_10057671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2305 | Open in IMG/M |
| 3300017955|Ga0187817_10428031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 844 | Open in IMG/M |
| 3300017959|Ga0187779_10169222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1356 | Open in IMG/M |
| 3300017961|Ga0187778_10198662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1277 | Open in IMG/M |
| 3300017961|Ga0187778_11277739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 516 | Open in IMG/M |
| 3300017970|Ga0187783_10019688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 4982 | Open in IMG/M |
| 3300017970|Ga0187783_10029127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 4092 | Open in IMG/M |
| 3300017970|Ga0187783_10084598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2337 | Open in IMG/M |
| 3300017970|Ga0187783_10202417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1458 | Open in IMG/M |
| 3300017970|Ga0187783_10221639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1386 | Open in IMG/M |
| 3300017970|Ga0187783_10549107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 837 | Open in IMG/M |
| 3300017970|Ga0187783_10990356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 606 | Open in IMG/M |
| 3300017972|Ga0187781_10100684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2007 | Open in IMG/M |
| 3300017972|Ga0187781_10286002 | Not Available | 1169 | Open in IMG/M |
| 3300017972|Ga0187781_10485187 | Not Available | 886 | Open in IMG/M |
| 3300017972|Ga0187781_10487104 | Not Available | 884 | Open in IMG/M |
| 3300017972|Ga0187781_10511408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 862 | Open in IMG/M |
| 3300017972|Ga0187781_11075984 | Not Available | 589 | Open in IMG/M |
| 3300017973|Ga0187780_10211676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1352 | Open in IMG/M |
| 3300017973|Ga0187780_10414715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea | 956 | Open in IMG/M |
| 3300017974|Ga0187777_10375942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 980 | Open in IMG/M |
| 3300017974|Ga0187777_10513976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 838 | Open in IMG/M |
| 3300017974|Ga0187777_10847181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 655 | Open in IMG/M |
| 3300017975|Ga0187782_10827783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 716 | Open in IMG/M |
| 3300017975|Ga0187782_11197578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 594 | Open in IMG/M |
| 3300018006|Ga0187804_10108577 | Not Available | 1145 | Open in IMG/M |
| 3300018046|Ga0187851_10877570 | Not Available | 504 | Open in IMG/M |
| 3300018058|Ga0187766_10014760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 4455 | Open in IMG/M |
| 3300018058|Ga0187766_10571612 | Not Available | 769 | Open in IMG/M |
| 3300018085|Ga0187772_11356780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 527 | Open in IMG/M |
| 3300018086|Ga0187769_10644982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 800 | Open in IMG/M |
| 3300018088|Ga0187771_11062396 | Not Available | 687 | Open in IMG/M |
| 3300018090|Ga0187770_10005026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7863 | Open in IMG/M |
| 3300018090|Ga0187770_10664736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 830 | Open in IMG/M |
| 3300020150|Ga0187768_1013410 | Not Available | 1706 | Open in IMG/M |
| 3300020581|Ga0210399_10573917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 934 | Open in IMG/M |
| 3300020582|Ga0210395_10006831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 8654 | Open in IMG/M |
| 3300020582|Ga0210395_10162248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1671 | Open in IMG/M |
| 3300020583|Ga0210401_10247129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1643 | Open in IMG/M |
| 3300021088|Ga0210404_10205797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1057 | Open in IMG/M |
| 3300021170|Ga0210400_10091569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2400 | Open in IMG/M |
| 3300021180|Ga0210396_10167285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1972 | Open in IMG/M |
| 3300021181|Ga0210388_10499313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1068 | Open in IMG/M |
| 3300021181|Ga0210388_10746288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 851 | Open in IMG/M |
| 3300021401|Ga0210393_10285408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1340 | Open in IMG/M |
| 3300021401|Ga0210393_10500680 | Not Available | 992 | Open in IMG/M |
| 3300021402|Ga0210385_10333006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1130 | Open in IMG/M |
| 3300021402|Ga0210385_11518826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 511 | Open in IMG/M |
| 3300021405|Ga0210387_10230161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1616 | Open in IMG/M |
| 3300021407|Ga0210383_10146732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2003 | Open in IMG/M |
| 3300021407|Ga0210383_11717961 | Not Available | 513 | Open in IMG/M |
| 3300021420|Ga0210394_11207786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 649 | Open in IMG/M |
| 3300021444|Ga0213878_10080182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1308 | Open in IMG/M |
| 3300021476|Ga0187846_10122689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1109 | Open in IMG/M |
| 3300021476|Ga0187846_10271708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 703 | Open in IMG/M |
| 3300021477|Ga0210398_10155070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1863 | Open in IMG/M |
| 3300021477|Ga0210398_10520044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 968 | Open in IMG/M |
| 3300021559|Ga0210409_10236211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1657 | Open in IMG/M |
| 3300021559|Ga0210409_10813868 | Not Available | 807 | Open in IMG/M |
| 3300021560|Ga0126371_11125347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 924 | Open in IMG/M |
| 3300021560|Ga0126371_12909421 | Not Available | 580 | Open in IMG/M |
| 3300022532|Ga0242655_10072075 | Not Available | 898 | Open in IMG/M |
| 3300022557|Ga0212123_10035727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 4941 | Open in IMG/M |
| 3300022557|Ga0212123_10082468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2707 | Open in IMG/M |
| 3300022711|Ga0242674_1029018 | Not Available | 686 | Open in IMG/M |
| 3300022716|Ga0242673_1037976 | Not Available | 768 | Open in IMG/M |
| 3300022722|Ga0242657_1077376 | Not Available | 784 | Open in IMG/M |
| 3300023030|Ga0224561_1026648 | Not Available | 518 | Open in IMG/M |
| 3300025134|Ga0207416_1058220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1568 | Open in IMG/M |
| 3300025898|Ga0207692_10788850 | Not Available | 621 | Open in IMG/M |
| 3300025910|Ga0207684_10095405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2538 | Open in IMG/M |
| 3300026508|Ga0257161_1087180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 646 | Open in IMG/M |
| 3300026551|Ga0209648_10017249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 6298 | Open in IMG/M |
| 3300026998|Ga0208369_1001403 | Not Available | 1808 | Open in IMG/M |
| 3300027029|Ga0208731_1007709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1073 | Open in IMG/M |
| 3300027047|Ga0208730_1000413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 2998 | Open in IMG/M |
| 3300027307|Ga0209327_1036347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 694 | Open in IMG/M |
| 3300027497|Ga0208199_1001426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 8259 | Open in IMG/M |
| 3300027545|Ga0209008_1056657 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300027545|Ga0209008_1155978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 500 | Open in IMG/M |
| 3300027570|Ga0208043_1063507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1052 | Open in IMG/M |
| 3300027575|Ga0209525_1013168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1996 | Open in IMG/M |
| 3300027648|Ga0209420_1002067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 9174 | Open in IMG/M |
| 3300027703|Ga0207862_1184792 | Not Available | 621 | Open in IMG/M |
| 3300027767|Ga0209655_10310706 | Not Available | 507 | Open in IMG/M |
| 3300027783|Ga0209448_10011207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2876 | Open in IMG/M |
| 3300027824|Ga0209040_10496637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 543 | Open in IMG/M |
| 3300027826|Ga0209060_10255331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 803 | Open in IMG/M |
| 3300027842|Ga0209580_10173224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1066 | Open in IMG/M |
| 3300027853|Ga0209274_10010740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 4115 | Open in IMG/M |
| 3300027855|Ga0209693_10081682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1596 | Open in IMG/M |
| 3300027879|Ga0209169_10081035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1677 | Open in IMG/M |
| 3300027884|Ga0209275_10771472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 554 | Open in IMG/M |
| 3300027889|Ga0209380_10113100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1575 | Open in IMG/M |
| 3300027895|Ga0209624_10093809 | Not Available | 1955 | Open in IMG/M |
| 3300028906|Ga0308309_10801778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 818 | Open in IMG/M |
| 3300028906|Ga0308309_10811537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 813 | Open in IMG/M |
| 3300029943|Ga0311340_10540312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1032 | Open in IMG/M |
| 3300029943|Ga0311340_11225231 | Not Available | 602 | Open in IMG/M |
| 3300030490|Ga0302184_10342078 | Not Available | 592 | Open in IMG/M |
| 3300030494|Ga0310037_10067735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata | 1682 | Open in IMG/M |
| 3300030580|Ga0311355_10936682 | Not Available | 783 | Open in IMG/M |
| 3300030586|Ga0265393_1038371 | Not Available | 839 | Open in IMG/M |
| 3300030624|Ga0210251_11257237 | Not Available | 540 | Open in IMG/M |
| 3300030631|Ga0210279_10252076 | Not Available | 656 | Open in IMG/M |
| 3300030740|Ga0265460_11343505 | Not Available | 699 | Open in IMG/M |
| 3300030760|Ga0265762_1157552 | Not Available | 545 | Open in IMG/M |
| 3300030940|Ga0265740_1034702 | Not Available | 574 | Open in IMG/M |
| 3300031122|Ga0170822_10994713 | Not Available | 501 | Open in IMG/M |
| 3300031128|Ga0170823_11531891 | Not Available | 816 | Open in IMG/M |
| 3300031234|Ga0302325_10610153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1604 | Open in IMG/M |
| 3300031234|Ga0302325_12112018 | Not Available | 689 | Open in IMG/M |
| 3300031543|Ga0318516_10018531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3515 | Open in IMG/M |
| 3300031543|Ga0318516_10272191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 979 | Open in IMG/M |
| 3300031543|Ga0318516_10452580 | Not Available | 738 | Open in IMG/M |
| 3300031544|Ga0318534_10039967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 2599 | Open in IMG/M |
| 3300031544|Ga0318534_10222785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1088 | Open in IMG/M |
| 3300031561|Ga0318528_10166554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1176 | Open in IMG/M |
| 3300031564|Ga0318573_10356297 | Not Available | 785 | Open in IMG/M |
| 3300031572|Ga0318515_10111746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1439 | Open in IMG/M |
| 3300031573|Ga0310915_10394302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 983 | Open in IMG/M |
| 3300031640|Ga0318555_10105470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1488 | Open in IMG/M |
| 3300031668|Ga0318542_10196362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1017 | Open in IMG/M |
| 3300031679|Ga0318561_10224384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1022 | Open in IMG/M |
| 3300031680|Ga0318574_10029471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 2761 | Open in IMG/M |
| 3300031682|Ga0318560_10430178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 715 | Open in IMG/M |
| 3300031708|Ga0310686_102245234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5398 | Open in IMG/M |
| 3300031708|Ga0310686_108505143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1087 | Open in IMG/M |
| 3300031708|Ga0310686_115039713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 853 | Open in IMG/M |
| 3300031715|Ga0307476_10376206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1047 | Open in IMG/M |
| 3300031715|Ga0307476_11007959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 613 | Open in IMG/M |
| 3300031719|Ga0306917_11035947 | Not Available | 640 | Open in IMG/M |
| 3300031744|Ga0306918_10296736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1244 | Open in IMG/M |
| 3300031747|Ga0318502_10464319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 756 | Open in IMG/M |
| 3300031765|Ga0318554_10664736 | Not Available | 585 | Open in IMG/M |
| 3300031769|Ga0318526_10201235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 814 | Open in IMG/M |
| 3300031778|Ga0318498_10018857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2901 | Open in IMG/M |
| 3300031781|Ga0318547_10074676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1886 | Open in IMG/M |
| 3300031799|Ga0318565_10249907 | Not Available | 862 | Open in IMG/M |
| 3300031835|Ga0318517_10440400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 588 | Open in IMG/M |
| 3300031860|Ga0318495_10340777 | Not Available | 664 | Open in IMG/M |
| 3300031860|Ga0318495_10343334 | Not Available | 661 | Open in IMG/M |
| 3300031879|Ga0306919_10438083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1005 | Open in IMG/M |
| 3300031910|Ga0306923_10555455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1293 | Open in IMG/M |
| 3300031910|Ga0306923_10613802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1219 | Open in IMG/M |
| 3300031910|Ga0306923_11240855 | Not Available | 794 | Open in IMG/M |
| 3300031941|Ga0310912_10090424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2238 | Open in IMG/M |
| 3300031942|Ga0310916_11750244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → unclassified Nocardioidaceae → Nocardioidaceae bacterium | 502 | Open in IMG/M |
| 3300031945|Ga0310913_10503608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 860 | Open in IMG/M |
| 3300031954|Ga0306926_10800713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1136 | Open in IMG/M |
| 3300031962|Ga0307479_11319670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 682 | Open in IMG/M |
| 3300032001|Ga0306922_10772894 | Not Available | 1006 | Open in IMG/M |
| 3300032009|Ga0318563_10350446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 799 | Open in IMG/M |
| 3300032010|Ga0318569_10068586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1565 | Open in IMG/M |
| 3300032010|Ga0318569_10381014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 657 | Open in IMG/M |
| 3300032025|Ga0318507_10287784 | Not Available | 714 | Open in IMG/M |
| 3300032042|Ga0318545_10119388 | Not Available | 930 | Open in IMG/M |
| 3300032052|Ga0318506_10266581 | Not Available | 759 | Open in IMG/M |
| 3300032067|Ga0318524_10670763 | Not Available | 546 | Open in IMG/M |
| 3300032089|Ga0318525_10273339 | Not Available | 868 | Open in IMG/M |
| 3300032160|Ga0311301_10026794 | All Organisms → cellular organisms → Bacteria | 15425 | Open in IMG/M |
| 3300032160|Ga0311301_10266475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2797 | Open in IMG/M |
| 3300032160|Ga0311301_10348706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2318 | Open in IMG/M |
| 3300032160|Ga0311301_10769475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1332 | Open in IMG/M |
| 3300032180|Ga0307471_102551259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 647 | Open in IMG/M |
| 3300032261|Ga0306920_100978778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1233 | Open in IMG/M |
| 3300032756|Ga0315742_12448543 | Not Available | 594 | Open in IMG/M |
| 3300032783|Ga0335079_11338461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 714 | Open in IMG/M |
| 3300032805|Ga0335078_10016871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 10847 | Open in IMG/M |
| 3300032892|Ga0335081_11035817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 952 | Open in IMG/M |
| 3300032895|Ga0335074_10000116 | All Organisms → cellular organisms → Bacteria | 135634 | Open in IMG/M |
| 3300032895|Ga0335074_10017212 | Not Available | 10186 | Open in IMG/M |
| 3300032895|Ga0335074_10018440 | Not Available | 9846 | Open in IMG/M |
| 3300032895|Ga0335074_10111058 | Not Available | 3581 | Open in IMG/M |
| 3300032895|Ga0335074_10150401 | Not Available | 2946 | Open in IMG/M |
| 3300032895|Ga0335074_10165938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2762 | Open in IMG/M |
| 3300032895|Ga0335074_10316243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1769 | Open in IMG/M |
| 3300032895|Ga0335074_10328256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1722 | Open in IMG/M |
| 3300032895|Ga0335074_10770452 | Not Available | 906 | Open in IMG/M |
| 3300032895|Ga0335074_11381964 | Not Available | 572 | Open in IMG/M |
| 3300032896|Ga0335075_10184371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2529 | Open in IMG/M |
| 3300032896|Ga0335075_10629831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1052 | Open in IMG/M |
| 3300032896|Ga0335075_10661060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1016 | Open in IMG/M |
| 3300032955|Ga0335076_10888383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 773 | Open in IMG/M |
| 3300033134|Ga0335073_10339608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1784 | Open in IMG/M |
| 3300033290|Ga0318519_10105359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1524 | Open in IMG/M |
| 3300033808|Ga0314867_158358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 532 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.55% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 11.59% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 9.78% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.33% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.26% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.90% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.17% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.17% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.45% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.45% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.09% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.09% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.09% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.72% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.72% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.36% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.36% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.36% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.36% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.36% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023030 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU2 | Environmental | Open in IMG/M |
| 3300025134 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026998 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF046 (SPAdes) | Environmental | Open in IMG/M |
| 3300027029 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF045 (SPAdes) | Environmental | Open in IMG/M |
| 3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
| 3300027307 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030586 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE041SO (Eukaryote Community Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300030624 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR005SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030631 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO086SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030940 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_100874972 | 3300001356 | Peatlands Soil | MHGMMSAAILICTFGAIAAACLYVAARVYLAGGRSGDAS* |
| JGI12269J14319_101985421 | 3300001356 | Peatlands Soil | MHGMLSAAILICVFAAVAVVCAYVAGRVYLAGSRRGDSS* |
| JGIcombinedJ26739_1011904972 | 3300002245 | Forest Soil | MLSAAILICVFAAVTVACVIVAARVYLGAGRGESRRGDSS* |
| JGIcombinedJ51221_100757333 | 3300003505 | Forest Soil | MHGMLSAAILIFVFGAVAVACAYAAGRVFLAGSRRGDSS* |
| JGIcombinedJ51221_103104282 | 3300003505 | Forest Soil | MHGMLSATILICVFAAVALAGLYVAGRVLLAGRRRGDAS* |
| Ga0062384_1007985451 | 3300004082 | Bog Forest Soil | MHGMLSAAILICVFGAVAVACAYVAGRIYLAAGNRRSHRGDSS* |
| Ga0062389_1017144261 | 3300004092 | Bog Forest Soil | MHGMLSAAILIVTLAAVAAASLYLAGRVYLAGARGNRGNGAS* |
| Ga0062386_1000143146 | 3300004152 | Bog Forest Soil | MYGMLSAAILICVFAAVTVACAYLAGRVYLAAAGKRQSPQSRRSRRGDSS* |
| Ga0070714_1004539902 | 3300005435 | Agricultural Soil | MHGMLSAAILICVFAAVAVACLIVAGRVYLAAGRRQGRRGDSS* |
| Ga0070706_1001264354 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MHGMLSAAILICVFAAVTAACLYVAGRVYLAGSRRGDSS* |
| Ga0070734_100124387 | 3300005533 | Surface Soil | MHGMLSAAILICVFAAVAVACLIAAGRVYLAAGRRQGRRGDSS* |
| Ga0070730_101411022 | 3300005537 | Surface Soil | MHGMLSAAILICVFAAVAIACLIVAGRVYLAAGRRQGRRGDSS* |
| Ga0070731_107088052 | 3300005538 | Surface Soil | MHGMLSATILICVFAAVAIACLIVAGRVYLADERRQSRRGDPS* |
| Ga0070731_111500052 | 3300005538 | Surface Soil | VPEARAGPHARTLRPMHGMMSAAILICTFGAVAAACLYAAARAYLSGGRDGNAS* |
| Ga0070733_109708872 | 3300005541 | Surface Soil | MHGMMSAAILICTFGVIAAACLYVAARAYLAGGRGGDAS* |
| Ga0070732_100961602 | 3300005542 | Surface Soil | MHGMLSAAILIGAFAAIAGACLYVVGRVHLAGRRRGDAS* |
| Ga0070761_102044622 | 3300005591 | Soil | MLSATILICVFAAVGVAGLYVAGRVLLAGRRRGDAS* |
| Ga0070761_102760932 | 3300005591 | Soil | MHGMLSAAILIVTLAAIAAASLYLAGRVYLAGARGNRGNGAS* |
| Ga0070761_103897972 | 3300005591 | Soil | MHGMMSAAILMCTFGAVAAACLYVAARAYLAGGRGGDAS* |
| Ga0070761_111097431 | 3300005591 | Soil | MHGMMSAAILICTFGAVAAACLYVAARAYLAGGLVETHPDL |
| Ga0070762_101478003 | 3300005602 | Soil | MHGMLSAAILIGAFAAIAGACLYVVRRVHLAGRRRGDAS* |
| Ga0070763_103413742 | 3300005610 | Soil | MHGMLSAAILIFVFAAVAAACLYVAGRVYLAGSRRGDSS* |
| Ga0070763_106752562 | 3300005610 | Soil | MHGMLSAAILICLFAAVTAACLYVAGRVYLAGSRRGDSS* |
| Ga0070764_103853412 | 3300005712 | Soil | MHGMLSAAILICLFAAVTAACLYVAVRVYLAGSRRGDSS* |
| Ga0070764_108522972 | 3300005712 | Soil | MHGMLSAAILICVFAAVAVACVWVAGRVYLAGSRRGDSS |
| Ga0066903_1021706082 | 3300005764 | Tropical Forest Soil | MYGMLSAAILICVFAAVAVACAYLAGRVYLASAAGRTQSPQSRRSRRGDSS* |
| Ga0066903_1087363352 | 3300005764 | Tropical Forest Soil | MHGMLSAAILICVFAAVTVACAYVAGRVYLAAAGRPQSRQSRRGDSS* |
| Ga0070766_108046582 | 3300005921 | Soil | MHGMLSAAILICVFAAVTVACLYVAGRVYLAGSRRGDSS* |
| Ga0075017_1011981601 | 3300006059 | Watersheds | MYGTLSAAILICVFAAVTVACAYLAGRVYLAAAAGKRQSPQRRWSRRGDSS |
| Ga0075015_1005586142 | 3300006102 | Watersheds | MYGTLSAAILICVFAAVAFACAYLAGRVYLAAAAGRPQRPQRRWSRRGDSS* |
| Ga0070765_1002336802 | 3300006176 | Soil | MHGMLSAAILICVFAAVTAACLYVAGRVYLAGSRHGDSS* |
| Ga0070765_1009520202 | 3300006176 | Soil | MYGTLSAAILICVFAAVTVACAYLAGRVYLAAAGKRQSPHSRRSRRGDSS* |
| Ga0073928_102970692 | 3300006893 | Iron-Sulfur Acid Spring | MLSATILICVFAAVALACVYVAGRVLLAGRRRGDAS* |
| Ga0102924_10154286 | 3300007982 | Iron-Sulfur Acid Spring | MHGMLSAAILICVFAAVTVTCVIVVGRVYLAGSRRGDSS* |
| Ga0116214_10065332 | 3300009520 | Peatlands Soil | MHGMLSAAILICVFAAVAVVCAYVAGRVYLAAGRRQRRRGDSS* |
| Ga0116222_10748092 | 3300009521 | Peatlands Soil | MHGMLSAAILICTFGAVAAGFLYVAARAYLAGGRGGDAS* |
| Ga0116225_12280334 | 3300009524 | Peatlands Soil | MHGMLSAAILICVFAAVAVACLYVAGRVYLAGSRRGDSS* |
| Ga0116220_103556502 | 3300009525 | Peatlands Soil | MHGMLSATILICVFTAVALVCLYVAGRVLMAGGRRGDAS* |
| Ga0116220_105478371 | 3300009525 | Peatlands Soil | RARTLRPMHGMLSAAILICTFGAVAAGFLYVAARAYLAGGRDGNAS* |
| Ga0116216_100780442 | 3300009698 | Peatlands Soil | MYGTLSAAILICVFAAVTIACAYLAGRVYLAAAAGKRQSPHSRRSRRGDSS* |
| Ga0116216_102184001 | 3300009698 | Peatlands Soil | MLSAAILICGFGAIAAVCGYVAGRVYLTGGRRGDPS* |
| Ga0116217_101258151 | 3300009700 | Peatlands Soil | LPPMHGMMSAAILICTFGAVAAACLCVAARAYLAGGRDGNAS* |
| Ga0116217_109933351 | 3300009700 | Peatlands Soil | MHGMLSAAILISVFALIAAACLYVAARVYAAGGRRGDAS* |
| Ga0126373_115695721 | 3300010048 | Tropical Forest Soil | PPFTLPPMHGMLSAAVLIGAFAAVVGACLYVVRRVHLAGKRRGDAS* |
| Ga0126373_117065231 | 3300010048 | Tropical Forest Soil | MHGMLSAAVLIGVFAAVAAACAYVAGRVYLAAAGRPHSRQNRRGD |
| Ga0126373_126302711 | 3300010048 | Tropical Forest Soil | MQGMLSAAILICVFVAVAVACAYLAGRVYLAAAAAGKPQRPQSRRGDSP* |
| Ga0074046_107144661 | 3300010339 | Bog Forest Soil | MHGMLSAAILISVFALIAAACLYVAVRVYAAGGRR |
| Ga0074045_104384362 | 3300010341 | Bog Forest Soil | MHGMLSAAILISVFALIAAACLYVAVRVYAAGGRRGDAS* |
| Ga0074044_111639992 | 3300010343 | Bog Forest Soil | MHGMLSAAILIGVLAVIAVACLYVAMRVYAAGGRRGDAF* |
| Ga0126370_123268592 | 3300010358 | Tropical Forest Soil | MLSAAILICVFAAVTVACAYVAGRVYLAAGKRQSRRGDSS* |
| Ga0126372_121534791 | 3300010360 | Tropical Forest Soil | MHGMLSAAILIGVFAAVTVACAYVAGRVYLAAAGRPQSRQSRRGDSS* |
| Ga0126378_109673042 | 3300010361 | Tropical Forest Soil | MHGMLSAAILICVFAAVTVACAYVAGRVYLAAGAGRTQSPQSGQSRRDDSS* |
| Ga0136449_1000648154 | 3300010379 | Peatlands Soil | MLSAAILICAFGAIAAACAYVAGRVYLTGGRRGDPS* |
| Ga0136449_1001911923 | 3300010379 | Peatlands Soil | MYGTLSAAILICVFAAVAVACAYLAGRVYLAAAGKRQSPHPRRSRRGDSS* |
| Ga0136449_1011832124 | 3300010379 | Peatlands Soil | MLSAAILICVFASVAVACAYVAGRVYLAGGRRQNRRGDSS* |
| Ga0136449_1015274052 | 3300010379 | Peatlands Soil | MHGMLSVTILICVFTAVALACLYVAGRVLLAGRRRGDAS* |
| Ga0136449_1015298432 | 3300010379 | Peatlands Soil | MHGMLSAAILIGVFAVMAAACLYVAVRVYAAGGRRGDTS* |
| Ga0126383_126622681 | 3300010398 | Tropical Forest Soil | MHGMLSAAILICVFGVAAAACLYVALRVWTAGGHHGDAS* |
| Ga0126344_11773562 | 3300010866 | Boreal Forest Soil | MHGMLSAAILICVFAAVTVACVIVAGRVYLAGSRRGDSS* |
| Ga0126347_11420822 | 3300010867 | Boreal Forest Soil | MLSAAILICVFAAVTVACVIVAGRVYLAGSRRGDSS* |
| Ga0126361_107748282 | 3300010876 | Boreal Forest Soil | MHGMLSATILICVFAAVVLACLYVAGRVLLAGRRRGDAS* |
| Ga0126350_106981873 | 3300010880 | Boreal Forest Soil | MHGMLSATILICVFTAVALACLYVAGRVLLAGRRRGDAS* |
| Ga0150983_150996792 | 3300011120 | Forest Soil | LSAAIRICTFGAVAAGFLYVAARAYLAGGRGGDAS* |
| Ga0182036_102816892 | 3300016270 | Soil | MYGMLSAAILICVFAAVTVACAYVAGRVYLAGSRRDDSS |
| Ga0187812_10144083 | 3300017821 | Freshwater Sediment | MLSAAILICVFAAVAVVCAYVAVRVYLAGSRRGDSS |
| Ga0187812_10657932 | 3300017821 | Freshwater Sediment | MHGMLSAAILMCVFGAVTVACAYVAGRVYLAAAGRPQSRQSRRGDSS |
| Ga0187812_11739102 | 3300017821 | Freshwater Sediment | MHGMLSAAILICVFAAVAVACAYVAGRVYLAGSRRGDSS |
| Ga0187802_100706492 | 3300017822 | Freshwater Sediment | MHGMMSAAILICTFGAVAAACLYTAARAYLSGGRDGQAS |
| Ga0187802_101942261 | 3300017822 | Freshwater Sediment | MHGMLSAAILICVFAAVAVVCAYVAVRVYLAGSRRGDSS |
| Ga0187818_100666882 | 3300017823 | Freshwater Sediment | MHGMLSAAILICLFAAVAVACAYVAGRVYLAGSRRGDSS |
| Ga0187820_10217942 | 3300017924 | Freshwater Sediment | MYGMLSAAILICVFAGVAVACAYLAGRVYLAAAAGKRQSLQSRRSRRGDSS |
| Ga0187820_13038542 | 3300017924 | Freshwater Sediment | MYGMLSAAILMCVFGAVTVACAYVAGRVYLAAAGRPQSRQSRRGDSS |
| Ga0187807_10894062 | 3300017926 | Freshwater Sediment | MHGMLSAAILMGVFAAVAAACLYLVGRVHLAGKRRGDAS |
| Ga0187807_10982811 | 3300017926 | Freshwater Sediment | MHGMLSATILICVFAAVAAACLYLAGRVYLAGKRRGDAS |
| Ga0187807_11053552 | 3300017926 | Freshwater Sediment | MYGMLSAAILICVFAAVTVACAYLAGRVYLAAAAGKRQSPQIRRSRRGDSS |
| Ga0187807_11935093 | 3300017926 | Freshwater Sediment | MHGMLSATILICAFAAVAVACLYLAGRVYLAGKRRG |
| Ga0187807_12208772 | 3300017926 | Freshwater Sediment | GLACRAGPYTCGMHGMLSAAILICVFAAVTVACAYLAGRVYLVAAAGKRQSPQSRRSRRGDSS |
| Ga0187806_10493582 | 3300017928 | Freshwater Sediment | MHGMLSSAILISVFAAVAVACACVAGRIYLAAGRRQSRSGDSS |
| Ga0187806_12934452 | 3300017928 | Freshwater Sediment | MYGMLSAAILICVFAAVTVACAYLAGRVYLAAAAAGKRQSRRSRRGDSS |
| Ga0187806_13479562 | 3300017928 | Freshwater Sediment | MHGMLSAAILISVFAAVAVACAFVAGRIYLTAERRQSRRGDSS |
| Ga0187806_13895882 | 3300017928 | Freshwater Sediment | MHGMLSAAILIGVFAVMAVACLYVAIRVYAAGGRRGDTS |
| Ga0187825_102025782 | 3300017930 | Freshwater Sediment | HARTLRPMHGMMSAAILICTFGAVAAACLYTAARAYLSGGRDGNAS |
| Ga0187814_102160652 | 3300017932 | Freshwater Sediment | MHGMVSATILICVFGGVAVACMYVAGRVYLAGKRRRDAS |
| Ga0187803_101458072 | 3300017934 | Freshwater Sediment | MHGMLSAAILICVFGAVAVACAFVAVRVYLTGSRRGDSS |
| Ga0187821_104150461 | 3300017936 | Freshwater Sediment | MLSAAILICVFAAVTVACAYLAGRVYLAAAAAGKRQSRRSRRGDSS |
| Ga0187809_102848562 | 3300017937 | Freshwater Sediment | MLSAAILISVFAAVAVACAFVAGRIYLTAERRQSRRGDSS |
| Ga0187775_101589692 | 3300017939 | Tropical Peatland | MSGMLSAAILIGVFAAVTVACAYVAWRVYLAAAGRPQSRQGRRGDSS |
| Ga0187808_100076984 | 3300017942 | Freshwater Sediment | MLSAAILMCVFGAVTVACAYVAGRVYLAAAGRPQSRQSRRGDSS |
| Ga0187808_102438492 | 3300017942 | Freshwater Sediment | MYGMLSAAILICVFAAVTVACAYLAGRVYLAAAAGKRQSRQSRRSRRGDSS |
| Ga0187819_100576712 | 3300017943 | Freshwater Sediment | MHGMLSSAILISVFAAVAVACACVAGRVYLAAARRQSRRGDSS |
| Ga0187817_104280312 | 3300017955 | Freshwater Sediment | MHGMLSAAILICVFGAVAVACAFVAGRVYLTGSRRGDSS |
| Ga0187779_101692222 | 3300017959 | Tropical Peatland | MHGMLSAAILIGVFAAVAVACLYVAVRVFMAGGRRGGAS |
| Ga0187778_101986622 | 3300017961 | Tropical Peatland | MHGMLSAAILICVFAAIAVACAYVAGRIYLAAGRRQGRRGDSS |
| Ga0187778_112777392 | 3300017961 | Tropical Peatland | MHGMLSAAILICVFAAVAVACLYVAVRVFMAGGRRGGAS |
| Ga0187783_100196885 | 3300017970 | Tropical Peatland | MHGMLSAAILIGVFAIVAAACLYVAGRVYLAGSRGGNPS |
| Ga0187783_100291273 | 3300017970 | Tropical Peatland | MHGMMSAAILICTFGAIAAACLYVAARAYLAGGRGGDAS |
| Ga0187783_100845984 | 3300017970 | Tropical Peatland | MHGMLSATILICVFAAVAAACLYLVGRVYLAGKRRGDAS |
| Ga0187783_102024172 | 3300017970 | Tropical Peatland | MHGMVSAAILIFAFGAVAVACLFVAARAYLAGGRGGDAS |
| Ga0187783_102216393 | 3300017970 | Tropical Peatland | MVSAAILLCVFGAIAAVGLFVAARVYLAGGRGGDAP |
| Ga0187783_105491072 | 3300017970 | Tropical Peatland | MHGMLSTAILMGAFAVVAAGCLYMAVRVYLAGGRRDGAS |
| Ga0187783_109903562 | 3300017970 | Tropical Peatland | MHGMLSAAILICLFAAVAVVCIYAAGRIYLAGSRRGDSS |
| Ga0187781_101006843 | 3300017972 | Tropical Peatland | MHGMMSAAILIGAFGAIAAACLYVAARAYLAGGRGGDAS |
| Ga0187781_102860022 | 3300017972 | Tropical Peatland | MHGMLSAAILICAFGAIAVACLFVAARAFLAGGRGGNAS |
| Ga0187781_104851871 | 3300017972 | Tropical Peatland | ARTLRPMHGMLSATILICVFAAVAAACLYLVGRVYLAGKRRGDAS |
| Ga0187781_104871041 | 3300017972 | Tropical Peatland | RTLRPMHGMLSATILICVFAAIAAACLYLAGRVYLAGKRRGDAS |
| Ga0187781_105114082 | 3300017972 | Tropical Peatland | MHGMLSAAILICLFAAVAVVCICAAGRIYLAGSPRGDSS |
| Ga0187781_110759841 | 3300017972 | Tropical Peatland | MHGMLSAAILICVFAAVAAACGYVAGRVYLAAGRRQGRRGDSS |
| Ga0187780_102116762 | 3300017973 | Tropical Peatland | MHGMLSAMILICVFGAVAAACLYVAVWVYLAGKRRADAS |
| Ga0187780_104147152 | 3300017973 | Tropical Peatland | MHGMLSATILICVFAAVAAACLYLAGRVYLAGKRRRDAS |
| Ga0187777_103759422 | 3300017974 | Tropical Peatland | MHGMLSAAILICVFAAVAVACLYAAGRVYLTGRRR |
| Ga0187777_105139762 | 3300017974 | Tropical Peatland | MHGMLSATILICAFGAVAAACLYLAARVYLAGKRRGDAS |
| Ga0187777_108471812 | 3300017974 | Tropical Peatland | MKGMVSTTILICVFGAVAAACLYVAVWVYLAGKRRADAS |
| Ga0187782_108277832 | 3300017975 | Tropical Peatland | MHGMLSAAILIGVFAVTAVACLYVAVRVYLAGGRHDGAS |
| Ga0187782_111975782 | 3300017975 | Tropical Peatland | MHGMLSATILICVFAAIAAACLYLAGRVYLAGKRRGDAS |
| Ga0187804_101085772 | 3300018006 | Freshwater Sediment | MHGMLSAAILICVFGAVAVACVFVAGRVYLTGSRRGDSS |
| Ga0187851_108775701 | 3300018046 | Peatland | MLSAAILICGFGAIAAACAYVAGRVYLTGGRRGDPS |
| Ga0187766_100147602 | 3300018058 | Tropical Peatland | MHGMVSATILICVFGAVAAACMYVAGRVYLAGKRRRDAS |
| Ga0187766_105716121 | 3300018058 | Tropical Peatland | MHGMLSAAILICVFAAVAAACLYLAGRVYLAGRRR |
| Ga0187772_113567801 | 3300018085 | Tropical Peatland | MHGMLSATILICVLAAIAAACLYLAGRVYLAGKRRGDAS |
| Ga0187769_106449822 | 3300018086 | Tropical Peatland | MHGMMSAAILICAFGAIAAACLFVAARAWMAGGRGGDAS |
| Ga0187771_110623961 | 3300018088 | Tropical Peatland | LRVMHGMLSATILICVFAAVAVACLYLVGWVYLAGRRRGHAS |
| Ga0187770_100050262 | 3300018090 | Tropical Peatland | MLSATILICVLAAIAAACLYLAGRVYLAGKRRGDAS |
| Ga0187770_106647362 | 3300018090 | Tropical Peatland | MHGMLSAAILICVFAAVAVACAYVAGRVYLAAGRGQGRRGDPS |
| Ga0187768_10134102 | 3300020150 | Tropical Peatland | MHGMVSATILICVFGGVAAACMYVAGRVYLAGKRRRDAS |
| Ga0210399_105739172 | 3300020581 | Soil | MYGTLSAAILICVFAAVTVACAYLAARVHLAAAGKRQSPHSRRSRRGDSS |
| Ga0210395_1000683111 | 3300020582 | Soil | MHGMLSATILICVFAAVALAGLYVAGRVLLAGRRRGDAS |
| Ga0210395_101622483 | 3300020582 | Soil | MHGMLSAAILICVFGVAAAACLYVALRVWTAGGHHGDAS |
| Ga0210401_102471293 | 3300020583 | Soil | MHGMLSAAILICVFAAVAAACLYVAGRVYLAGSRRGDSS |
| Ga0210404_102057972 | 3300021088 | Soil | MHGMLSAAILICVFVAVTAACLYVAGRVYLAGSRRGDSS |
| Ga0210400_100915692 | 3300021170 | Soil | MHGMLSAAILICVFAVVAAACLYVAGRVYLAGSRRGDSS |
| Ga0210396_101672854 | 3300021180 | Soil | MLSAVILICGFGAIAAACAYVAGRVYLTGGRRGDPS |
| Ga0210388_104993132 | 3300021181 | Soil | MHGMLSATILICVFAAVALAGLYVAGRVLLAGRRRGDTS |
| Ga0210388_107462882 | 3300021181 | Soil | MHGMLSAAILIVTLAAIAAASLYLAGRVYLAGARGNRGNGAS |
| Ga0210393_102854083 | 3300021401 | Soil | MLSATILICVFAAVALAGLYVAGRVLLAGRRRGDAS |
| Ga0210393_105006803 | 3300021401 | Soil | MHGMLSAAILICVFVAVTAACLYVAGRVYLAGSHRGDSS |
| Ga0210385_103330062 | 3300021402 | Soil | MHGMLSAAILIFVFGAVAVACAYAAGRVFLAGSRRGDSS |
| Ga0210385_115188261 | 3300021402 | Soil | MHGMLSATILICVFAAVALAGLYVTGRVLLAGRRRGDTS |
| Ga0210387_102301611 | 3300021405 | Soil | MHGMLSATILICVFAAVTAACLYVAGRVYLAGSRHGDSS |
| Ga0210383_101467324 | 3300021407 | Soil | MHGMLSAAILIFVFAAVAAACLYVAGRVYLAGSRRGDSS |
| Ga0210383_117179611 | 3300021407 | Soil | MHGMLSAAILICVFAAVTAACLYVAGRVYLGAGRRQGRRGDSS |
| Ga0210394_112077862 | 3300021420 | Soil | MHGMLSATILICVFAAVALSGLYVAGRVLLAGRRRGDAS |
| Ga0213878_100801822 | 3300021444 | Bulk Soil | MHGMLSAAILIGVFAVVAVAFAYVAGRVYLAGNRHGDSS |
| Ga0187846_101226892 | 3300021476 | Biofilm | MHGMASAAILIGAFGAVAAACLYVAARVFLAGGRGGDAP |
| Ga0187846_102717082 | 3300021476 | Biofilm | MHGMMSATILICAFAAVAAACIYLVGRVYLAGKRRRDAS |
| Ga0210398_101550702 | 3300021477 | Soil | MHGMLSAAILICLFAAVTAACLYVAGRVYLAGSRRGDSS |
| Ga0210398_105200443 | 3300021477 | Soil | MLSATILICVFAAVALSGLYVAGRVLLAGRRRGDAS |
| Ga0210409_102362113 | 3300021559 | Soil | MHGMLSAAILICVFLAVTAAALYVAGRVYLAAGRRQGRRGDSS |
| Ga0210409_108138681 | 3300021559 | Soil | ILICVFAAVTVACAYLAGRVYLAAAGKRQSPHSRRSRRGDSS |
| Ga0126371_111253472 | 3300021560 | Tropical Forest Soil | MHGMLSAAVLIGVFAAVAAACAYVAGRVYLAAAGRPHSRQNRRGDSS |
| Ga0126371_129094212 | 3300021560 | Tropical Forest Soil | MHGMLSAAILICVFGVAAAACLYVALRVWTAGGHHGDPS |
| Ga0242655_100720751 | 3300022532 | Soil | LSAAILICVFVAVTAACLYVAGRVYLAGSHRGDSS |
| Ga0212123_100357275 | 3300022557 | Iron-Sulfur Acid Spring | MLSATILICVFAAVALACLYVAGRVLLAGRRRGDAS |
| Ga0212123_100824683 | 3300022557 | Iron-Sulfur Acid Spring | MHGMLSAAILICVFAAVTVACVIVAGRVYLAGSRRGDSS |
| Ga0242674_10290182 | 3300022711 | Soil | LSATILICVFAAVALSGLYVAGRVLLAGRRRGDAS |
| Ga0242673_10379762 | 3300022716 | Soil | AILIVTLAAIAAASLYLAGRVYLAGARGNRGNGAS |
| Ga0242657_10773761 | 3300022722 | Soil | LSAAILIFVFAAVAAACLYVAGRVYLAGSRRGDSS |
| Ga0224561_10266482 | 3300023030 | Soil | LHLRPMHGMLSAAILICVFAAVTVACAIVAGRVYLAGSRRGDSS |
| Ga0207416_10582202 | 3300025134 | Iron-Sulfur Acid Spring | MHGMLSAAILICVFAAVTVTCVIVVGRVYLAGSRRGDSS |
| Ga0207692_107888501 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MHGMLSAAILICVFAAVAVACLIVAGRVYLAAGRRQGRRGDSS |
| Ga0207684_100954054 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MHGMLSAAILICVFAAVTAACLYVAGRVYLAGSRRGDSS |
| Ga0257161_10871802 | 3300026508 | Soil | MHGMLSAAILICVFVAVTAACVYVAARVYLAGSRRGDSS |
| Ga0209648_100172495 | 3300026551 | Grasslands Soil | MHGMLSAAILIFVFAAVTAACLYVAGRVYLAAGRRKSRRGDSS |
| Ga0208369_10014034 | 3300026998 | Forest Soil | MHGMLSAAILICVFAAVTAACLYVAGRVYLAGSRHGDSS |
| Ga0208731_10077092 | 3300027029 | Forest Soil | MHGMLSAAILICVFAAVTAACLYMAGRVYLAGSRRGDSS |
| Ga0208730_10004132 | 3300027047 | Forest Soil | MHGMLSAAILICVFAAVTVACLYVAGRVYLAGSRRGDSS |
| Ga0209327_10363472 | 3300027307 | Forest Soil | MLSAAILIGVLGVIAAACAYVAGRVYLAGGRHGDPS |
| Ga0208199_10014264 | 3300027497 | Peatlands Soil | MHGMLSAAILICVFAAVAVVCAYVAGRVYLAAGRRQRRRGDSS |
| Ga0209008_10566572 | 3300027545 | Forest Soil | MLSAAILICVFAAVTVACVIVAGRVYLGAGRREGRRGDSS |
| Ga0209008_11559782 | 3300027545 | Forest Soil | MLSAAILICVFAAVTVACVIVAGRVYLAGSRRGDSS |
| Ga0208043_10635072 | 3300027570 | Peatlands Soil | MHGMLSAAILICVFAAVAVVCAYVAGRVYLAGSRRGDSS |
| Ga0209525_10131684 | 3300027575 | Forest Soil | MHGMLSAAILIFVFAAVTVACVIVAGRVYLAGSRRGDSS |
| Ga0209420_10020672 | 3300027648 | Forest Soil | MHGMLSATILICVFAAVGVAGLYVAGRVLLAGRRRGDAS |
| Ga0207862_11847922 | 3300027703 | Tropical Forest Soil | MQGMLSATILMCAFGAVAAACLYVAVRVYLAGKRRGDAS |
| Ga0209655_103107061 | 3300027767 | Bog Forest Soil | GMLSAAILICVFAAVTAACLYVAGRVYLGAGRRQGRRGDSS |
| Ga0209448_100112073 | 3300027783 | Bog Forest Soil | MHGMLSAAILICVFAAVTVACIYVAGRVYLAGSRRGDPS |
| Ga0209040_104966372 | 3300027824 | Bog Forest Soil | MYGMLSAAILICVFAAVTVACAYLAGRVYLAAAGKRQSPQSRRSRRGDSS |
| Ga0209060_102553313 | 3300027826 | Surface Soil | MHGMLSAAILICVFAAVAVACLIAAGRVYLAAGRRQGRRGDSS |
| Ga0209580_101732242 | 3300027842 | Surface Soil | MHGMLSAAILIGAFAAIAGACLYVVGRVHLAGRRRGDAS |
| Ga0209274_100107402 | 3300027853 | Soil | MHGMLSAAILIVTLAAIAAASLYLAGRVYLAGARGNRGDGAS |
| Ga0209693_100816822 | 3300027855 | Soil | MLSAAILIVTLAAIAAASLYLAGRVYLAGARGNRGNGAS |
| Ga0209169_100810353 | 3300027879 | Soil | MHGMLSAAILICLFAAVTAACLYVAVRVYLAGSRRGDSS |
| Ga0209275_107714722 | 3300027884 | Soil | MHGMLSATILIITFAVIALAGLYVAGRVYLAGARGRTGSDAS |
| Ga0209380_101131003 | 3300027889 | Soil | MHGMLSAAILIGAFAAIAGACLYVVRRVHLAGRRRGDAS |
| Ga0209624_100938093 | 3300027895 | Forest Soil | MLSAAILICVFAAVTVACVIVAARVYLGAGRGESRRGDSS |
| Ga0308309_108017782 | 3300028906 | Soil | MYGMLSAAILIVTLAAIAAASLYLAGRVYLAGARGNRGNGAS |
| Ga0308309_108115372 | 3300028906 | Soil | MYGTLSAAILICVFAAVTVACAYLAGRVYLAAAGKRQSPHSRRSRRGDSS |
| Ga0311340_105403122 | 3300029943 | Palsa | MLSAMILIGVFGLIAAACAYVAGRVYLAGGHHGDPS |
| Ga0311340_112252311 | 3300029943 | Palsa | MHGMLSAAILIGVFIVVAAACVYVAGRVYLAGSRRGPDAG |
| Ga0302184_103420782 | 3300030490 | Palsa | LMHGMLSAMILIGVFGLIAAACAYVAGRVYLAGGHHGDPS |
| Ga0310037_100677352 | 3300030494 | Peatlands Soil | MHGMMSAAILICTFGAIAAACLYVAARVYLAGGRSGDAS |
| Ga0311355_109366822 | 3300030580 | Palsa | MHGMLSAAILICVFAVVAVACVWVAGRVYLAGSRRGDSS |
| Ga0265393_10383711 | 3300030586 | Soil | LFPSMHGMLSAAILICVFAAVTVACIYVAGRVYLAAGRRQGHRGDPS |
| Ga0210251_112572372 | 3300030624 | Soil | SSAAILIVTLAAVAAASLYLAGRVYLAGARGNRGNGAS |
| Ga0210279_102520762 | 3300030631 | Soil | HGMLSAAIVICVFAAVAVACAYVAGRVYLAAAGRGPRRQGRRGDSS |
| Ga0265460_113435052 | 3300030740 | Soil | MHGMLSAAILICVFAAVTVACIYVAGRVYLAAGRRQGHRGDPS |
| Ga0265762_11575521 | 3300030760 | Soil | MHGMVSASILIAVFAAIALAGLYVAIRIHLAGATRRKTGK |
| Ga0265740_10347021 | 3300030940 | Soil | RAPALHLRVMYGTLSAAILICVFAAVTVACAYLAGRVYLAAAGKRQSPHSRRSRRGDSS |
| Ga0170822_109947131 | 3300031122 | Forest Soil | MLSAAILICVFAAVTVACVIVAGRVYLAAAGRPHSRQGRRGNSS |
| Ga0170823_115318911 | 3300031128 | Forest Soil | AVLICVFLAVTAAGLYVAGRVYLAAGRRQGRRGDSS |
| Ga0302325_106101533 | 3300031234 | Palsa | MLSAMILIGVFGLIAAACGYVAGRVYLAGGHHGDPS |
| Ga0302325_121120181 | 3300031234 | Palsa | MHGMLSAAILIVTLAAIAAASLYLAGRVYLAGARGNRGSGGS |
| Ga0318516_100185313 | 3300031543 | Soil | MHGTLSATILICVLGAVAAACLYVAVRVYLAGKRGAGAS |
| Ga0318516_102721912 | 3300031543 | Soil | MHGMLSAAILICVFAAVTVACAYVAGRVYLATGKRQGRRGDSP |
| Ga0318516_104525802 | 3300031543 | Soil | MHGMLSAAILICVFAAVTVACAYVAGRVYLAGRRQSRRGDSS |
| Ga0318534_100399671 | 3300031544 | Soil | PFTLRAMHGMLSATILICVLGAVAAACLYVAVRVYLAGKRGAGAS |
| Ga0318534_102227853 | 3300031544 | Soil | MHGMLSATILICVLGAVAAACLYVAVRVYLAGKRGAG |
| Ga0318528_101665541 | 3300031561 | Soil | LRAMQGMLSATILMCAFAAVAAACLYVVGRVYLTGKRRRDAS |
| Ga0318573_103562971 | 3300031564 | Soil | MHGMLSATILICVLGAVAAACLYVAVRVYLAGKRGAGAP |
| Ga0318515_101117461 | 3300031572 | Soil | MLSATILMCVFAAVAAACLYVAGRAYRAGKRRGDAS |
| Ga0310915_103943022 | 3300031573 | Soil | MHGMLSAAILICVFAAVTVACAYVAARVYLAAGKR |
| Ga0318555_101054702 | 3300031640 | Soil | MHGTLSATILICVLGAVAAACLYVAVRVYLAGKRGAGAP |
| Ga0318542_101963623 | 3300031668 | Soil | MHGMLSATILMCVFAVVAAACLYVAGRVYRAGKRRGDAS |
| Ga0318561_102243841 | 3300031679 | Soil | MHGMLSAAILICVFAAVTVACAYVAGRVYLAAAAAGRPQSIQSRRDDSS |
| Ga0318574_100294714 | 3300031680 | Soil | PSFYTLAMHGMLSATILMCVFAVVAAACLYVAGRAYRAGKRRGDAS |
| Ga0318560_104301782 | 3300031682 | Soil | MHGMLSAAILICVFAAVTVACAYVAGRVYLAAGKRQGRRGDSP |
| Ga0310686_1022452345 | 3300031708 | Soil | MYGTLSAAILICVFAAVTVACAYLAGRVYLAAAGRPHSRRSRRGDSS |
| Ga0310686_1085051432 | 3300031708 | Soil | MHGMLSAAILIGVFAAVTVACLYVAGRVYLAGSRGGDSS |
| Ga0310686_1150397132 | 3300031708 | Soil | MHGMLSAGILMGAFAAVAVACLYVVGRVHLAGKRRGDAS |
| Ga0307476_103762062 | 3300031715 | Hardwood Forest Soil | MHGMLSAGILMGAFAAVAGACLYVVGRVHLAGKRRGDGS |
| Ga0307476_110079592 | 3300031715 | Hardwood Forest Soil | MHGMLSAAILICVFVAVTAACLYVAGRVYLAGGRRGDSS |
| Ga0306917_110359472 | 3300031719 | Soil | MHGMLSATILMCVFAVVAAACLYVAGRAYRAGKRRGDAS |
| Ga0306918_102967363 | 3300031744 | Soil | MHGMLSATILICVLGAVAAACLYVAVRVYLAGKRG |
| Ga0318502_104643192 | 3300031747 | Soil | MHGMLSAAILICVFAAVTVACAYVAGRVYLAGSRRDDSS |
| Ga0318554_106647362 | 3300031765 | Soil | VLHLQAMHGMLSAAILICVFAAVTVACAYVAGRVYLAAGKRQSRRGDSS |
| Ga0318526_102012351 | 3300031769 | Soil | MLSAAVLIGVFAAVAAACAYVAGRVYLAAAGRPHS |
| Ga0318498_100188575 | 3300031778 | Soil | TLRAMHGMLSATILICVLGAVAAACLYVAVRVYLAGKRGAGAS |
| Ga0318547_100746764 | 3300031781 | Soil | MHGMLSAAILICVFAAVTVACAYVAGRVYLAAAAAGRPQSIQSRRD |
| Ga0318565_102499071 | 3300031799 | Soil | MHGMLSAAILICVFAGVAVACLYVAGRVYLAAAGRPQRRQSRRGRS |
| Ga0318517_104404002 | 3300031835 | Soil | MHGMLSAAILICVFAAVTVACAYVAGRVYLAAGKQKSRRGDSS |
| Ga0318495_103407771 | 3300031860 | Soil | MHGTLSATILICVLGAVAAACLYVAVRVYLAGKRGA |
| Ga0318495_103433341 | 3300031860 | Soil | VPPFTLRAMHGTLSATILICVLGAVAAACLYVAVRVYLAGKRGAGAS |
| Ga0306919_104380832 | 3300031879 | Soil | MHGMLSATILICVLGAVAAACLYVAVRVYLAGKRGAGAS |
| Ga0306923_105554551 | 3300031910 | Soil | HGTLSATILICVLGAVAAACLYVAVRVYLAGKRGAGAS |
| Ga0306923_106138021 | 3300031910 | Soil | AILICVFAAVTVACAYVAGRVYLAAGKRQSRRGDSS |
| Ga0306923_112408552 | 3300031910 | Soil | MLSAAILICVFAAVTVACAYVAGRVYLATGKRQGRRGDSP |
| Ga0310912_100904244 | 3300031941 | Soil | MHGMLSAAILICVFAAVTVACAYVAGRVYLAAGKRQSRRGDSS |
| Ga0310916_117502442 | 3300031942 | Soil | MHGMLSAAVLIGVFAAVAVACGYVAGRVYLAAAAAGRPQSIQSRRDDSS |
| Ga0310913_105036081 | 3300031945 | Soil | MHGMLSAVILICVFASVTVACAYVAGRVYLAAAAAGRPQSIQSRRDDSS |
| Ga0306926_108007132 | 3300031954 | Soil | MHGMLSATILICVFAAVAAACMYLVGRVYLAGKRRGDAS |
| Ga0307479_113196702 | 3300031962 | Hardwood Forest Soil | MHGMLSAAILICVFAVVTAACLYVARRVYLAAEKGQDRRGDSS |
| Ga0306922_107728942 | 3300032001 | Soil | FYTLAMHGMLSATILMCVFAVVAAACLYVAGRAYRAGKRRGDAS |
| Ga0318563_103504462 | 3300032009 | Soil | MHGMVSAAILISVFGAIAVACVYVAGRVYLAGSRRGDSS |
| Ga0318569_100685862 | 3300032010 | Soil | MHGMLSAAILICVFAAVTVACAHVAGRVYLAAGKRQSRRGDSS |
| Ga0318569_103810142 | 3300032010 | Soil | MLSAAILICVFAAVTVACAYVAGRVYLAGRRQSRRGDSS |
| Ga0318507_102877841 | 3300032025 | Soil | MHGMLSATILICVLGAVAAACLYVAVRVYLAGKRRGDAS |
| Ga0318545_101193881 | 3300032042 | Soil | AILICVFAAVTVACAYVAGRVYLAAAAAGRPQSIQSRRDDSS |
| Ga0318506_102665812 | 3300032052 | Soil | ASPALHLRAMHGMLSAAILICVFAAVAAACVYVAGRVYLAGGRRGRSS |
| Ga0318524_106707632 | 3300032067 | Soil | AMHGMLSAAILICVFAAVTVACAYVAGRVYLAGRRQSRRGDSS |
| Ga0318525_102733392 | 3300032089 | Soil | MHGMLSAAILICVFAAVTVACAYVAGRVYLAGRRQSRR |
| Ga0311301_100267944 | 3300032160 | Peatlands Soil | MLSAAILICVFAAVAVVCAYVAGRVYLAGSRRGDSS |
| Ga0311301_102664754 | 3300032160 | Peatlands Soil | MYGTLSAAILICVFAAVAVACAYLAGRVYLAAAGKRQSPHPRRSRRGDSS |
| Ga0311301_103487064 | 3300032160 | Peatlands Soil | MLSAAILICAFGAIAAACAYVAGRVYLTGGRRGDPS |
| Ga0311301_107694751 | 3300032160 | Peatlands Soil | RRMHGMLSATILICVFTAVALVCLYVAGRVLMAGGRRGDAS |
| Ga0307471_1025512592 | 3300032180 | Hardwood Forest Soil | MYGTLSAAILICVFAAVTVACAYLAARVYLAAAGKRQSPHSRRSRRGDSS |
| Ga0306920_1009787782 | 3300032261 | Soil | MHGMLSAAILICLFAVTAVACLLAAVRVYAAGRQRGRDAR |
| Ga0315742_124485431 | 3300032756 | Forest Soil | AAILICVFAAVTAACLYVAGRVYLGAGRRQGRRGDSS |
| Ga0335079_113384612 | 3300032783 | Soil | MHGMLSAAILIGVFAAVTVACLYVAWRVYLAAAAGRPQSRQSRRGDSS |
| Ga0335078_1001687111 | 3300032805 | Soil | MHGMLSATILIITFAVIAVAGLYLAGRVYLAGTRGKTGGDAS |
| Ga0335081_110358172 | 3300032892 | Soil | MHGMLSAAILIGVFAAVAVACAYVAGRVYLAAGRRPGRRRARHGDPS |
| Ga0335074_10000116115 | 3300032895 | Soil | MHGMVSASVLIGVFGAIAAACLYVAARVYLAGGRGGGAS |
| Ga0335074_100172122 | 3300032895 | Soil | MHGMLSAAILIGVFAAVAVACLYVAGRVFLAGSRGGGPS |
| Ga0335074_100184406 | 3300032895 | Soil | MHGMLSAAILICAFGAVAAACLFVAARAYLAGGRGGDAS |
| Ga0335074_101110584 | 3300032895 | Soil | MLSATILIITFAVIAVAGLYVAGRVYLAGARGKTGGDAS |
| Ga0335074_101504014 | 3300032895 | Soil | MHGMLSATILIITFAVIAAACLYLAGRAYLAGTRGKTGSDAS |
| Ga0335074_101659384 | 3300032895 | Soil | MHGMLSATILIITFAVIAVAGLFLAGRVYLAGARGKAGGDAS |
| Ga0335074_103162432 | 3300032895 | Soil | MHGMLSAAILIFVFGAVAVACAYAAGRVYLAGSRRGDSS |
| Ga0335074_103282562 | 3300032895 | Soil | MHGMLSAAILIGVFAAVTVACLYVAGRVYLAGSRRGDSS |
| Ga0335074_107704522 | 3300032895 | Soil | LDWRAMHGMLSAAILIFVFGAVAVACAYAAGRVFLAGSRRGDSS |
| Ga0335074_113819641 | 3300032895 | Soil | MHGMLSAAILIGVFAAVTVACLYVAGRVFLAGRRRGGSS |
| Ga0335075_101843713 | 3300032896 | Soil | MHGMLSAAILIGVFAAIAVACLYVAGRVFLAGSRGGGPS |
| Ga0335075_106298312 | 3300032896 | Soil | MHGMLSAEILIGVFALVAVACLYVAARAYLAGSRGGDPS |
| Ga0335075_106610602 | 3300032896 | Soil | MHGMLSAMFLIGVFGAVTVACAYVAGRVYLAGSRRGDSS |
| Ga0335076_108883832 | 3300032955 | Soil | MHGMLSAAILICVFAAVTVACLYVAGRVFLAGRRRGGSS |
| Ga0335073_103396083 | 3300033134 | Soil | MHGMLSAATLIGVFAAVAVACLYVAGRVFLAGSRGGGPS |
| Ga0318519_101053591 | 3300033290 | Soil | MHGMLSAAILICVFAAVTVACAYVAGRVYLAAAAAGRPQSIQSR |
| Ga0314867_158358_131_274 | 3300033808 | Peatland | MYGMLSAAILMCVFAAATVACAYVAGRVYLAAAGRPQRRQSRRGDPS |
| ⦗Top⦘ |