| Basic Information | |
|---|---|
| Family ID | F012870 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 276 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MTDLAQWEKENEAFLIKIGQVAPAAPKPTTKKDEE |
| Number of Associated Samples | 169 |
| Number of Associated Scaffolds | 276 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 68.84 % |
| % of genes near scaffold ends (potentially truncated) | 14.13 % |
| % of genes from short scaffolds (< 2000 bps) | 67.39 % |
| Associated GOLD sequencing projects | 152 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (87.681 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (14.130 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.174 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (61.232 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.40% β-sheet: 0.00% Coil/Unstructured: 74.60% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 276 Family Scaffolds |
|---|---|---|
| PF05065 | Phage_capsid | 8.70 |
| PF03354 | TerL_ATPase | 2.90 |
| PF04860 | Phage_portal | 2.54 |
| PF01844 | HNH | 1.81 |
| PF04586 | Peptidase_S78 | 0.72 |
| PF05869 | Dam | 0.72 |
| PF12850 | Metallophos_2 | 0.36 |
| PF13539 | Peptidase_M15_4 | 0.36 |
| PF03237 | Terminase_6N | 0.36 |
| PF02018 | CBM_4_9 | 0.36 |
| COG ID | Name | Functional Category | % Frequency in 276 Family Scaffolds |
|---|---|---|---|
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 8.70 |
| COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 2.90 |
| COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.55 % |
| Unclassified | root | N/A | 1.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000756|JGI12421J11937_10008022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4123 | Open in IMG/M |
| 3300002408|B570J29032_109545973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 858 | Open in IMG/M |
| 3300002471|metazooDRAFT_1437456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300003491|JGI25924J51412_1017287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1286 | Open in IMG/M |
| 3300004054|Ga0063232_10134568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
| 3300005517|Ga0070374_10005792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5806 | Open in IMG/M |
| 3300005517|Ga0070374_10020784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3341 | Open in IMG/M |
| 3300005527|Ga0068876_10008335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6958 | Open in IMG/M |
| 3300005527|Ga0068876_10215584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1109 | Open in IMG/M |
| 3300005527|Ga0068876_10282098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 946 | Open in IMG/M |
| 3300005581|Ga0049081_10236542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
| 3300005662|Ga0078894_10011634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6937 | Open in IMG/M |
| 3300005662|Ga0078894_10066495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3101 | Open in IMG/M |
| 3300005662|Ga0078894_10362691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1312 | Open in IMG/M |
| 3300005662|Ga0078894_11599964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300005805|Ga0079957_1004542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11482 | Open in IMG/M |
| 3300005805|Ga0079957_1063537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2174 | Open in IMG/M |
| 3300005805|Ga0079957_1190660 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 998 | Open in IMG/M |
| 3300005832|Ga0074469_10479229 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
| 3300006030|Ga0075470_10124764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 761 | Open in IMG/M |
| 3300006484|Ga0070744_10023715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1819 | Open in IMG/M |
| 3300006484|Ga0070744_10060625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1104 | Open in IMG/M |
| 3300006484|Ga0070744_10150898 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300006484|Ga0070744_10234500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
| 3300006639|Ga0079301_1005586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5102 | Open in IMG/M |
| 3300006802|Ga0070749_10023376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3899 | Open in IMG/M |
| 3300006802|Ga0070749_10125147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1508 | Open in IMG/M |
| 3300006802|Ga0070749_10195821 | All Organisms → Viruses → Predicted Viral | 1159 | Open in IMG/M |
| 3300006802|Ga0070749_10439182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
| 3300006802|Ga0070749_10708387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300006802|Ga0070749_10756191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300006803|Ga0075467_10572864 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
| 3300006805|Ga0075464_10018714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3553 | Open in IMG/M |
| 3300006805|Ga0075464_10182888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1241 | Open in IMG/M |
| 3300006805|Ga0075464_10250122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1060 | Open in IMG/M |
| 3300006805|Ga0075464_10655779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
| 3300006863|Ga0075459_1021099 | All Organisms → Viruses → Predicted Viral | 1084 | Open in IMG/M |
| 3300006916|Ga0070750_10442800 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300006919|Ga0070746_10532098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300006920|Ga0070748_1245886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
| 3300006920|Ga0070748_1255536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
| 3300006920|Ga0070748_1277585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| 3300006920|Ga0070748_1330858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300007363|Ga0075458_10119747 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
| 3300007538|Ga0099851_1028836 | All Organisms → Viruses → Predicted Viral | 2228 | Open in IMG/M |
| 3300007540|Ga0099847_1002582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6255 | Open in IMG/M |
| 3300007540|Ga0099847_1239687 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
| 3300007542|Ga0099846_1219519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
| 3300007559|Ga0102828_1201620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
| 3300007708|Ga0102859_1013158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2082 | Open in IMG/M |
| 3300007708|Ga0102859_1046562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1195 | Open in IMG/M |
| 3300007734|Ga0104986_1159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11480 | Open in IMG/M |
| 3300007734|Ga0104986_1478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15590 | Open in IMG/M |
| 3300007735|Ga0104988_10307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13283 | Open in IMG/M |
| 3300007735|Ga0104988_10474 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15866 | Open in IMG/M |
| 3300007860|Ga0105735_1113672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
| 3300008055|Ga0108970_11762693 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3462 | Open in IMG/M |
| 3300008072|Ga0110929_1000609 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6122 | Open in IMG/M |
| 3300008106|Ga0114339_1202740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
| 3300008107|Ga0114340_1003334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9017 | Open in IMG/M |
| 3300008107|Ga0114340_1027179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2646 | Open in IMG/M |
| 3300008107|Ga0114340_1086522 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1282 | Open in IMG/M |
| 3300008110|Ga0114343_1217483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
| 3300008113|Ga0114346_1267216 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
| 3300008117|Ga0114351_1057695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2399 | Open in IMG/M |
| 3300008258|Ga0114840_1002569 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3255 | Open in IMG/M |
| 3300008261|Ga0114336_1006844 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8483 | Open in IMG/M |
| 3300008264|Ga0114353_1281251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 708 | Open in IMG/M |
| 3300008266|Ga0114363_1010888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4310 | Open in IMG/M |
| 3300008266|Ga0114363_1017579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3204 | Open in IMG/M |
| 3300008266|Ga0114363_1086895 | All Organisms → Viruses → Predicted Viral | 1152 | Open in IMG/M |
| 3300008266|Ga0114363_1124294 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 892 | Open in IMG/M |
| 3300008266|Ga0114363_1158107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
| 3300008267|Ga0114364_1006969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9481 | Open in IMG/M |
| 3300008267|Ga0114364_1122834 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 768 | Open in IMG/M |
| 3300008448|Ga0114876_1038552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2260 | Open in IMG/M |
| 3300008448|Ga0114876_1042529 | All Organisms → Viruses → Predicted Viral | 2119 | Open in IMG/M |
| 3300008448|Ga0114876_1079578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1365 | Open in IMG/M |
| 3300008450|Ga0114880_1041979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1980 | Open in IMG/M |
| 3300008450|Ga0114880_1173560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 751 | Open in IMG/M |
| 3300009009|Ga0105105_10255593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 930 | Open in IMG/M |
| 3300009009|Ga0105105_10344085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
| 3300009009|Ga0105105_10465456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
| 3300009068|Ga0114973_10062370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2174 | Open in IMG/M |
| 3300009068|Ga0114973_10264248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 925 | Open in IMG/M |
| 3300009068|Ga0114973_10683669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
| 3300009081|Ga0105098_10127225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1125 | Open in IMG/M |
| 3300009081|Ga0105098_10155591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1030 | Open in IMG/M |
| 3300009081|Ga0105098_10421587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
| 3300009081|Ga0105098_10512991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
| 3300009085|Ga0105103_10240529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 976 | Open in IMG/M |
| 3300009085|Ga0105103_10280162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 905 | Open in IMG/M |
| 3300009131|Ga0115027_10603441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 809 | Open in IMG/M |
| 3300009152|Ga0114980_10009609 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6261 | Open in IMG/M |
| 3300009152|Ga0114980_10231624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1081 | Open in IMG/M |
| 3300009152|Ga0114980_10789193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300009155|Ga0114968_10158551 | All Organisms → Viruses → Predicted Viral | 1337 | Open in IMG/M |
| 3300009158|Ga0114977_10003024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10800 | Open in IMG/M |
| 3300009158|Ga0114977_10158375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1345 | Open in IMG/M |
| 3300009158|Ga0114977_10236903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1058 | Open in IMG/M |
| 3300009159|Ga0114978_10005079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10554 | Open in IMG/M |
| 3300009159|Ga0114978_10401192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
| 3300009164|Ga0114975_10002253 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13259 | Open in IMG/M |
| 3300009168|Ga0105104_10275051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 922 | Open in IMG/M |
| 3300009169|Ga0105097_10015404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3991 | Open in IMG/M |
| 3300009169|Ga0105097_10369381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 796 | Open in IMG/M |
| 3300009169|Ga0105097_10402760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 761 | Open in IMG/M |
| 3300009169|Ga0105097_10525961 | Not Available | 662 | Open in IMG/M |
| 3300009169|Ga0105097_10733718 | Not Available | 560 | Open in IMG/M |
| 3300009170|Ga0105096_10133780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1243 | Open in IMG/M |
| 3300009180|Ga0114979_10868228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
| 3300009181|Ga0114969_10173053 | All Organisms → Viruses → Predicted Viral | 1342 | Open in IMG/M |
| 3300009183|Ga0114974_10559288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
| 3300009184|Ga0114976_10048357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2515 | Open in IMG/M |
| 3300009184|Ga0114976_10333140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 805 | Open in IMG/M |
| 3300009184|Ga0114976_10494845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
| 3300009184|Ga0114976_10561305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
| 3300009469|Ga0127401_1144261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
| 3300010316|Ga0136655_1041500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1458 | Open in IMG/M |
| 3300010354|Ga0129333_10013330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7798 | Open in IMG/M |
| 3300010354|Ga0129333_10279917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1497 | Open in IMG/M |
| 3300010368|Ga0129324_10229836 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
| 3300010388|Ga0136551_1000264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15116 | Open in IMG/M |
| 3300010388|Ga0136551_1001861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5300 | Open in IMG/M |
| 3300010388|Ga0136551_1098351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
| 3300010885|Ga0133913_10893550 | All Organisms → Viruses → Predicted Viral | 2307 | Open in IMG/M |
| 3300010885|Ga0133913_13073206 | All Organisms → Viruses → Predicted Viral | 1109 | Open in IMG/M |
| 3300010970|Ga0137575_10007862 | All Organisms → Viruses → Predicted Viral | 1988 | Open in IMG/M |
| 3300011115|Ga0151514_10570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15819 | Open in IMG/M |
| 3300011116|Ga0151516_11181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10924 | Open in IMG/M |
| 3300011183|Ga0136713_1025655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 757 | Open in IMG/M |
| 3300011334|Ga0153697_1322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15492 | Open in IMG/M |
| 3300011334|Ga0153697_1481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12008 | Open in IMG/M |
| 3300011334|Ga0153697_1610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10040 | Open in IMG/M |
| 3300011335|Ga0153698_1487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16399 | Open in IMG/M |
| 3300011339|Ga0153700_11222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11228 | Open in IMG/M |
| 3300012006|Ga0119955_1036265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1607 | Open in IMG/M |
| 3300012006|Ga0119955_1060282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1151 | Open in IMG/M |
| 3300012012|Ga0153799_1008991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2271 | Open in IMG/M |
| 3300012017|Ga0153801_1031048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 945 | Open in IMG/M |
| 3300012266|Ga0136712_1023630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
| 3300012352|Ga0157138_1005257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2180 | Open in IMG/M |
| 3300012665|Ga0157210_1000922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10126 | Open in IMG/M |
| 3300012665|Ga0157210_1008680 | All Organisms → Viruses → Predicted Viral | 1861 | Open in IMG/M |
| 3300012665|Ga0157210_1053940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300012714|Ga0157601_1200019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 777 | Open in IMG/M |
| 3300012716|Ga0157605_1012881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
| 3300012723|Ga0157604_1198340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
| 3300012724|Ga0157611_1086902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
| 3300012730|Ga0157602_1015681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11102 | Open in IMG/M |
| 3300012731|Ga0157616_1139527 | All Organisms → Viruses → Predicted Viral | 1193 | Open in IMG/M |
| 3300012990|Ga0159060_1017030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1870 | Open in IMG/M |
| 3300013004|Ga0164293_10046583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3516 | Open in IMG/M |
| 3300013004|Ga0164293_10532020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
| 3300013004|Ga0164293_10556339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
| 3300013006|Ga0164294_10093770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2235 | Open in IMG/M |
| 3300013006|Ga0164294_10101676 | All Organisms → Viruses → Predicted Viral | 2130 | Open in IMG/M |
| 3300013006|Ga0164294_10917473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
| 3300013074|Ga0157618_1055408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
| 3300013295|Ga0170791_15274364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 759 | Open in IMG/M |
| 3300013372|Ga0177922_10096841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1150 | Open in IMG/M |
| 3300013372|Ga0177922_10137628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
| 3300014811|Ga0119960_1075498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
| 3300017707|Ga0181363_1010542 | All Organisms → Viruses → Predicted Viral | 1902 | Open in IMG/M |
| 3300017722|Ga0181347_1074234 | All Organisms → Viruses → Predicted Viral | 1000 | Open in IMG/M |
| 3300017722|Ga0181347_1133775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
| 3300017736|Ga0181365_1098074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 711 | Open in IMG/M |
| 3300017761|Ga0181356_1000941 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12794 | Open in IMG/M |
| 3300017761|Ga0181356_1047897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1481 | Open in IMG/M |
| 3300017761|Ga0181356_1090158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1008 | Open in IMG/M |
| 3300017761|Ga0181356_1181186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
| 3300017777|Ga0181357_1228038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
| 3300017777|Ga0181357_1311541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300017780|Ga0181346_1300676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300017784|Ga0181348_1017801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3042 | Open in IMG/M |
| 3300017785|Ga0181355_1098895 | All Organisms → Viruses → Predicted Viral | 1208 | Open in IMG/M |
| 3300019784|Ga0181359_1007331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3746 | Open in IMG/M |
| 3300019784|Ga0181359_1012607 | All Organisms → Viruses → Predicted Viral | 3060 | Open in IMG/M |
| 3300019784|Ga0181359_1060021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1456 | Open in IMG/M |
| 3300020048|Ga0207193_1010934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12745 | Open in IMG/M |
| 3300020048|Ga0207193_1120321 | All Organisms → Viruses → Predicted Viral | 2308 | Open in IMG/M |
| 3300020048|Ga0207193_1733007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
| 3300020172|Ga0211729_10903810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1113 | Open in IMG/M |
| 3300020205|Ga0211731_10700971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10512 | Open in IMG/M |
| 3300020506|Ga0208091_1014526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 948 | Open in IMG/M |
| 3300020537|Ga0208722_1052971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300021438|Ga0213920_1001128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15908 | Open in IMG/M |
| 3300021438|Ga0213920_1006637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3949 | Open in IMG/M |
| 3300021438|Ga0213920_1094342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
| 3300021962|Ga0222713_10293913 | All Organisms → Viruses → Predicted Viral | 1038 | Open in IMG/M |
| 3300021963|Ga0222712_10723449 | Not Available | 558 | Open in IMG/M |
| 3300022179|Ga0181353_1052924 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1060 | Open in IMG/M |
| 3300022190|Ga0181354_1032607 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1708 | Open in IMG/M |
| 3300022407|Ga0181351_1113151 | All Organisms → Viruses → Predicted Viral | 1030 | Open in IMG/M |
| 3300022543|Ga0212119_1085982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
| 3300023174|Ga0214921_10006808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15459 | Open in IMG/M |
| 3300023184|Ga0214919_10197115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1518 | Open in IMG/M |
| 3300024346|Ga0244775_10023877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5509 | Open in IMG/M |
| 3300024346|Ga0244775_11539620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300025075|Ga0209615_100789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2576 | Open in IMG/M |
| 3300025543|Ga0208303_1033324 | All Organisms → Viruses → Predicted Viral | 1354 | Open in IMG/M |
| 3300025635|Ga0208147_1117115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
| 3300025647|Ga0208160_1072127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 940 | Open in IMG/M |
| 3300025848|Ga0208005_1190994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
| 3300025889|Ga0208644_1005266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9579 | Open in IMG/M |
| 3300025896|Ga0208916_10217730 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 828 | Open in IMG/M |
| 3300027143|Ga0255105_1054916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
| 3300027285|Ga0255131_1069296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300027365|Ga0209300_1010978 | All Organisms → Viruses → Predicted Viral | 2432 | Open in IMG/M |
| 3300027586|Ga0208966_1168835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
| 3300027683|Ga0209392_1053563 | All Organisms → Viruses → Predicted Viral | 1309 | Open in IMG/M |
| 3300027721|Ga0209492_1025198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2054 | Open in IMG/M |
| 3300027721|Ga0209492_1128668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 888 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1156097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 977 | Open in IMG/M |
| 3300027733|Ga0209297_1218245 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
| 3300027733|Ga0209297_1343247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300027734|Ga0209087_1001292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14749 | Open in IMG/M |
| 3300027734|Ga0209087_1084622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1372 | Open in IMG/M |
| 3300027734|Ga0209087_1140952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 978 | Open in IMG/M |
| 3300027754|Ga0209596_1226807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 781 | Open in IMG/M |
| 3300027759|Ga0209296_1001207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20389 | Open in IMG/M |
| 3300027759|Ga0209296_1337491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
| 3300027762|Ga0209288_10253848 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
| 3300027763|Ga0209088_10008334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5710 | Open in IMG/M |
| 3300027763|Ga0209088_10099720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1333 | Open in IMG/M |
| 3300027764|Ga0209134_10043670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1477 | Open in IMG/M |
| 3300027764|Ga0209134_10297661 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
| 3300027769|Ga0209770_10066030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1519 | Open in IMG/M |
| 3300027782|Ga0209500_10009933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5910 | Open in IMG/M |
| 3300027782|Ga0209500_10094797 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1488 | Open in IMG/M |
| 3300027782|Ga0209500_10315401 | Not Available | 657 | Open in IMG/M |
| 3300027785|Ga0209246_10168868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 859 | Open in IMG/M |
| 3300027785|Ga0209246_10278022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
| 3300027793|Ga0209972_10002428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15280 | Open in IMG/M |
| 3300027798|Ga0209353_10441998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
| 3300027808|Ga0209354_10208092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 792 | Open in IMG/M |
| 3300027808|Ga0209354_10349145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
| 3300027971|Ga0209401_1056575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1752 | Open in IMG/M |
| 3300027971|Ga0209401_1196446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
| 3300027973|Ga0209298_10260714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
| 3300028025|Ga0247723_1002459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9861 | Open in IMG/M |
| 3300028025|Ga0247723_1045269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1286 | Open in IMG/M |
| 3300028025|Ga0247723_1049163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1215 | Open in IMG/M |
| 3300028025|Ga0247723_1070733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 940 | Open in IMG/M |
| 3300028025|Ga0247723_1109447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
| 3300028025|Ga0247723_1159108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1012591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8350 | Open in IMG/M |
| (restricted) 3300029268|Ga0247842_10309550 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 844 | Open in IMG/M |
| 3300031784|Ga0315899_10956956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
| 3300031786|Ga0315908_10018363 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5119 | Open in IMG/M |
| 3300031787|Ga0315900_10024933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6806 | Open in IMG/M |
| 3300031857|Ga0315909_10458752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 893 | Open in IMG/M |
| 3300031951|Ga0315904_10042978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5120 | Open in IMG/M |
| 3300031951|Ga0315904_11066760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300032093|Ga0315902_10406162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1229 | Open in IMG/M |
| 3300032116|Ga0315903_10310495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1327 | Open in IMG/M |
| 3300032116|Ga0315903_10442504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1045 | Open in IMG/M |
| 3300033980|Ga0334981_0362610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300033981|Ga0334982_0002392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11648 | Open in IMG/M |
| 3300034012|Ga0334986_0126578 | All Organisms → Viruses → Predicted Viral | 1499 | Open in IMG/M |
| 3300034012|Ga0334986_0264894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 927 | Open in IMG/M |
| 3300034061|Ga0334987_0100668 | All Organisms → Viruses → Predicted Viral | 2223 | Open in IMG/M |
| 3300034061|Ga0334987_0448533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
| 3300034061|Ga0334987_0629940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300034062|Ga0334995_0089230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2372 | Open in IMG/M |
| 3300034063|Ga0335000_0404855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 810 | Open in IMG/M |
| 3300034101|Ga0335027_0002909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15033 | Open in IMG/M |
| 3300034101|Ga0335027_0291972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1106 | Open in IMG/M |
| 3300034104|Ga0335031_0035046 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3651 | Open in IMG/M |
| 3300034104|Ga0335031_0842124 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300034106|Ga0335036_0002871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14972 | Open in IMG/M |
| 3300034106|Ga0335036_0042376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3519 | Open in IMG/M |
| 3300034111|Ga0335063_0609005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300034119|Ga0335054_0078156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2040 | Open in IMG/M |
| 3300034121|Ga0335058_0002150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13658 | Open in IMG/M |
| 3300034168|Ga0335061_0043663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2400 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 14.13% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 13.77% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.41% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.87% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 7.25% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.16% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.43% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 3.26% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.26% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.17% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.17% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.45% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 1.45% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.45% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.09% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 1.09% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.09% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.09% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.72% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.72% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.72% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.72% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.72% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.36% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.36% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.36% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.36% |
| Water Bodies | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies | 0.36% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.36% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.36% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.36% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.36% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.36% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.36% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002471 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAY 2013 | Environmental | Open in IMG/M |
| 3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
| 3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
| 3300007860 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3um | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008072 | Microbial Communities in Water bodies, Singapore - Site MA | Environmental | Open in IMG/M |
| 3300008106 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-53-LTR | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009469 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300010970 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016 | Environmental | Open in IMG/M |
| 3300011115 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016May | Environmental | Open in IMG/M |
| 3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
| 3300011183 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - JTO22cm metaG | Environmental | Open in IMG/M |
| 3300011334 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung | Environmental | Open in IMG/M |
| 3300011335 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman | Environmental | Open in IMG/M |
| 3300011339 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Hannam | Environmental | Open in IMG/M |
| 3300012006 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101B | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012266 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - JTO19cm metaG | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012714 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES125 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012716 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012723 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES129 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012724 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012730 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES126 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012731 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012990 | Tailings pond microbial communities from Northern Alberta -TP6_2010 BML May 2015 | Engineered | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013074 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES147 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020537 | Freshwater microbial communities from Lake Mendota, WI - 21SEP2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022543 | Indian_combined assembly | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025075 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027143 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300027285 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8d | Environmental | Open in IMG/M |
| 3300027365 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300029268 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19m | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| 3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12421J11937_100080223 | 3300000756 | Freshwater And Sediment | MSDYDKELEAFLIKIGQAAPTAAPTPKPATKKDEE* |
| B570J29032_1095459733 | 3300002408 | Freshwater | MSDWEKENEAFLIKIGQVAPTAAPTPKPVTKKDEE* |
| metazooDRAFT_14374562 | 3300002471 | Lake | NPNELELTMTDMAQWEKENEAFLIKIGQVKPAATKPVTKKEEE* |
| JGI25924J51412_10172872 | 3300003491 | Freshwater Lake | LGIIMTELEQWEKENEAFLIKIGQVKPSAAKPITKKDEE* |
| Ga0063232_101345683 | 3300004054 | Freshwater Lake | PNELELTMTDMAQWEKEQEAFLIKIGQVKPAAVKPVTKKEEE* |
| Ga0070374_100057923 | 3300005517 | Freshwater Lake | MTDLAQWEKENEAFLIKIGQVAPKAETKPTTKKEEE* |
| Ga0070374_100207843 | 3300005517 | Freshwater Lake | MSDYDKELADFLIKIGQVAPTAPTPKPVTKKDEE* |
| Ga0068876_100083355 | 3300005527 | Freshwater Lake | MTDMEQWNKENDAFLALIGQVAKATPKPVSKKDEE* |
| Ga0068876_102155843 | 3300005527 | Freshwater Lake | MSDWEKENEAFLIKIGQVKETPAVKPVTTKKDEE* |
| Ga0068876_102820983 | 3300005527 | Freshwater Lake | KMSEWEKENEAFLIKIGQVAPSAPKPVTTKKDEE* |
| Ga0049081_102365422 | 3300005581 | Freshwater Lentic | MTDLAQWEKENKEFLIKIGQAAPAPKPTTKKDEE* |
| Ga0078894_100116344 | 3300005662 | Freshwater Lake | MTITEWEKENEAFLIKIGQIAPAAPKPATKKDEE* |
| Ga0078894_100664955 | 3300005662 | Freshwater Lake | MTDMEQWEKENEAFLAKIGQVKQAVSKPASTKKDEE* |
| Ga0078894_103626913 | 3300005662 | Freshwater Lake | MTDLAQWEKENEAFLIKIGQVASKPETKPATKKDEE* |
| Ga0078894_115999642 | 3300005662 | Freshwater Lake | MTDLAQWEKENEAFLTKIGQVASKPEPKTTTKKDEE* |
| Ga0079957_100454212 | 3300005805 | Lake | MSEWEKENAAFLIKIGQVAPAAPAPKPATKKDEE* |
| Ga0079957_10635372 | 3300005805 | Lake | MTDMAQWEKEQEAFLIKIGQVKPAAPKPVTKKEEE* |
| Ga0079957_11906602 | 3300005805 | Lake | MTLNEWEKENEAFLIKIGQIAPAAPKTATKKDEE* |
| Ga0074469_104792292 | 3300005832 | Sediment (Intertidal) | MTDLAQWEKENEAFLTKIGQVASKPEPKPATKKDEE* |
| Ga0075470_101247643 | 3300006030 | Aqueous | MTDLAQWEKENEAFLIKIGQVASKPETKPTKKEEE* |
| Ga0070744_100237154 | 3300006484 | Estuarine | MSDWEKENEAFLIKIGQVKETPAAKPVTTKKDEE* |
| Ga0070744_100606253 | 3300006484 | Estuarine | LELIMTELEQWEKENEAFLIKIGQVKPVAAKPATKKDEE* |
| Ga0070744_101508982 | 3300006484 | Estuarine | MTDMEQWEKENEAFLAKIGQVKQAAPKPTSTKKDEE* |
| Ga0070744_102345002 | 3300006484 | Estuarine | MTLNEWEKENEAFLIKIGQVAPVTAPKPTTKKDEE* |
| Ga0079301_10055863 | 3300006639 | Deep Subsurface | MSDYDKELEAFLIKIGQVKPAVPTPKPVTKKDEE* |
| Ga0070749_100233764 | 3300006802 | Aqueous | MSDYEKELEAFLIKIGQTPAPATPAAPKTTPKKDEE* |
| Ga0070749_101251473 | 3300006802 | Aqueous | MTDLAEWEKENDAFLIRIGQKAPTQATKPTAKKDEE* |
| Ga0070749_101958212 | 3300006802 | Aqueous | MTDLAQWEKENEAFLIKIGQVASKPETKPTAKKEEE* |
| Ga0070749_104391822 | 3300006802 | Aqueous | MSDWEKENEAVLIKIGQVKETPAVKPVTTKKDEE* |
| Ga0070749_107083872 | 3300006802 | Aqueous | MTLEQWEKDNAAFLIKIGQIAPAAPKPATKKDEE* |
| Ga0070749_107561912 | 3300006802 | Aqueous | KMSEWEKENEAFLIKIGQVAPAVSKPATTKKDEE* |
| Ga0075467_105728642 | 3300006803 | Aqueous | MTDLAQWEKENEAFLIKIGQVAPKAEAKPTTKKDEE* |
| Ga0075464_100187144 | 3300006805 | Aqueous | MTELEQWEKENEAFLIKIGQVKPVAAKPVTKKEEE* |
| Ga0075464_101828882 | 3300006805 | Aqueous | MTDMEQWEKENEAFLAKIGQVKQSAPKPPSTKKDEE* |
| Ga0075464_102501223 | 3300006805 | Aqueous | MTDLTQWEKENEAFLIKIGQVASKPETKPTAKKEEE* |
| Ga0075464_106557791 | 3300006805 | Aqueous | TMTELAQWEKENEEFLIKIGQVKPAAAKPLNKKDEE* |
| Ga0075459_10210994 | 3300006863 | Aqueous | MTDLAQWEKENEAFLIKIGQVASKPETKTTTKKDEE* |
| Ga0070750_104428002 | 3300006916 | Aqueous | MTDLAQWEKENEAFLTKIGQVASKPETKPTKKEEE* |
| Ga0070746_105320981 | 3300006919 | Aqueous | MTDLAQWEKENEAFLIKIGQVKEAQTPKPVTKKDEE* |
| Ga0070748_12458861 | 3300006920 | Aqueous | LELTMTDMAQWEKEQEAFLIKIGQVKPAAPKPVTKKEEE* |
| Ga0070748_12555362 | 3300006920 | Aqueous | MSDREKENEAFLIKIGQVKETPAAKPVTTKKDEE* |
| Ga0070748_12775852 | 3300006920 | Aqueous | MSDYDKELEAFLIKVGQIQQAAPAPKPATKKDEE* |
| Ga0070748_13308582 | 3300006920 | Aqueous | MTELEQWEKENEAFLIKIGQVKPAAIKPVTKKDEE* |
| Ga0075458_101197473 | 3300007363 | Aqueous | MSDYDKELEAFLIKVGQIQPAAPAPKPATKKDEE* |
| Ga0099851_10288364 | 3300007538 | Aqueous | MSDWEKENEAFLIKIGQVKPAAQAAPKPVTKKEEE* |
| Ga0099847_10025829 | 3300007540 | Aqueous | MTLNEWEKENEAFLIKIGQTAPATPKPATKKDEE* |
| Ga0099847_12396872 | 3300007540 | Aqueous | MNMTDYDKELEAFLIKIGQVAPTAAPTPKPVTKKDEE* |
| Ga0099846_12195192 | 3300007542 | Aqueous | MSDYEKELEAFLIKIGQTPAPVAPAAPKTTPKKDEE* |
| Ga0102828_12016202 | 3300007559 | Estuarine | MTELEQWEKENEAFLIKIGQVKPVAAKPATKKDEE* |
| Ga0102859_10131583 | 3300007708 | Estuarine | MSEWEKELEAFLIKIGQVPAVATKPASTDNKEKE* |
| Ga0102859_10465623 | 3300007708 | Estuarine | MTLEQWEKENEAFLIKIGQIAPATPATPKPATKKDEE* |
| Ga0104986_11592 | 3300007734 | Freshwater | MTDMEQWEKENEAFLAKIGQVKQAVSKPASTKKEEE* |
| Ga0104986_147821 | 3300007734 | Freshwater | MTLNEWEKENEAFLIKIGQIAPAAPKPATKKDEE* |
| Ga0104988_1030721 | 3300007735 | Freshwater | MTDMEQWEKENEAFLAKIGQGKPAVKPTSTKKDEE* |
| Ga0104988_1047424 | 3300007735 | Freshwater | MTDLAQWEKENAAFLTKIGQVASKPEPKQKKDEE* |
| Ga0105735_11136721 | 3300007860 | Estuary Water | VGVNMSEWELENEAFLKKIGQVAPATPKPATTKKDEE* |
| Ga0108970_117626935 | 3300008055 | Estuary | MTDMAQWEKEQEAFLIKIGQVKPVAPKPVTKKEEE* |
| Ga0110929_10006093 | 3300008072 | Water Bodies | MDINMTDTAEKENEAFLTKIGQVAPKPKPTVKKDEE* |
| Ga0114339_12027402 | 3300008106 | Freshwater, Plankton | MSDYDKELEAFLIKIGQAAPTPAPTPKPATKKDEE* |
| Ga0114340_100333414 | 3300008107 | Freshwater, Plankton | MTELAQWEKEQEAFLIKIGQVKPAAAKPLNKKDEE* |
| Ga0114340_10271792 | 3300008107 | Freshwater, Plankton | MTLEQWEKDNAAFLIKIGQIAPAAPKTATKKDEE* |
| Ga0114340_10865222 | 3300008107 | Freshwater, Plankton | MTLEEWEKENDAFLIRIGQKPSTPAAKPATKKDEE* |
| Ga0114343_12174832 | 3300008110 | Freshwater, Plankton | MTDMEQWEKDNEAFLIKIGQVKPAASKPASTKKDEE* |
| Ga0114346_12672163 | 3300008113 | Freshwater, Plankton | MTDLAQWEKENEAFLIKIGQVAPKAEAKPTTKKDE |
| Ga0114351_10576954 | 3300008117 | Freshwater, Plankton | MTDMEQWEKENEAFLIKIGQVKPAAAKPTTKKDEE* |
| Ga0114840_10025696 | 3300008258 | Freshwater, Plankton | VGAKMSEWEKEQEAFLIKIGQVAPKPKPASTKKDEE* |
| Ga0114336_10068444 | 3300008261 | Freshwater, Plankton | MTMTDYDKELEAFLIKIGQVEPKATPKPATKKDEE* |
| Ga0114353_12812511 | 3300008264 | Freshwater, Plankton | ELIMSEWEKEQEAFLIKIGQVKPASPKPVTIKKEEE* |
| Ga0114363_10108883 | 3300008266 | Freshwater, Plankton | MDITMTDLEQWEKENEAFLIKIGQVKPAAAKPLTKKDEE* |
| Ga0114363_10175793 | 3300008266 | Freshwater, Plankton | MELIMTDLAQWEKENEAFLIKIGQVAPKAETKPTTKKEEE* |
| Ga0114363_10868952 | 3300008266 | Freshwater, Plankton | MSDYDKELEAFLIKIGQVAPTAPTPKPVTKKDEE* |
| Ga0114363_11242941 | 3300008266 | Freshwater, Plankton | AGAKMSEWEKENEAFLIKIGQVAPSAPKPVTTKKDEE* |
| Ga0114363_11581071 | 3300008266 | Freshwater, Plankton | MTELAQWEKENEEFLIKIGQVKPAAAKPLTKKDEE* |
| Ga0114364_100696919 | 3300008267 | Freshwater, Plankton | MSEWELENAAFLKKIGQVAPAAPAPKPATKKDEE* |
| Ga0114364_11228343 | 3300008267 | Freshwater, Plankton | MIMTDLAQWEKENEAFLIKIGQVAPKAETKPSNKKDEE* |
| Ga0114876_10385523 | 3300008448 | Freshwater Lake | MGVEMTLEQWEKDNAAFLIKIGQIAPAAPKTATKKDEE* |
| Ga0114876_10425294 | 3300008448 | Freshwater Lake | MTDLAQWEKENEAFLIKIGQVASKPETKPTTKKDEE* |
| Ga0114876_10795782 | 3300008448 | Freshwater Lake | MSEWEKENAAFLKKIGQVAPAAPAPKPATKKDEE* |
| Ga0114880_10419793 | 3300008450 | Freshwater Lake | MTLNEWEKENEAFLIKIGQIAPAAPQPKTTKKDEE* |
| Ga0114880_11735603 | 3300008450 | Freshwater Lake | MSEWEQENAAFLKKIGQVAPAPAAPKPTTKKDEE* |
| Ga0105105_102555933 | 3300009009 | Freshwater Sediment | MTEWEKEQEAFLIKIGQVKPVVPTPKPATKKDEE* |
| Ga0105105_103440853 | 3300009009 | Freshwater Sediment | MTDMAQWEKENEAFLIKIGQVKPAAAKPVTKKEEE* |
| Ga0105105_104654562 | 3300009009 | Freshwater Sediment | MTDMEQWEKENEAFLAKIGQVKQAAPKPATTKKDEE* |
| Ga0114973_100623703 | 3300009068 | Freshwater Lake | MTDMEQWEKENKAFLALIGQVEKVAPKPTPTKKDEE* |
| Ga0114973_102642482 | 3300009068 | Freshwater Lake | MTDLAQWEKDNEAFLIKIGQVASKAEPKPTTKKDEE* |
| Ga0114973_106836692 | 3300009068 | Freshwater Lake | GANMSEWEKERDAFLIKIGQVAPSAPKPVTTKKDEE* |
| Ga0105098_101272252 | 3300009081 | Freshwater Sediment | MTELEQWEKENEAFLIKIGQVKPAAPKPVTKKDEE* |
| Ga0105098_101555912 | 3300009081 | Freshwater Sediment | MTDMEQWEKENEAFLIKIGQVKPAAPKPATTKKDEE* |
| Ga0105098_104215871 | 3300009081 | Freshwater Sediment | MTDMEQWNKENDAFLALIGQVAKATPKPVTKKDEE* |
| Ga0105098_105129911 | 3300009081 | Freshwater Sediment | MTLNEWEKDNEAFLIKIGQIAPAAPKPATKKDEE* |
| Ga0105103_102405293 | 3300009085 | Freshwater Sediment | MTDMEQWKKENDAFLALIGQVAKATPKPVTKKDEE* |
| Ga0105103_102801622 | 3300009085 | Freshwater Sediment | MTELEQWEKENEAFLIKIGQVKPLAAKPVTKKDEE* |
| Ga0115027_106034413 | 3300009131 | Wetland | MTDKAQWEKEQEAFLIKVGQVEAPKPKPITKKDEE* |
| Ga0114980_100096094 | 3300009152 | Freshwater Lake | MTDLAQWEKENEAFLIKIGQVAPKAETKPSNKKDEE* |
| Ga0114980_102316243 | 3300009152 | Freshwater Lake | MIMTDLAQWEKENEAFLIKIGQVAPKAETKPTPKKDEE* |
| Ga0114980_107891932 | 3300009152 | Freshwater Lake | TDMEQWEKENEAFLAKIGQVKQAAPKPTSTKKDEE* |
| Ga0114968_101585513 | 3300009155 | Freshwater Lake | MTDLAQWEKDNEAFLIKIGQVAPKAETKPTPKKDEE* |
| Ga0114977_100030242 | 3300009158 | Freshwater Lake | MTLNEWEKDNEAFLIKIGQIASIAPKPSTKKDEE* |
| Ga0114977_101583752 | 3300009158 | Freshwater Lake | MDMIMTDLAQWEKENEAFLIKIGQVAPKAETKPTPKKDEE* |
| Ga0114977_102369033 | 3300009158 | Freshwater Lake | MGITMTDMAQWEKENEAFLIKIGQVKPAAPKPVTKKEEE* |
| Ga0114978_1000507921 | 3300009159 | Freshwater Lake | MTDLAQWEKENADFLTKIGQVDSAPAAPKPTTKKDEE* |
| Ga0114978_104011922 | 3300009159 | Freshwater Lake | MELIVTDLAQWEKENEAFLIKIGQAAPVTSKPTTKKDEE* |
| Ga0114975_1000225316 | 3300009164 | Freshwater Lake | MTDLAQWEKENEAFLIKIGQVAPKAEARPTTKKDEE* |
| Ga0105104_102750511 | 3300009168 | Freshwater Sediment | MTDMEQWEKENEAFLIKIGQVKPAAPKPTSTKKDEE* |
| Ga0105097_100154046 | 3300009169 | Freshwater Sediment | MGVDMTLEQWEKDNEAFLIKIGQIRPAAPKPATKKDEE* |
| Ga0105097_103693812 | 3300009169 | Freshwater Sediment | MTDLAQWEKENEAFLIKIGQVASKPEPKTTTKKDEE* |
| Ga0105097_104027602 | 3300009169 | Freshwater Sediment | MTEWEKEQEAFLTKIGQVKPAVPTPKPVTKKDEE* |
| Ga0105097_105259613 | 3300009169 | Freshwater Sediment | MTDLAQWEKENAAFLIKIGQVAPKAEAKPTTKKEEE |
| Ga0105097_107337182 | 3300009169 | Freshwater Sediment | MDIDMTDTAEKENEAFLTKIGQVASKPKPTVKKEEE* |
| Ga0105096_101337802 | 3300009170 | Freshwater Sediment | MTDMEQWEKENEAFLIKIGQVKPAAPKPASTKKDEE* |
| Ga0114979_108682282 | 3300009180 | Freshwater Lake | MDIGMTDLAQWEKENEAFLIKIGQVAPKAETKPTTKKDEE* |
| Ga0114969_101730533 | 3300009181 | Freshwater Lake | MTDLAQWEKENEAFLIKIGQVAPKTETKPTPKKDEE* |
| Ga0114974_105592881 | 3300009183 | Freshwater Lake | MTLNEWEKENEAFLIKIGQIAPVAPKPATKKDEE* |
| Ga0114976_100483574 | 3300009184 | Freshwater Lake | MGVTMTDLGQWEKENEAFLIKIGQVAKETPKPVTTKKDEE* |
| Ga0114976_103331401 | 3300009184 | Freshwater Lake | MTLEEWEKDNAAFLIKIGQVAPPAPKPATKKDEE* |
| Ga0114976_104948452 | 3300009184 | Freshwater Lake | MELIMTDLAQWEKENEAFLIKIGQVVPKAETKPTTKKDEE* |
| Ga0114976_105613052 | 3300009184 | Freshwater Lake | MTDMELWEKENEAFLAKIGQVKQSAPKPPSTKKDEE* |
| Ga0127401_11442612 | 3300009469 | Meromictic Pond | MSEWEKDNAAFLIKIGQVAPAAPAPKPITKKDEE* |
| Ga0136655_10415003 | 3300010316 | Freshwater To Marine Saline Gradient | MGVKMTLQEWEKENEAFLIKIGQTAPATPKPATKKDEE* |
| Ga0129333_100133306 | 3300010354 | Freshwater To Marine Saline Gradient | MSDYDKELEAFLIKIGQVAPTAAPTPKPATKKDEE* |
| Ga0129333_102799173 | 3300010354 | Freshwater To Marine Saline Gradient | MTDMEQWEKDNEAFLAKIGQVKQAASKPASTKKDEE* |
| Ga0129324_102298363 | 3300010368 | Freshwater To Marine Saline Gradient | NELELSMTEWEKEQEAFLIKIGQVKPATPKPVTKKDEE* |
| Ga0136551_100026422 | 3300010388 | Pond Fresh Water | MTELEQWEKENEAFLIKIGQVKPVASKPATKKEEE* |
| Ga0136551_10018612 | 3300010388 | Pond Fresh Water | MTDLAQWEKDNEAFLIKIGQVAPVATPKPTTKKDEE* |
| Ga0136551_10983512 | 3300010388 | Pond Fresh Water | MSDYDKELEAFLIKVGQIQQVAPAPKPATKKDEE* |
| Ga0133913_108935503 | 3300010885 | Freshwater Lake | MTDLAQWEKDNEAFLIKIGQVAPVATTKPTTKKDEE* |
| Ga0133913_130732062 | 3300010885 | Freshwater Lake | MTDMEQWEKENEAFLAKIGQVKQSAPKPTSTKKDEE* |
| Ga0137575_100078623 | 3300010970 | Pond Fresh Water | MSDWEKENEAFLIKIGQVSKPAPQPKPVTKKDEE* |
| Ga0151514_105704 | 3300011115 | Freshwater | MGVIMSEWEKEQEAFLIKIGQVAPAAPKSSTKKDEE* |
| Ga0151516_111819 | 3300011116 | Freshwater | MTDMAQWEKEQEAFLIKIGQVKPAAPKPAIKKEEE* |
| Ga0136713_10256551 | 3300011183 | Freshwater | MTELAQWEKENEEFLIKIGQVKPAAAKPLNKKDEE* |
| Ga0153697_132220 | 3300011334 | Freshwater | MTMTDYDKELEAFLIKIGQVEPKAAPKPVTKKEEE* |
| Ga0153697_14815 | 3300011334 | Freshwater | MTDLAQWEKENEAFLIKIGQVASKAETKPTTKKDEE* |
| Ga0153697_16103 | 3300011334 | Freshwater | MSDWEKENEAFLIKIGQVKETPTAKPATTKKDEE* |
| Ga0153698_14876 | 3300011335 | Freshwater | MTDLAQWEKENKEFLIKIGQVAPTAKPTTKKEEE* |
| Ga0153700_1122222 | 3300011339 | Freshwater | MTDMAQWEKEQEAFLIKIGQVKPAAAKPVTKKEEE* |
| Ga0119955_10362654 | 3300012006 | Freshwater | MTDLAQWEKENAAFLIKIGQVAPKAEAKPTTKKDEE* |
| Ga0119955_10602823 | 3300012006 | Freshwater | MTDMELWEKENEAFLAKIGQVKQSAPKPTSTKKDEE* |
| Ga0153799_10089913 | 3300012012 | Freshwater | MTDMEQWEKENQAFLAKIGQVKQSAPKPPSTKKDEE* |
| Ga0153801_10310483 | 3300012017 | Freshwater | VGVNMSEWEKENEAFLIKIGQVAPAAPKPATTKKDEE* |
| Ga0136712_10236302 | 3300012266 | Freshwater | MTDLAQWEKENKEFLIKIGQVSPAPKPTTKKDEE* |
| Ga0157138_10052575 | 3300012352 | Freshwater | MTDLAEWEKENDAFLIRIGQKAPAQATKPTAKKDEE* |
| Ga0157210_10009226 | 3300012665 | Freshwater | MTDLAQWEKENADFLTKIGQVAPAPVAPKPTTKKDEE* |
| Ga0157210_10086804 | 3300012665 | Freshwater | MELIVTDLAQWEKENEAFLIKIGQVAPATPAPKPTTTKKDEE* |
| Ga0157210_10539401 | 3300012665 | Freshwater | MTDLAQWEKENEAFLIKIGQVASKPETKSTKKDEE* |
| Ga0157601_12000193 | 3300012714 | Freshwater | VGANMSEWEKEQEAFLIKIGQAAPSAPKPSTKKDEE* |
| Ga0157605_10128811 | 3300012716 | Freshwater | RVGAKMSEWEKEQEAFLIKIGQAAPSAPKPSTKKDEE* |
| Ga0157604_11983403 | 3300012723 | Freshwater | RVGVKMSEWEKENEAFLIKIGQVTPAVSKPATTKKDEE* |
| Ga0157611_10869021 | 3300012724 | Freshwater | GVKMSEWEKENEAFLIKIGQVAPSVSKPVTTKKDEE* |
| Ga0157602_101568117 | 3300012730 | Freshwater | MSDWEKDNEAFLIKIGQVKETPAAKPVTTKKDEE* |
| Ga0157616_11395273 | 3300012731 | Freshwater | MTDLAQWEKENEAFLTKIGQVASKPETKPTAKKDEE* |
| Ga0159060_10170303 | 3300012990 | Hydrocarbon Resource Environments | MTLEQWEKENEAFLIKIGQIAPATPKPATKKDEE* |
| Ga0164293_100465833 | 3300013004 | Freshwater | MTDLAQWEKENEAFLIKIGQGAPKAETKPTTKKDEE* |
| Ga0164293_105320202 | 3300013004 | Freshwater | MELIVTDLAQWEKENEAFLIKIGQVAPAAPKPTTKKDEE* |
| Ga0164293_105563391 | 3300013004 | Freshwater | IMSDWDKENEAFLIKIGQVKPEAPKPAPTKKDEE* |
| Ga0164294_100937704 | 3300013006 | Freshwater | MTDLAQWEKENEAFLIKIGQVAPKAEAKPSTKKDEE* |
| Ga0164294_101016765 | 3300013006 | Freshwater | RVGVNMSEWEKENEAFLIKIGQVAPTAPKPTPTKKDEE* |
| Ga0164294_109174732 | 3300013006 | Freshwater | GVNMSEWEKENEAFLKKIGQVSTPAPKPVTTKKDEE* |
| Ga0157618_10554081 | 3300013074 | Freshwater | MTDLAQWEKENEAFLIKIGQVASKPETKPTAKKDEE* |
| Ga0170791_152743641 | 3300013295 | Freshwater | PGANMSEWEKENEAFLKKIGQVTSAPKPPSTKKDEE* |
| Ga0177922_100968413 | 3300013372 | Freshwater | MTDLAQWEKENEAFLIKIGQVAPAAAPKPTTKKDEE* |
| Ga0177922_101376283 | 3300013372 | Freshwater | AKMSEWEKEQEAFLIKIGQVAPSTPKPVTTKKDEE* |
| Ga0119960_10754982 | 3300014811 | Aquatic | FPVTIMAEWEKENEAFLIKIGQVAPATHKPAPTKKDEE* |
| Ga0181363_10105421 | 3300017707 | Freshwater Lake | MTDLAQWEKENEAFLTKIGQVASKPETKTTTKKDEE |
| Ga0181347_10742343 | 3300017722 | Freshwater Lake | MELIMTDLAQWEKENEAFLIKIGQVAPAAAPKPTTKKDEE |
| Ga0181347_11337751 | 3300017722 | Freshwater Lake | MTDLAQWEKENEAFLIKIGQVAPAASKPTTKKDEE |
| Ga0181365_10980743 | 3300017736 | Freshwater Lake | GAKMSEWEKEQEAFLIKIGQVAPSTPKPSTKKDEE |
| Ga0181356_10009416 | 3300017761 | Freshwater Lake | MTELEQWEKENEAFLIIIGQVKPSAAKPITKKDEE |
| Ga0181356_10478971 | 3300017761 | Freshwater Lake | MTDMEQWEKENEAFLVKIGQVKPTATKPITKKDEE |
| Ga0181356_10901583 | 3300017761 | Freshwater Lake | IMSDYDKELADFLIKIGQVAPTAPTPKPVTKKDEE |
| Ga0181356_11811862 | 3300017761 | Freshwater Lake | MTDLAQWEKENEAFLIKIGQVAPTAAPKPTTKKDEE |
| Ga0181357_12280382 | 3300017777 | Freshwater Lake | MELIMTDHAQWEKENKAFLIKIGQVAPAAAAPKPTTKKDEE |
| Ga0181357_13115412 | 3300017777 | Freshwater Lake | MELIMTDLAQWEKENEAFLIKIGQVAPAASKPTTKKDEE |
| Ga0181346_13006762 | 3300017780 | Freshwater Lake | YGMELIMTDHAQWEKENKAFLIKIGQVAPAAAAPKPTTKKDEE |
| Ga0181348_10178015 | 3300017784 | Freshwater Lake | MTDHAQWEKENKAFLIKIGQVAPAAAAPKPTTKKDEE |
| Ga0181355_10988953 | 3300017785 | Freshwater Lake | MELIMTDHAQWEKENKAFLIKIGQVAPAPAPKPTTKKDEE |
| Ga0181359_10073315 | 3300019784 | Freshwater Lake | MTDLAQWEKENEAFLIKIGQVAPKAETKPTTKKEEE |
| Ga0181359_10126073 | 3300019784 | Freshwater Lake | MTDLAQWEKENEAFLIKIGQVASKPETKSTKKDEE |
| Ga0181359_10600213 | 3300019784 | Freshwater Lake | MTELEQWEKENEAFLIKIGQVKPSAAKPITKKDEE |
| Ga0207193_10109346 | 3300020048 | Freshwater Lake Sediment | MELEMTDLEQWEKDTEAFLIKVGQVAPATPATPKPTKKDEE |
| Ga0207193_11203215 | 3300020048 | Freshwater Lake Sediment | MTDLAQWEKENEAFLTKIGQVASKPEPKTTTKKDEE |
| Ga0207193_17330072 | 3300020048 | Freshwater Lake Sediment | MDLTMTDLEQWEKDNEAFLIKIGQVKPAAAKPITKKEEE |
| Ga0211729_109038102 | 3300020172 | Freshwater | MSDYDKELEAFLIKIGQVAPTAAPTPKPITKKDEE |
| Ga0211731_107009716 | 3300020205 | Freshwater | MTDLAQWEKENEAFLIKIGQVAPKAEAKPSTKKDEE |
| Ga0208091_10145263 | 3300020506 | Freshwater | MSDYDKELEAFLIKIGQAAPTAAPTPKLATKKDEE |
| Ga0208722_10529712 | 3300020537 | Freshwater | ELELIMSEWEKEQEAFLIKIGQVAPTAPKPSTKKDEE |
| Ga0213920_10011286 | 3300021438 | Freshwater | MRDADQFNYELELKTMNEWEKEQEAFLIKVGQIAPAATKPSTKKDEE |
| Ga0213920_10066375 | 3300021438 | Freshwater | MTDMELWEKENEAFLAKIGQVKQTVTKTATTKKDEE |
| Ga0213920_10943421 | 3300021438 | Freshwater | MTDMELWEKENEAFLIKIGQVKQSAPKPTSTKKDEE |
| Ga0222713_102939132 | 3300021962 | Estuarine Water | MTDMAQWEKENEAFLIKIGQGAPKAEAKPTTKKDEE |
| Ga0222712_107234492 | 3300021963 | Estuarine Water | MTDLAQWEKDNEAFLTKIGQVASKPETKTTTKKDEE |
| Ga0181353_10529243 | 3300022179 | Freshwater Lake | MTDLAQWEKENEAFLIKIGQVASKPETKPATKKDEE |
| Ga0181354_10326075 | 3300022190 | Freshwater Lake | IIMSDYDKELEAFLIKVGQIQPVAPAPKPATKKDEE |
| Ga0181351_11131512 | 3300022407 | Freshwater Lake | MTDIEQWEKENEAFLVKIGQVKPTATKPITKKDEE |
| Ga0212119_10859822 | 3300022543 | Freshwater | IMTELEQWEKENEAFLIKIGQVKPVASKPLTKKEEE |
| Ga0214921_100068088 | 3300023174 | Freshwater | MTDLAQWEKENEAFLIKIGQVAPKAEARPTTKKDEE |
| Ga0214919_101971153 | 3300023184 | Freshwater | MTDLAQWEKENAAFLIKIGQVAPKAEAKPTTKKDEE |
| Ga0244775_100238773 | 3300024346 | Estuarine | MTELEQWEKENEAFLIKIGQVKPVAAKPATKKDEE |
| Ga0244775_115396202 | 3300024346 | Estuarine | MTDLAQWEKENEAFLIKIGQVAPVTAPKPTTKKDEE |
| Ga0209615_1007895 | 3300025075 | Freshwater | MTDMAQWEKENEAFLIRIGQVKPAAKPVTTKKDEE |
| Ga0208303_10333244 | 3300025543 | Aqueous | MSDWEKENEAFLIKIGQTPAPATPAAPKTTPKKDEE |
| Ga0208147_11171152 | 3300025635 | Aqueous | MTDLAEWEKENDAFLIRIGQKAPAQATKPTAKKDEE |
| Ga0208160_10721272 | 3300025647 | Aqueous | MSDWEKENEAFLIKIGQVKPAAQAAPKPVTKKEEE |
| Ga0208005_11909942 | 3300025848 | Aqueous | MTDLAQWEKENEAFLIKIGQVETKQTKPTTKKDEE |
| Ga0208644_10052664 | 3300025889 | Aqueous | MSDYEKELEAFLIKIGQTPAPATPAAPKTTPKKDEE |
| Ga0208916_102177301 | 3300025896 | Aqueous | MTDMEQWEKENEAFLAKIGQVKQSAPKPPSTKKDEE |
| Ga0255105_10549161 | 3300027143 | Freshwater | VKMTLNEWEKENEAFLIKIGQIAPAAPKPATKKDEE |
| Ga0255131_10692962 | 3300027285 | Freshwater | MTDLAQWEKENEAFLIKIGQGAPKAEAKPTPKKDEE |
| Ga0209300_10109782 | 3300027365 | Deep Subsurface | MTDLAQWEKENEAFLIKIGQVASKPETKPTKKEEE |
| Ga0208966_11688352 | 3300027586 | Freshwater Lentic | MELIMTDHAQWEKENKAFLIKIGQVAPAAAPKPTTKKDEE |
| Ga0209392_10535631 | 3300027683 | Freshwater Sediment | MTDMEQWEKENEAFLIKIGQVKPAAPKPATTKKDEE |
| Ga0209492_10251984 | 3300027721 | Freshwater Sediment | MGVDMTLEQWEKDNEAFLIKIGQIRPAAPKPATKKDEE |
| Ga0209492_11286683 | 3300027721 | Freshwater Sediment | MTDLAQWEKENEAFLIKIGQVASKPEPKTTTKKDEE |
| (restricted) Ga0247836_11560972 | 3300027728 | Freshwater | MTELEQWEKENEAFLIKIGQGKPAAAKPITKKDEE |
| Ga0209297_12182452 | 3300027733 | Freshwater Lake | MTDLAQWEKDNEAFLIKIGQVASKAEPKPTTKKDEE |
| Ga0209297_13432471 | 3300027733 | Freshwater Lake | MGITMTDMAQWEKENEAFLIKIGQVKPAAPKPVTKKEEE |
| Ga0209087_10012926 | 3300027734 | Freshwater Lake | MTDMAQWEKENEAFLIKIGQVKPAAPKPVTKKEEE |
| Ga0209087_10846224 | 3300027734 | Freshwater Lake | MTDLAQWEKENEAFLIKIGQVVPKAETKPTTKKDEE |
| Ga0209087_11409522 | 3300027734 | Freshwater Lake | MGVTMTDLGQWEKENEAFLIKIGQVAKETPKPVTTKKDEE |
| Ga0209596_12268072 | 3300027754 | Freshwater Lake | MTDLAQWEKENEAFLIKIGQVAPKTETKPTPKKDEE |
| Ga0209296_100120728 | 3300027759 | Freshwater Lake | MTDMDQWNKENNDFLALIGQVTKSIPKPITTKKDEE |
| Ga0209296_13374912 | 3300027759 | Freshwater Lake | MTDLGQWEKENEAFLIKIGQVAKETPKPVTTKKDEE |
| Ga0209288_102538482 | 3300027762 | Freshwater Sediment | MSDWDKENEAFLKKIGQVKPSTPAPKPVTTTKDEE |
| Ga0209088_100083347 | 3300027763 | Freshwater Lake | MTDLAQWEKENEAFLIKIGQVAPKAETKPSNKKDEE |
| Ga0209088_100997202 | 3300027763 | Freshwater Lake | MIMTDLAQWEKENEAFLIKIGQVAPKAETKPTPKKDEE |
| Ga0209134_100436701 | 3300027764 | Freshwater Lake | MTELAQWEKENEEFLIKIGQVKPAAAKPSTKKDEE |
| Ga0209134_102976611 | 3300027764 | Freshwater Lake | LVVTDLAQWEKENEAFLIKIGQVASKPETKPTAKKEEE |
| Ga0209770_100660303 | 3300027769 | Freshwater Lake | MTDMEQWEKENEAFLAKIGQVKQAVSKPASTKKDEE |
| Ga0209500_100099331 | 3300027782 | Freshwater Lake | MTDLAQWEKENADFLTKIGQVDSAPAAPKPTTKKDEE |
| Ga0209500_100947974 | 3300027782 | Freshwater Lake | MTDLAQWEKENADFLTKIGQVDSAPAAPKPTTKKDE |
| Ga0209500_103154011 | 3300027782 | Freshwater Lake | MDMIMTDLAQWEKENEAFLIKIGQVAPKSETKPTPK |
| Ga0209246_101688683 | 3300027785 | Freshwater Lake | ANMSEWEKERDAFLIKIGQVAPSATKPVTTKKDEE |
| Ga0209246_102780223 | 3300027785 | Freshwater Lake | AGANMSEWEKERDAFLIKIGQVAPTAPKPVTTKKDEE |
| Ga0209972_1000242821 | 3300027793 | Freshwater Lake | MTDMEQWNKENDAFLALIGQVAKATPKPVSKKDEE |
| Ga0209353_104419982 | 3300027798 | Freshwater Lake | MSDWEKENEAFLIKIGQVAPTAAPTPKPVTKKDEE |
| Ga0209354_102080922 | 3300027808 | Freshwater Lake | MTDLAQWEKENEAFLIKIGQVAPAAPKPTTKKDEE |
| Ga0209354_103491452 | 3300027808 | Freshwater Lake | MTELAQWEKENEEFLIKIGQVKPAAAKPLTKKDEE |
| Ga0209401_10565754 | 3300027971 | Freshwater Lake | MTDMEQWEKENKAFLALIGQVEKVAPKPTPTKKDEE |
| Ga0209401_11964461 | 3300027971 | Freshwater Lake | GANMSEWEKERDAFLIKIGQVAPSAPKPVTTKKDEE |
| Ga0209298_102607142 | 3300027973 | Freshwater Lake | MDMIMTDLAQWEKENEAFLIKIGQVAPKAETKPTPKKDEE |
| Ga0247723_10024591 | 3300028025 | Deep Subsurface Sediment | MTDLAQWEKENEAFLIKIGQVASKPEPKTTTKKEEE |
| Ga0247723_10452693 | 3300028025 | Deep Subsurface Sediment | MTDMEQWNKENDAFLALIGQVAKATPKPVTTKKDEE |
| Ga0247723_10491633 | 3300028025 | Deep Subsurface Sediment | MGVEMTLEEWEKENEAFLIKIGQIAPAAPKTATKKDEE |
| Ga0247723_10707332 | 3300028025 | Deep Subsurface Sediment | MTDMEQWNKENDAFLALIGQVAKATPKPVTKKEEE |
| Ga0247723_11094472 | 3300028025 | Deep Subsurface Sediment | MNMTDYDKELEAFLIKIGQIAPVTAPTPKPVTKKDEE |
| Ga0247723_11591082 | 3300028025 | Deep Subsurface Sediment | MTELEQWEKENEEFLIKIGQVKPAAAKPLNKKDEE |
| (restricted) Ga0247843_101259113 | 3300028569 | Freshwater | MELIMTDLAQWEKENEAFLIKIGQVAPAAPKPTTKKDEE |
| (restricted) Ga0247842_103095502 | 3300029268 | Freshwater | MTELEQWEKENEAFLIKIGQGKLAAAKPITKKDEE |
| Ga0315899_109569562 | 3300031784 | Freshwater | MTMTDYDKELEAFLIKIGQVEPKATPKPATKKDEE |
| Ga0315908_100183637 | 3300031786 | Freshwater | MGVTMTDLAQWEKDTEAFLIKIGQVKPAAAKPITKKEE |
| Ga0315900_100249331 | 3300031787 | Freshwater | MSDYDKELEAFLIKIGQAAPTPAPTPKPATKKDEE |
| Ga0315909_104587523 | 3300031857 | Freshwater | MTDMEQWEKENEAFLIKIGQVKPAAAKPTTKKDEE |
| Ga0315904_100429786 | 3300031951 | Freshwater | MGVTMTDLAQWEKDTEAFLIKIGQVKPAAAKPITKKEEE |
| Ga0315904_110667602 | 3300031951 | Freshwater | MTELEQWEKENEAFLIKIGQVKPATPKPVTKKEEE |
| Ga0315902_104061623 | 3300032093 | Freshwater | MTLEEWEKENDAFLIRIGQKPSTPAAKPATKKDEE |
| Ga0315903_103104953 | 3300032116 | Freshwater | MTDLEQWEKENEAFLIKIGQVKPAAAKPLTKKDEE |
| Ga0315903_104425041 | 3300032116 | Freshwater | MELIMTDLAQWEKENEAFLIRIGQVKPAAKPVTTKKDEE |
| Ga0334981_0362610_376_483 | 3300033980 | Freshwater | MTELEQWEKENEAFLIKIGQVKPVAAKPITKKDEE |
| Ga0334982_0002392_4626_4745 | 3300033981 | Freshwater | MDLTMTDLEQWEKENEAFLIKIGQVKPAAAKPLTKKDEE |
| Ga0334986_0126578_622_732 | 3300034012 | Freshwater | MTDLAQWERENEAFLIKIGQVAPKPEAKPTTKKEEE |
| Ga0334986_0264894_37_144 | 3300034012 | Freshwater | MTELAQWETENEAFLIKIGQVKPAAAKPLNKKDEE |
| Ga0334987_0100668_1644_1754 | 3300034061 | Freshwater | MGVIMSEWEKEQEAFLIKIGQVAPTAPKPSTKKDEE |
| Ga0334987_0448533_216_335 | 3300034061 | Freshwater | MDITMTDLEQWEKENEAFLIKIGQVKPAAAKPLTKKDEE |
| Ga0334987_0629940_426_533 | 3300034061 | Freshwater | MTELEQWEKENEAFLIKIGQVKPLAAKPVTKKDEE |
| Ga0334995_0089230_460_570 | 3300034062 | Freshwater | MGVIMSEWEKEQEAFLIKIGQVAPAAPKPSTKKDEE |
| Ga0335000_0404855_269_376 | 3300034063 | Freshwater | MTDMAQWEKENEAFLIKIGQGKPAAPKPVTKKEEE |
| Ga0335027_0002909_4652_4759 | 3300034101 | Freshwater | MSDWDIENEAFLKKIGQVKPAAPAPKPVTTTKDEE |
| Ga0335027_0291972_361_480 | 3300034101 | Freshwater | MDLTMTDLEQWEKDNEAFLIKIGQVKPAAAKPLTKKDEE |
| Ga0335031_0035046_2962_3081 | 3300034104 | Freshwater | MDLTMTDLEQWEKENEAFLIKIGQVKPAAAKPITKKDEE |
| Ga0335031_0842124_273_392 | 3300034104 | Freshwater | MDITMTDLEQWEKENEAFLIKIGQVKPAAAKPITKKDEE |
| Ga0335036_0002871_9574_9684 | 3300034106 | Freshwater | MTDMEQWEKDNEAFLAKIGQVKQAAPKPTSTKKDEE |
| Ga0335036_0042376_525_644 | 3300034106 | Freshwater | MGITMTDMAQWEKENEAFLIRIGQVKPAAPKPVTKKEEE |
| Ga0335063_0609005_257_364 | 3300034111 | Freshwater | MTELEQWEKENEAFLIKIGQVKPAANKPVTKKDEE |
| Ga0335054_0078156_437_544 | 3300034119 | Freshwater | MTELEQWEKENEAFLIKIGQVKPVASKPLTKKEEE |
| Ga0335058_0002150_6164_6271 | 3300034121 | Freshwater | MTELEQWEKENEAFLIKIGQVKPVAFKPVTKKDEE |
| Ga0335061_0043663_1550_1660 | 3300034168 | Freshwater | MTDMEQWEKDNKAFLIKIGQVVTPAPKPVTTKKDEE |
| ⦗Top⦘ |