NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F012823

Metagenome Family F012823

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F012823
Family Type Metagenome
Number of Sequences 277
Average Sequence Length 49 residues
Representative Sequence DSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA
Number of Associated Samples 208
Number of Associated Scaffolds 277

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 7.64 %
% of genes near scaffold ends (potentially truncated) 90.25 %
% of genes from short scaffolds (< 2000 bps) 88.09 %
Associated GOLD sequencing projects 189
AlphaFold2 3D model prediction Yes
3D model pTM-score0.61

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.755 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(10.108 % of family members)
Environment Ontology (ENVO) Unclassified
(33.213 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(48.736 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.54%    β-sheet: 2.70%    Coil/Unstructured: 56.76%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.61
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 277 Family Scaffolds
PF03601Cons_hypoth698 4.69
PF10503Esterase_PHB 3.97
PF07369DUF1488 1.44
PF07883Cupin_2 0.72
PF03330DPBB_1 0.72
PF08714Fae 0.72
PF00982Glyco_transf_20 0.72
PF00581Rhodanese 0.72
PF11752DUF3309 0.72
PF13561adh_short_C2 0.72
PF01804Penicil_amidase 0.72
PF03358FMN_red 0.36
PF08282Hydrolase_3 0.36
PF13384HTH_23 0.36
PF14023DUF4239 0.36
PF00691OmpA 0.36
PF13683rve_3 0.36
PF03411Peptidase_M74 0.36
PF08240ADH_N 0.36
PF04366Ysc84 0.36
PF07311Dodecin 0.36
PF00709Adenylsucc_synt 0.36
PF01545Cation_efflux 0.36
PF12833HTH_18 0.36
PF00239Resolvase 0.36
PF09361Phasin_2 0.36
PF00589Phage_integrase 0.36
PF01471PG_binding_1 0.36
PF09335SNARE_assoc 0.36
PF13643DUF4145 0.36
PF02586SRAP 0.36
PF01472PUA 0.36
PF00440TetR_N 0.36
PF02602HEM4 0.36
PF00571CBS 0.36
PF02909TetR_C_1 0.36
PF01384PHO4 0.36
PF13432TPR_16 0.36

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 277 Family Scaffolds
COG2855Uncharacterized membrane protein YadS, UPF0324 familyFunction unknown [S] 4.69
COG0380Trehalose-6-phosphate synthase, GT20 familyCarbohydrate transport and metabolism [G] 0.72
COG2366Acyl-homoserine lactone (AHL) acylase PvdQSecondary metabolites biosynthesis, transport and catabolism [Q] 0.72
COG1795Formaldehyde-activating enzyme (5,6,7,8-tetrahydromethanopterin hydrolyase)Energy production and conversion [C] 0.72
COG3965Predicted Co/Zn/Cd cation transporter, cation efflux familyInorganic ion transport and metabolism [P] 0.36
COG0053Divalent metal cation (Fe/Co/Zn/Cd) efflux pumpInorganic ion transport and metabolism [P] 0.36
COG3770Murein endopeptidase MepA (D-alanyl-D-alanine-endopeptidase)Cell wall/membrane/envelope biogenesis [M] 0.36
COG3769Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamilyCarbohydrate transport and metabolism [G] 0.36
COG3360Flavin-binding protein dodecinGeneral function prediction only [R] 0.36
COG2930Lipid-binding SYLF domain, Ysc84/FYVE familyLipid transport and metabolism [I] 0.36
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.36
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 0.36
COG2135ssDNA abasic site-binding protein YedK/HMCES, SRAP familyReplication, recombination and repair [L] 0.36
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.36
COG1877Trehalose-6-phosphate phosphataseCarbohydrate transport and metabolism [G] 0.36
COG1587Uroporphyrinogen-III synthaseCoenzyme transport and metabolism [H] 0.36
COG1309DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmATranscription [K] 0.36
COG1238Uncharacterized membrane protein YqaA, VTT domainFunction unknown [S] 0.36
COG1230Co/Zn/Cd efflux system componentInorganic ion transport and metabolism [P] 0.36
COG0586Membrane integrity protein DedA, putative transporter, DedA/Tvp38 familyCell wall/membrane/envelope biogenesis [M] 0.36
COG0561Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatasesCoenzyme transport and metabolism [H] 0.36
COG0560Phosphoserine phosphataseAmino acid transport and metabolism [E] 0.36
COG0398Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 familyFunction unknown [S] 0.36
COG0306Phosphate/sulfate permeaseInorganic ion transport and metabolism [P] 0.36
COG0104Adenylosuccinate synthaseNucleotide transport and metabolism [F] 0.36


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.75 %
UnclassifiedrootN/A16.25 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000787|JGI11643J11755_11364233Not Available631Open in IMG/M
3300000787|JGI11643J11755_11540903Not Available567Open in IMG/M
3300000789|JGI1027J11758_12581108Not Available606Open in IMG/M
3300000789|JGI1027J11758_12831007All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium625Open in IMG/M
3300000890|JGI11643J12802_11206908All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium941Open in IMG/M
3300000955|JGI1027J12803_101456634All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium855Open in IMG/M
3300000956|JGI10216J12902_115837155All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium528Open in IMG/M
3300001431|F14TB_102252649All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium510Open in IMG/M
3300001536|A1565W1_10782035All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium560Open in IMG/M
3300001537|A2065W1_10046870All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1683Open in IMG/M
3300001537|A2065W1_11673040All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium623Open in IMG/M
3300002124|C687J26631_10326817All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium506Open in IMG/M
3300002503|C687J35164_10160022All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium649Open in IMG/M
3300003994|Ga0055435_10021133All Organisms → cellular organisms → Bacteria1380Open in IMG/M
3300003997|Ga0055466_10157622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium652Open in IMG/M
3300004062|Ga0055500_10141838All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium563Open in IMG/M
3300004156|Ga0062589_100306140All Organisms → cellular organisms → Bacteria1232Open in IMG/M
3300004157|Ga0062590_102480827All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium549Open in IMG/M
3300004463|Ga0063356_102382556Not Available809Open in IMG/M
3300004463|Ga0063356_103969942All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium637Open in IMG/M
3300004479|Ga0062595_101025841All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium712Open in IMG/M
3300004479|Ga0062595_102109884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium549Open in IMG/M
3300004480|Ga0062592_102073950All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium564Open in IMG/M
3300004481|Ga0069718_15610022All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300004643|Ga0062591_102573843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium536Open in IMG/M
3300005093|Ga0062594_102416061All Organisms → cellular organisms → Bacteria → Proteobacteria575Open in IMG/M
3300005295|Ga0065707_10278248All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1053Open in IMG/M
3300005329|Ga0070683_102080003Not Available545Open in IMG/M
3300005330|Ga0070690_100306871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1139Open in IMG/M
3300005330|Ga0070690_100853197All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium710Open in IMG/M
3300005331|Ga0070670_100035681All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium4280Open in IMG/M
3300005331|Ga0070670_100820463All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium841Open in IMG/M
3300005337|Ga0070682_100119833All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1765Open in IMG/M
3300005337|Ga0070682_100489897All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium950Open in IMG/M
3300005339|Ga0070660_100007762All Organisms → cellular organisms → Bacteria → Proteobacteria7482Open in IMG/M
3300005343|Ga0070687_100198279All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1214Open in IMG/M
3300005343|Ga0070687_101207319All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium558Open in IMG/M
3300005344|Ga0070661_100009705All Organisms → cellular organisms → Bacteria → Proteobacteria6676Open in IMG/M
3300005344|Ga0070661_100856010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium748Open in IMG/M
3300005354|Ga0070675_100031386All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae4295Open in IMG/M
3300005355|Ga0070671_101820496All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium541Open in IMG/M
3300005365|Ga0070688_100016304All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium4245Open in IMG/M
3300005366|Ga0070659_100847760All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium796Open in IMG/M
3300005366|Ga0070659_102059665All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium513Open in IMG/M
3300005367|Ga0070667_101599195All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium612Open in IMG/M
3300005441|Ga0070700_101901785All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium514Open in IMG/M
3300005444|Ga0070694_101224038All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium630Open in IMG/M
3300005457|Ga0070662_100737106All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium835Open in IMG/M
3300005457|Ga0070662_101517502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Deinococcales → Deinococcaceae → Deinococcus → Deinococcus roseus578Open in IMG/M
3300005458|Ga0070681_10750291All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium892Open in IMG/M
3300005536|Ga0070697_101694470All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium565Open in IMG/M
3300005546|Ga0070696_100480147Not Available985Open in IMG/M
3300005546|Ga0070696_101775980All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium533Open in IMG/M
3300005548|Ga0070665_100165403All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium2214Open in IMG/M
3300005549|Ga0070704_100090565All Organisms → cellular organisms → Bacteria2278Open in IMG/M
3300005563|Ga0068855_101873424Not Available608Open in IMG/M
3300005577|Ga0068857_100756996All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium925Open in IMG/M
3300005614|Ga0068856_101514299All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium684Open in IMG/M
3300005614|Ga0068856_101754784All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium633Open in IMG/M
3300005764|Ga0066903_101458273All Organisms → cellular organisms → Bacteria1289Open in IMG/M
3300005764|Ga0066903_103374310All Organisms → cellular organisms → Bacteria → Proteobacteria862Open in IMG/M
3300005843|Ga0068860_100900857All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium900Open in IMG/M
3300006047|Ga0075024_100655592All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium571Open in IMG/M
3300006052|Ga0075029_100629251Not Available719Open in IMG/M
3300006058|Ga0075432_10120070All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium987Open in IMG/M
3300006163|Ga0070715_10626565Not Available634Open in IMG/M
3300006175|Ga0070712_101003031All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium722Open in IMG/M
3300006175|Ga0070712_101470682All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium595Open in IMG/M
3300006358|Ga0068871_102020302All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium549Open in IMG/M
3300006755|Ga0079222_10413543All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium945Open in IMG/M
3300006844|Ga0075428_101102046All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium839Open in IMG/M
3300006903|Ga0075426_10431455All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium974Open in IMG/M
3300006904|Ga0075424_100145194All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium2513Open in IMG/M
3300006904|Ga0075424_100650507All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1125Open in IMG/M
3300006904|Ga0075424_101160311Not Available823Open in IMG/M
3300006904|Ga0075424_102071852All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium600Open in IMG/M
3300007004|Ga0079218_11800274All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium686Open in IMG/M
3300007076|Ga0075435_100775365All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium834Open in IMG/M
3300007076|Ga0075435_102024048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium506Open in IMG/M
3300009053|Ga0105095_10356536Not Available806Open in IMG/M
3300009094|Ga0111539_10184900All Organisms → cellular organisms → Bacteria2434Open in IMG/M
3300009094|Ga0111539_10500210All Organisms → cellular organisms → Bacteria1416Open in IMG/M
3300009094|Ga0111539_12262656Not Available631Open in IMG/M
3300009101|Ga0105247_10055647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae2441Open in IMG/M
3300009101|Ga0105247_10954630Not Available666Open in IMG/M
3300009146|Ga0105091_10139713All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1131Open in IMG/M
3300009147|Ga0114129_10711863All Organisms → cellular organisms → Bacteria1289Open in IMG/M
3300009147|Ga0114129_10721401Not Available1279Open in IMG/M
3300009147|Ga0114129_13147143All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium538Open in IMG/M
3300009156|Ga0111538_10642000All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1346Open in IMG/M
3300009162|Ga0075423_10859363All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300009162|Ga0075423_11869575All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium648Open in IMG/M
3300009545|Ga0105237_12620429All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium515Open in IMG/M
3300009551|Ga0105238_10580368All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1127Open in IMG/M
3300009553|Ga0105249_10339878All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1518Open in IMG/M
3300009700|Ga0116217_10140564All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1619Open in IMG/M
3300009811|Ga0105084_1040671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium811Open in IMG/M
3300009811|Ga0105084_1055018All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium708Open in IMG/M
3300009815|Ga0105070_1123284All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium522Open in IMG/M
3300009820|Ga0105085_1097244All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium573Open in IMG/M
3300009824|Ga0116219_10000569All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi38264Open in IMG/M
3300009839|Ga0116223_10002308All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria18149Open in IMG/M
3300009839|Ga0116223_10159275All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1398Open in IMG/M
3300010371|Ga0134125_10498581All Organisms → cellular organisms → Bacteria → Proteobacteria1349Open in IMG/M
3300010371|Ga0134125_11646322All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium698Open in IMG/M
3300010373|Ga0134128_10084502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium3620Open in IMG/M
3300010373|Ga0134128_10619327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1204Open in IMG/M
3300010373|Ga0134128_11038315All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium906Open in IMG/M
3300010373|Ga0134128_11439529All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium759Open in IMG/M
3300010375|Ga0105239_10476293Not Available1418Open in IMG/M
3300010375|Ga0105239_11488296Not Available782Open in IMG/M
3300010396|Ga0134126_10768693All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1091Open in IMG/M
3300010397|Ga0134124_10468403All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1213Open in IMG/M
3300010397|Ga0134124_10674234All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1021Open in IMG/M
3300010397|Ga0134124_12051994All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria609Open in IMG/M
3300010399|Ga0134127_10329404All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1483Open in IMG/M
3300010400|Ga0134122_11935834All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium626Open in IMG/M
3300010401|Ga0134121_10045181All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium3606Open in IMG/M
3300010401|Ga0134121_11141091All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium775Open in IMG/M
3300010401|Ga0134121_12067655All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium603Open in IMG/M
3300011119|Ga0105246_10691514All Organisms → cellular organisms → Bacteria → Proteobacteria893Open in IMG/M
3300011119|Ga0105246_11065685All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium736Open in IMG/M
3300011991|Ga0120153_1027078All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1218Open in IMG/M
3300012019|Ga0120139_1088710All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium768Open in IMG/M
3300012358|Ga0137368_10644535All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium670Open in IMG/M
3300012360|Ga0137375_11475119All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria501Open in IMG/M
3300012361|Ga0137360_10914818All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium756Open in IMG/M
3300012895|Ga0157309_10249782All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium578Open in IMG/M
3300012906|Ga0157295_10402442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium511Open in IMG/M
3300012907|Ga0157283_10153253All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium682Open in IMG/M
3300012909|Ga0157290_10272806All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium611Open in IMG/M
3300012911|Ga0157301_10300900All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium585Open in IMG/M
3300012915|Ga0157302_10418155All Organisms → cellular organisms → Bacteria → Proteobacteria558Open in IMG/M
3300012915|Ga0157302_10443715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium547Open in IMG/M
3300012931|Ga0153915_10037240All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4920Open in IMG/M
3300012957|Ga0164303_10620746Not Available715Open in IMG/M
3300012958|Ga0164299_10362394All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium917Open in IMG/M
3300012961|Ga0164302_10991258All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300012984|Ga0164309_10718115All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300012984|Ga0164309_11112328All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium658Open in IMG/M
3300012984|Ga0164309_11876984All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium514Open in IMG/M
3300012989|Ga0164305_11605066Not Available581Open in IMG/M
3300012989|Ga0164305_12054243All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium523Open in IMG/M
3300013100|Ga0157373_10383200All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1006Open in IMG/M
3300013296|Ga0157374_11220971Not Available773Open in IMG/M
3300013297|Ga0157378_10034294All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4488Open in IMG/M
3300013306|Ga0163162_10439217All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1437Open in IMG/M
3300013307|Ga0157372_12990952Not Available540Open in IMG/M
3300013308|Ga0157375_10051179All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4055Open in IMG/M
3300013308|Ga0157375_11628086All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300013758|Ga0120147_1049431All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria738Open in IMG/M
3300014324|Ga0075352_1154985All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium647Open in IMG/M
3300014325|Ga0163163_10085860All Organisms → cellular organisms → Bacteria3155Open in IMG/M
3300014325|Ga0163163_10295996All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1671Open in IMG/M
3300014325|Ga0163163_11255376All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales803Open in IMG/M
3300014325|Ga0163163_12751188Not Available549Open in IMG/M
3300014326|Ga0157380_12328202All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium600Open in IMG/M
3300014823|Ga0120170_1066060All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium774Open in IMG/M
3300014968|Ga0157379_10322168Not Available1411Open in IMG/M
3300014968|Ga0157379_10665079All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium976Open in IMG/M
3300014968|Ga0157379_11935197All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium582Open in IMG/M
3300015077|Ga0173483_10090872All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1253Open in IMG/M
3300015371|Ga0132258_10166720All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5305Open in IMG/M
3300015371|Ga0132258_11455800Not Available1730Open in IMG/M
3300015372|Ga0132256_101088953All Organisms → cellular organisms → Bacteria → Proteobacteria913Open in IMG/M
3300015372|Ga0132256_103426440Not Available533Open in IMG/M
3300015373|Ga0132257_103362184Not Available582Open in IMG/M
3300015374|Ga0132255_101628662All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium978Open in IMG/M
3300016270|Ga0182036_10549594Not Available920Open in IMG/M
3300016357|Ga0182032_10106604All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1991Open in IMG/M
3300016371|Ga0182034_10974685All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales731Open in IMG/M
3300016387|Ga0182040_11153773All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium650Open in IMG/M
3300016404|Ga0182037_10067991All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium2453Open in IMG/M
3300017792|Ga0163161_12058297All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium508Open in IMG/M
3300017947|Ga0187785_10165498All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium940Open in IMG/M
3300017959|Ga0187779_11123023All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium550Open in IMG/M
3300017999|Ga0187767_10030268All Organisms → cellular organisms → Bacteria1238Open in IMG/M
3300018028|Ga0184608_10164463Not Available962Open in IMG/M
3300018056|Ga0184623_10188035All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium951Open in IMG/M
3300018058|Ga0187766_10905146Not Available623Open in IMG/M
3300018063|Ga0184637_10672878All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium571Open in IMG/M
3300018076|Ga0184609_10255722Not Available819Open in IMG/M
3300018089|Ga0187774_11190606All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium545Open in IMG/M
3300018465|Ga0190269_11074920All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium617Open in IMG/M
3300018481|Ga0190271_10657663All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1169Open in IMG/M
3300019356|Ga0173481_10289128All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium757Open in IMG/M
3300019356|Ga0173481_10336070All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium716Open in IMG/M
3300019361|Ga0173482_10168533All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales870Open in IMG/M
3300023263|Ga0247800_1062893All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium698Open in IMG/M
3300024433|Ga0209986_10539092All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium508Open in IMG/M
3300025002|Ga0209001_1084165All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium501Open in IMG/M
3300025165|Ga0209108_10291424All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium821Open in IMG/M
3300025322|Ga0209641_10499741All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales862Open in IMG/M
3300025324|Ga0209640_10064538All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter3169Open in IMG/M
3300025325|Ga0209341_11038917All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium598Open in IMG/M
3300025326|Ga0209342_11124039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium587Open in IMG/M
3300025327|Ga0209751_10487764All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1009Open in IMG/M
3300025551|Ga0210131_1040621All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium735Open in IMG/M
3300025899|Ga0207642_10137957Not Available1282Open in IMG/M
3300025901|Ga0207688_10137559All Organisms → cellular organisms → Bacteria1436Open in IMG/M
3300025901|Ga0207688_10376163All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300025901|Ga0207688_10613687All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium686Open in IMG/M
3300025904|Ga0207647_10023576All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4069Open in IMG/M
3300025905|Ga0207685_10012519All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2592Open in IMG/M
3300025906|Ga0207699_10149935All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1542Open in IMG/M
3300025906|Ga0207699_11239473All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium552Open in IMG/M
3300025907|Ga0207645_10231267All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1220Open in IMG/M
3300025915|Ga0207693_10528882All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium920Open in IMG/M
3300025915|Ga0207693_10803889All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium725Open in IMG/M
3300025916|Ga0207663_10124900All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1768Open in IMG/M
3300025918|Ga0207662_10025439All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3409Open in IMG/M
3300025919|Ga0207657_10149402Not Available1904Open in IMG/M
3300025920|Ga0207649_10792624All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium739Open in IMG/M
3300025920|Ga0207649_11001902Not Available657Open in IMG/M
3300025923|Ga0207681_10281306All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae1310Open in IMG/M
3300025923|Ga0207681_10448360All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1049Open in IMG/M
3300025925|Ga0207650_10296458All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1319Open in IMG/M
3300025929|Ga0207664_10183557All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1797Open in IMG/M
3300025931|Ga0207644_10057980All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2797Open in IMG/M
3300025932|Ga0207690_10050683All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2772Open in IMG/M
3300025936|Ga0207670_10989637All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium707Open in IMG/M
3300025938|Ga0207704_10017320All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium3730Open in IMG/M
3300025939|Ga0207665_11009929All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium662Open in IMG/M
3300025940|Ga0207691_10130450All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2221Open in IMG/M
3300025945|Ga0207679_10913270All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium803Open in IMG/M
3300025949|Ga0207667_10719560All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium999Open in IMG/M
3300025949|Ga0207667_11470664Not Available653Open in IMG/M
3300025949|Ga0207667_12058236Not Available530Open in IMG/M
3300025961|Ga0207712_10320419All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1279Open in IMG/M
3300025961|Ga0207712_10384601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1175Open in IMG/M
3300025981|Ga0207640_10361043All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1170Open in IMG/M
3300025986|Ga0207658_10076699All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium2547Open in IMG/M
3300026088|Ga0207641_10376391All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1359Open in IMG/M
3300026089|Ga0207648_10469562All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1148Open in IMG/M
3300026142|Ga0207698_12179630All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium567Open in IMG/M
3300027056|Ga0209879_1046731All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium707Open in IMG/M
3300027854|Ga0209517_10137382All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1583Open in IMG/M
3300027909|Ga0209382_11688400All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium622Open in IMG/M
3300027952|Ga0209889_1033908All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1106Open in IMG/M
3300027957|Ga0209857_1031522All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter975Open in IMG/M
3300028380|Ga0268265_10482721All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1164Open in IMG/M
3300028889|Ga0247827_11334909Not Available503Open in IMG/M
3300030006|Ga0299907_10537527All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium918Open in IMG/M
3300030006|Ga0299907_10973825All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium625Open in IMG/M
3300030006|Ga0299907_11121993Not Available570Open in IMG/M
3300030114|Ga0311333_11299628Not Available623Open in IMG/M
3300030606|Ga0299906_10351098All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1146Open in IMG/M
3300030613|Ga0299915_10065598All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter2676Open in IMG/M
3300030620|Ga0302046_10987429All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium670Open in IMG/M
3300030659|Ga0316363_10003780All Organisms → cellular organisms → Bacteria10677Open in IMG/M
3300030707|Ga0310038_10066905All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1967Open in IMG/M
3300031170|Ga0307498_10047101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1149Open in IMG/M
3300031562|Ga0310886_11043634All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium525Open in IMG/M
3300031668|Ga0318542_10409287All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium701Open in IMG/M
3300031679|Ga0318561_10479358All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium685Open in IMG/M
3300031726|Ga0302321_100419047All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloligella → Methyloligella halotolerans1462Open in IMG/M
3300031740|Ga0307468_100615819All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria890Open in IMG/M
3300031740|Ga0307468_101975820Not Available558Open in IMG/M
3300031781|Ga0318547_10206749All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1174Open in IMG/M
3300031796|Ga0318576_10629390Not Available505Open in IMG/M
3300031833|Ga0310917_10216125Not Available1284Open in IMG/M
3300031833|Ga0310917_10274683All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1137Open in IMG/M
3300031847|Ga0310907_10062300All Organisms → cellular organisms → Bacteria1491Open in IMG/M
3300031940|Ga0310901_10046525All Organisms → cellular organisms → Bacteria1403Open in IMG/M
3300032000|Ga0310903_10458426Not Available659Open in IMG/M
3300032017|Ga0310899_10506231All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300032075|Ga0310890_10347387All Organisms → cellular organisms → Bacteria1083Open in IMG/M
3300032205|Ga0307472_100491931All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1055Open in IMG/M
3300032205|Ga0307472_101613110Not Available638Open in IMG/M
3300032205|Ga0307472_101974938All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium584Open in IMG/M
3300032261|Ga0306920_103069569Not Available628Open in IMG/M
3300032782|Ga0335082_10609659All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium953Open in IMG/M
3300033551|Ga0247830_10277423All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1278Open in IMG/M
3300033551|Ga0247830_10638803All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales844Open in IMG/M
3300034090|Ga0326723_0247144All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium795Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.11%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.22%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.78%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.42%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere4.69%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.25%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.53%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.53%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.53%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil2.53%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand2.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.17%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.81%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.81%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.44%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.44%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.44%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.44%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.44%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.44%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.44%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.44%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.08%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.08%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.08%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.08%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.08%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.72%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.72%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.72%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.72%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.72%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.72%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.72%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.36%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.36%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.36%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.36%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.36%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.36%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.36%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.36%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.36%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.36%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300001536Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001537Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002124Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3EnvironmentalOpen in IMG/M
3300002503Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3EnvironmentalOpen in IMG/M
3300003994Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300003997Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1EnvironmentalOpen in IMG/M
3300004062Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009811Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30EnvironmentalOpen in IMG/M
3300009815Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10EnvironmentalOpen in IMG/M
3300009820Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011991Permafrost microbial communities from Nunavut, Canada - A34_65cm_12MEnvironmentalOpen in IMG/M
3300012019Permafrost microbial communities from Nunavut, Canada - A7_5cm_12MEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013758Permafrost microbial communities from Nunavut, Canada - A24_65cm_12MEnvironmentalOpen in IMG/M
3300014324Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014823Permafrost microbial communities from Nunavut, Canada - A3_80cm_0MEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300023263Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6EnvironmentalOpen in IMG/M
3300024433Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025002Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 2 (SPAdes)EnvironmentalOpen in IMG/M
3300025165Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1EnvironmentalOpen in IMG/M
3300025322Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025325Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025326Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025327Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025551Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027056Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027952Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027957Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030606Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125EnvironmentalOpen in IMG/M
3300030613Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227EnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI11643J11755_1136423313300000787SoilEALRELLEQVASDVFDAGEADEAGCILVTKEALN*
JGI11643J11755_1154090313300000787SoilREIIEHVASDAFDAEDPFDTSGRVLVTSEALARVMRSA*
JGI1027J11758_1258110823300000789SoilEIIEQVASDAFDAEDPFDTSGRVLVTSEALARVMRSA*
JGI1027J11758_1283100723300000789SoilHAERVHLNGSDGAIFEAYRELIEDLASEAFDAEGPFDQHGRILVTSEAIARVTRSA*
JGI11643J12802_1120690833300000890SoilEELASDAFDAEGPFDNHGRVLVTSEAFTRITRSA*
JGI1027J12803_10145663433300000955SoilSHEALRDHADRVHFSESDGAVFQAYRELIEQAASDAYDAEGPFDDHGRVLVTSEALARVTRSA*
JGI10216J12902_11583715513300000956SoilMPLVRLKDEYLEQEDGVRFLMADELGNAVACKVSHEALRAQAEHVHFSGSDSAAFDAEGPFDNHGRVLVTSEALARITRSA*
F14TB_10225264913300001431SoilLIEQVASDAYDAEGPFDDHGRILVTPEALARVTRSA*
A1565W1_1078203523300001536PermafrostTDSAIFEAYRELIEDVASKTFDAEGPFDDHGRILVTSEALARVTRSA*
A2065W1_1004687053300001537PermafrostHEVLRDQADRLHFVATDDAIFEEYRELIEDIASEAFDAGGPLDHQGRILVTSEAMARATRSA*
A2065W1_1167304013300001537PermafrostVHLSGTDSAVFEAYRELIEDVASETFDAEGPYDEHGRILVTSDALARVTRSA*
C687J26631_1032681713300002124SoilSEAHDAEGPFDAHGRILVTSGALARVTRSAVFRK*
C687J35164_1016002233300002503SoilVFQAYRELIEEVASEAHDAEGPFDAHGRVLVTSEALARVTRSA*
Ga0055435_1002113323300003994Natural And Restored WetlandsMHFSGTDSAIFDAYRELIEGVASDAHDAEGPFDAHGRIIVTSEALARVMRSA*
Ga0055466_1015762223300003997Natural And Restored WetlandsHEALRDHAERVHLSGSDAAVFEAYRELIEQAASDAHDAEGPFDNHGRVLVTSEALARVTRSA*
Ga0055500_1014183823300004062Natural And Restored WetlandsALQDHADRMHFSGTDGAVFDAYRELIEAVASEAHDAEGPFDAHGRILVTSEALARVTRSA
Ga0062589_10030614013300004156SoilDISGTYRSASDAFDAEGPFDNHGRVLVSSEALARITRSA*
Ga0062590_10248082723300004157SoilVSHEALRAQAERVHFSGSDSAVFRIEELASDAFDAEGPFDNHGRVLVTSEALARITRSA*
Ga0063356_10238255623300004463Arabidopsis Thaliana RhizosphereSGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALARIMRSA*
Ga0063356_10396994213300004463Arabidopsis Thaliana RhizosphereVHFSGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEAFTRITRSA*
Ga0062595_10102584123300004479SoilVQLSHELRDHADRMHFSGTDGAVFEAYRELMEDVASGAYDAKGPFDDHGRILVTSEALARVTRSA*
Ga0062595_10210988413300004479SoilTGSDSEVFEAYRELIEELASEAFDAEGPFDAHGRVLVTSEAIARITRSA*
Ga0062592_10207395023300004480SoilAYRELIEQVASDAYDAEGPFDDHGRILVTSEALARVTRSA*
Ga0069718_1561002233300004481SedimentDGAVFEAYRELIEELASATYDAETPFDELGRVLVTSEAIARITRSA*
Ga0062591_10257384313300004643SoilQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALARIMRSA*
Ga0062594_10241606113300005093SoilSGTDGAVFDAYRELIEEVASEAHDAEGPFDDQGRIRVTSEALAGNA*
Ga0065707_1027824813300005295Switchgrass RhizosphereKVSHEALRTHAEHVHFAGTDSAVFQAYRELVEELASDAFDAEGPFDNHGRVLVTSEALARITRSA*
Ga0070683_10208000313300005329Corn RhizosphereKVFKAYRELIEQVASDAYDAGAKVDDAGCVLVTSEAIDRVSRSA*
Ga0070690_10030687133300005330Switchgrass RhizosphereSDSAVFQAYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA*
Ga0070690_10085319723300005330Switchgrass RhizosphereAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA*
Ga0070670_10003568113300005331Switchgrass RhizosphereERVHFSGSDSAVFQAYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA*
Ga0070670_10082046323300005331Switchgrass RhizosphereFSGSDSAVFQAYRELIEELASDAFDVEGPFDNHGRVLVTSEALTRITRSA*
Ga0070682_10011983343300005337Corn RhizosphereAVFEAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA*
Ga0070682_10048989723300005337Corn RhizosphereTDGAVFQAYRELIEELANDAAEGPFDNHGRVLVTSEALARITRSA*
Ga0070660_10000776213300005339Corn RhizosphereDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA*
Ga0070687_10019827923300005343Switchgrass RhizosphereMPTAHFSGTDGAAFEAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA*
Ga0070687_10120731923300005343Switchgrass RhizosphereSGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVSSEALARITRSA*
Ga0070661_10000970513300005344Corn RhizosphereCKVNHEALRAQAERVHFSGSDSAVFQAYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA*
Ga0070661_10085601033300005344Corn RhizosphereGTDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSGALTRITRSA*
Ga0070675_10003138693300005354Miscanthus RhizosphereDRVHFSGTDGAVFEAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA*
Ga0070671_10182049613300005355Switchgrass RhizosphereAYRELIEEVASEAHDAEGPFDDHGRILVTSEALTRVMRSA*
Ga0070688_10001630413300005365Switchgrass RhizosphereSAVFQAYRELIEELASDAFDAEGPFDNHGRALVTSEALTRITRSA*
Ga0070659_10084776023300005366Corn RhizosphereGAVFEAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA*
Ga0070659_10205966513300005366Corn RhizosphereHFSGTDGAVFDAYRELIEEVASEAHDAEGPFDDQGRIRVTSEALAGNA*
Ga0070667_10159919513300005367Switchgrass RhizosphereQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA*
Ga0070700_10190178513300005441Corn, Switchgrass And Miscanthus RhizosphereEALRGHADRMRFSGTDGAVFEAYRELIEEVASEAHDAEGPFDDHGRILVTTEALTRVMRSA*
Ga0070694_10122403813300005444Corn, Switchgrass And Miscanthus RhizosphereMRFSGTDGAVFEAYRELIEEVASEAHDAEGPFDDHGRILVTSEALTRVMRSA*
Ga0070662_10073710613300005457Corn RhizosphereGAVFQAYREPIEELANDAFDAEGPFDNHGRVLVTSEALTRITRSA*
Ga0070662_10151750223300005457Corn RhizosphereQPRADEPIARAASGDAFDAEGPYDNHGRVLVTSEALARVTRSA*
Ga0070681_1075029143300005458Corn RhizosphereDSAVFQAYRELIEELASDAFDAEGPFDNHGRALVTSEALTRITRSA*
Ga0070697_10169447023300005536Corn, Switchgrass And Miscanthus RhizosphereHFSGSDSAVFQAHRELIEELASEAFDAEGPFDNHGRVLVTSEALARITRSA*
Ga0070696_10048014713300005546Corn, Switchgrass And Miscanthus RhizosphereAFEAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA*
Ga0070696_10177598013300005546Corn, Switchgrass And Miscanthus RhizosphereHAERSHASGTDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA*
Ga0070665_10016540313300005548Switchgrass RhizosphereSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA*
Ga0070704_10009056513300005549Corn, Switchgrass And Miscanthus RhizosphereSGTDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSGALTRITRSA*
Ga0068855_10187342413300005563Corn RhizosphereKVMVFEAYRELIEQVASDACDAGANVDDAGCVLVTSEALDRVSRSA*
Ga0068857_10075699643300005577Corn RhizosphereAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA*
Ga0068856_10151429923300005614Corn RhizosphereAYRELIEELASDAFDAEGPFDNHGRVLVTSGALTRITRSA*
Ga0068856_10175478413300005614Corn RhizosphereVFQAYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA*
Ga0066903_10145827313300005764Tropical Forest SoilVFEAYRELIETVASDAFDAEGPMDAHGRILVTSEALARVMRSA*
Ga0066903_10337431023300005764Tropical Forest SoilMKHCERVRLSGSDSSVFEACRELIEDSASEAFDAEGLFDRHGRGLVNSEAIARVTRSA*
Ga0068860_10090085713300005843Switchgrass RhizosphereVFEAYRELIEQVASDAYDAGTSFDDAGLILVTSEALARVGRSA*
Ga0075024_10065559213300006047WatershedsLQDHADRMHFSGTDGAVFDAYRELIEAVASEAHDAEGPFDAHGRILVTSEALARVTRSA*
Ga0075029_10062925113300006052WatershedsRELIEQVASDAYHAGTSVDDAGLVLVTSEALALVARSA*
Ga0075432_1012007023300006058Populus RhizosphereRVHFSGSDSAVFQAYRELIEELASEAFDAEGPFDNHGRVLVTSEALTRITRSA*
Ga0070715_1062656513300006163Corn, Switchgrass And Miscanthus RhizosphereLNVADDKVFEAYRELIEQVASDAYDAGANVDDAGCVLVTSEALDRVSRSA*
Ga0070712_10100303113300006175Corn, Switchgrass And Miscanthus RhizosphereIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA*
Ga0070712_10147068213300006175Corn, Switchgrass And Miscanthus RhizosphereVTHEALRDHAERMHFSGSDRAVFEAYRELIETVASGAFDAEGPMDAHGRILVTSEALARVMRSA*
Ga0068871_10202030223300006358Miscanthus RhizosphereAYRELIEELASEAHDAEGPFDAHGRILVTSEALARVTRSA*
Ga0079222_1041354313300006755Agricultural SoilGTDATIFEAYRELIEQIASDAYDAEGPVDDHGRILVTSEALARVTRSA*
Ga0075428_10110204633300006844Populus RhizosphereERVHFSGSDSAVFQAYRELIEELASDAFDVEGPFDNHGRVLVTSEALTRITRSA*
Ga0075426_1043145513300006903Populus RhizosphereSHEALRAHAERVHFAGNDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALARIMRSA*
Ga0075424_10014519483300006904Populus RhizosphereFSGSDSAVFQAYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA*
Ga0075424_10065050713300006904Populus RhizosphereAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALARITRNA*
Ga0075424_10116031133300006904Populus RhizosphereFEAYREFIEQVASDAYDAGSVDDAGLALVTSEALARVGRSA*
Ga0075424_10207185213300006904Populus RhizosphereMPDRMHFSGTDGAVFEAYRELIEDVASGAYDAKGPFDDHGRILVSSEKLARVT
Ga0079218_1180027423300007004Agricultural SoilLRDHADRMHFSGTDGAVFEAYRELIEEVASEAHDAEGPFDAHGRILVTSEALARVTRST*
Ga0075435_10077536533300007076Populus RhizosphereGSDSAVFQAYRELIEELASDAFDVEGPFDNHGRVLVTSEALTRITRSA*
Ga0075435_10202404813300007076Populus RhizosphereMAPFSRAYRELIEELASAAYDAEAPFDDHGRVLVTSEAIARITRSA*
Ga0105095_1035653623300009053Freshwater SedimentHFSGTDGAVFDAYRELIEEVASVAHDAEGPFDEHGRILVTSEALARVTRSA*
Ga0111539_1018490063300009094Populus RhizosphereVSHEALRAQAERVHFSGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALARITRSA*
Ga0111539_1050021023300009094Populus RhizosphereMPTVQHSGTDGAVFEAYRELIEELASAAYDAEAPFDDHGRVLVTSEAIARITRSA*
Ga0111539_1226265623300009094Populus RhizosphereEGPDEKVFEVYRELIEQVASDAYDAGTSVDDAGLVLVTSEALARVGRSA*
Ga0105247_1005564713300009101Switchgrass RhizosphereIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA*
Ga0105247_1095463013300009101Switchgrass RhizosphereVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALARIMRSA*
Ga0105091_1013971313300009146Freshwater SedimentRVSHEALRDHAERTHFSGTDGAVFEAYRELIEEVASETHDAEGPFDAHGRVLVTSEALARVTRSA*
Ga0114129_1071186323300009147Populus RhizosphereLAINLEEELEHASGTDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSGALTRITRSA*
Ga0114129_1072140133300009147Populus RhizosphereSHASGTDSAVFQAYRELIEELASDAFDAEGPFDNPGHVLVTSEALTRITRSA*
Ga0114129_1314714323300009147Populus RhizosphereHEALRAQAERVHFSGSDSAVFQAYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA*
Ga0111538_1064200023300009156Populus RhizosphereMVDELGNTVACKVCHEALRVHAEREHFAGTDGAVFQAHRELIEELASGAFDAEGPFANYGRVLVTSEALTRITRSA*
Ga0075423_1085936323300009162Populus RhizosphereHFSGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALARITRNA*
Ga0075423_1141648423300009162Populus RhizosphereRLNVADDKVFEAYRELIEQVASDAYDAGANVDDAGCVLVTSEALDRVSRSA*
Ga0075423_1186957513300009162Populus RhizosphereDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALARIMRSA*
Ga0105237_1262042913300009545Corn RhizosphereLRAQAERVHFSGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA*
Ga0105238_1058036813300009551Corn RhizosphereMRFSGTDGAVFEAYRELIEEVASEAHDAEGPFDDHGRILVTTEALTRVMRSA*
Ga0105249_1033987813300009553Switchgrass RhizosphereRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA*
Ga0116217_1014056443300009700Peatlands SoilFEAYRELIEQVASDAFDAGASVDDAGLVLVTSEALARVGRSA*
Ga0105084_104067113300009811Groundwater SandYRELIEQLASDAYDAEGPFDAHGRVFVTSEALARVTRSA*
Ga0105084_105501833300009811Groundwater SandYRELIEGVASEAHDAEGPFDAHGRILVTSEALARVTRSA*
Ga0105070_112328423300009815Groundwater SandYRELIEEIASEAYEAEGPFDAHGRILVTSEALARVTRSA*
Ga0105085_109724413300009820Groundwater SandLIEQIASDAYDAEGPFDDHGRVLVTSEALARVTRSA*
Ga0116219_1000056913300009824Peatlands SoilLIEQVASDAFDAGASVDDAGLVLVTSEALARVGRSA*
Ga0116223_1000230813300009839Peatlands SoilEKVFEAYRELIEQVASDAFDAGASVDDAGLVLVTSEALARVARSA*
Ga0116223_1015927513300009839Peatlands SoilEKVFEAYRELIEQVASDAFDAGASVDDAGLVLVTSEALARVGRSA*
Ga0134125_1049858123300010371Terrestrial SoilFSGADGAVFEAYRELIEEVAIEAHDAEGPFDDHGRILVTTEALTRVMRSA*
Ga0134125_1164632213300010371Terrestrial SoilMPLTRVKDDGAVFQAYREPIEELANDAFDAEVPFDNHGRVLVTSEALTRITRSA*
Ga0134128_10084502113300010373Terrestrial SoilELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA*
Ga0134128_1061932713300010373Terrestrial SoilALRDHADRLHFTGTDGAVFEAYRELIEDLAGRAFEAGGPLDDEGTILVTSEAIARETRSA
Ga0134128_1103831513300010373Terrestrial SoilLRDHADRLHLSGTDGAVFDVYRELIEEVASAAYDAESPLDDHGRILVTSEALARMTRSA*
Ga0134128_1143952913300010373Terrestrial SoilMVDELGITVACKVCHEALRVHAEREHFAGTDGAVFQAHRELIEELASGAFDAEGPFANYGRVLVTSEALTRITRSA*
Ga0105239_1047629323300010375Corn RhizosphereYRELIEQVASDAYDAGAKVDDAGCVLVTSEAIDRVSRSA*
Ga0105239_1148829613300010375Corn RhizosphereEAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA*
Ga0134126_1076869313300010396Terrestrial SoilMRFSGTDGAVFEAYRELIEEIASEAHDAEGPFDDHGRILVTSEALTRVMRSA*
Ga0134124_1046840313300010397Terrestrial SoilALRAQAERVHFSGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA
Ga0134124_1067423413300010397Terrestrial SoilELIEQVASDAYDAGTSVDDAGLVLVTAEALARVGRSA*
Ga0134124_1205199413300010397Terrestrial SoilRVSHEALRGHADRMRFSGTDGAVFEAYRELIEEVASEAHDAEGPFDDHGRILVTSEALARVMRSA*
Ga0134127_1032940413300010399Terrestrial SoilVHFSGSDSAVFQAYRELIEELASEAFDAEGPFDNHGRVLVTSEALTRITRSA*
Ga0134122_1193583423300010400Terrestrial SoilFSGADGAVFEAYRELIEEVASEAHDAEGPFDDHGRILVTSEALTRVMRSA*
Ga0134121_1004518113300010401Terrestrial SoilAQAERVHFSGSDSAVFQAYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA*
Ga0134121_1114109113300010401Terrestrial SoilRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA*
Ga0134121_1206765513300010401Terrestrial SoilSHEALRAQAERVHFSGSDSAVFQAYRELIEELASEAFDAEGPFDNHGRVLVTSEALTRITRSA*
Ga0105246_1069151423300011119Miscanthus RhizosphereMHFSGTDGAVFDAYRELIEEVASEAHDAEGPFDDQGRIRVTSEALAGNA*
Ga0105246_1106568523300011119Miscanthus RhizosphereADRMRFSGTDGAVFEAYRELIEEVASEAHDAEGPFDDHGRILVTSEALTRVMRSA*
Ga0120153_102707833300011991PermafrostHEALRDHADRVHLSGTDSAIFEAYRELIEDVASKTFDAEGPFDDHGRILVTSEALARVTRSA*
Ga0120139_108871023300012019PermafrostALRDHADRVHLSGTDSAVFEAYRELIEDVASETFDAEGPYDEHGRILVTSDALARVTRSA
Ga0137368_1064453513300012358Vadose Zone SoilHEALRDHADRMHFSGTDGAVFEAYRELIEEVASEAYDAEGPFNDHGRVLVTSEALARVIRSA*
Ga0137375_1147511913300012360Vadose Zone SoilDHADRVHFSGTDSAVFEAYRELIEDVASEAFDAEGPFDDHGRILVTSEALARVTRSA*
Ga0137360_1091481813300012361Vadose Zone SoilHADRVHLSGTDGSVFEAYRELIEGVASEAFDAEGPFNDHGRILVTSQALARVTRSA*
Ga0157309_1024978213300012895SoilEALRAQAERVHFSGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA*
Ga0157295_1040244213300012906SoilERVHFSGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEAFTRITRSA*
Ga0157283_1015325313300012907SoilQAYRELIEELASDAFDAEGPFDNHGRVLVTSEAFTRITRSA*
Ga0157290_1027280613300012909SoilQAERVHFSGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSGALTRITRSA*
Ga0157301_1030090023300012911SoilEALRAHAERSHASGTDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSGALTRITRSA*
Ga0157302_1041815513300012915SoilRDHANRVQHSGTDGAVFEAYRELIEELASAAYDAEAPFDDHGRVLVTSEAIARITRSA*
Ga0157302_1044371513300012915SoilVSHEALRAQAEHVHFSGSDSAVFQAFRELIEELASDAFDAEGPFDNHGRVLVTSEALARITRSA*
Ga0153915_1003724063300012931Freshwater WetlandsLQDHAERVHLSGSDAIVFEAYRELIEQVASDAYDAEGPFDDHGRILVTSEALARVTRSA*
Ga0164303_1062074623300012957SoilVFEAYRELIEQVASDTFDAGVNVDEAGGILVTKEALDRVARSA*
Ga0164299_1036239433300012958SoilAERVHFSGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRALVTSEALTRITRSA*
Ga0164302_1099125823300012961SoilEAYRELIEELASAAYDAEATFEDHGRVLVTSEAIARITRRA*
Ga0164309_1071811513300012984SoilSGTDGAVFEAYRELIEELASAAYDAEAPFDDHGRVLVTSEAIARITRSA*
Ga0164309_1111232813300012984SoilFSGSDSAVFQAYRELIEELASDAFHAEGPFDNHGRVLVTSGALTRITRSA*
Ga0164309_1187698413300012984SoilFSGSDSAVFQAYRELIEELASDAFHAEGPFDNHGRVLVTSEAITRITRSA*
Ga0164305_1160506623300012989SoilTDDQVFEAYRELIEQVASDTFDAGVDVDEAGCILVTKEALDRVARSA*
Ga0164305_1205424313300012989SoilKDESGGTVACRVNHLALRDHADRMHFSGNDGAVFEAYRELIEELASEAHDAEGPFDAHGRILVTSEALARVMRSA*
Ga0157373_1038320013300013100Corn RhizosphereAERVHFSGSDSAVFQAYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA*
Ga0157374_1122097113300013296Miscanthus RhizosphereRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA*
Ga0157378_1003429483300013297Miscanthus RhizosphereAYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA*
Ga0163162_1043921733300013306Switchgrass RhizosphereFQAYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA*
Ga0157372_1299095213300013307Corn RhizosphereRELIEQVASDTFDTRVNVDEAGCILVTKEALDRVGRSA*
Ga0157375_1005117973300013308Miscanthus RhizosphereFEAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA*
Ga0157375_1162808613300013308Miscanthus RhizosphereFEAYRELIEEVASEAHDAEGPFDDHGRILVTSEALTRVMRSA*
Ga0120147_104943133300013758PermafrostICRGSHEALRDQADRLHFVATDDAIFEEYRELIEDIASEAFDAGGPLDHQGRILVTSEAMARATRSA*
Ga0075352_115498513300014324Natural And Restored WetlandsALRDHAERVHLASKDAAVFEAYRELIEQVASDAYDAEGPFDDHGRILVTSEALARVTRSA
Ga0163163_1008586023300014325Switchgrass RhizosphereMRFSGADGAVFEAYRELIEEVASEAHDAEGPFDDHGRILVTTEALTRVMRSA*
Ga0163163_1029599633300014325Switchgrass RhizosphereSGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA*
Ga0163163_1125537613300014325Switchgrass RhizosphereLFIYALKVMVFEAYRELIEQVASDACDAGANVDDAGCVLVTSEALDRVSRSA*
Ga0163163_1275118813300014325Switchgrass RhizosphereMHFSGTDGAVFDAYRELIEEVASEAHDAEGPFDDQGRIRVTSEALA
Ga0157380_1232820213300014326Switchgrass RhizosphereHFAGNDSAVFQAYQELIEELASDAFDAEGPFDNHGRVLVSSEALARITRSA*
Ga0120170_106606023300014823PermafrostRDHADRVHLSGTDSAVFEAYRELIEDVASETFDAEGPYDEHGRILVTSDALARVTRSA*
Ga0157379_1032216823300014968Switchgrass RhizosphereDDEVFEAYRELIEQVASDTFDAGVNIDEAGCILVTKEALDRVARSA*
Ga0157379_1066507913300014968Switchgrass RhizosphereTDGAVFEAYRELIEEVASEAHDAEGPFDDHGRILVTSEALTRVMRSA*
Ga0157379_1193519713300014968Switchgrass RhizosphereAERVHFSGSDSAVFQAYRELIEELASDAFDVEGPFDNHGRVLVTSEALTRITRSA*
Ga0173483_1009087213300015077SoilRVHFSGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEAFTRITRSA*
Ga0132258_10166720113300015371Arabidopsis RhizosphereFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA*
Ga0132258_1145580013300015371Arabidopsis RhizosphereMRFSGTDGAVFEAYRELVEEIASEAHDAEGPFDDHGRILVTSEALTRVMRSA*
Ga0132256_10108895333300015372Arabidopsis RhizosphereHLSDTDAAVFEAYRELIEQVASDAYDAEGPFDDHGRILVTSEALARVTRSA*
Ga0132256_10342644013300015372Arabidopsis RhizosphereDGDTVACGVSHELRDHVDRMHFSGTDSAVFEAYRELIEDVASGAYDAKSPFDDHGRILVTSEALARVTRSA*
Ga0132257_10336218423300015373Arabidopsis RhizosphereEQVASDTFDAGVNVDEAGCILVTKEALDRVARSA*
Ga0132255_10162866213300015374Arabidopsis RhizosphereLIEEVASEAHDAEGPFDDHGRILVTSEALTRVMRSA*
Ga0182036_1054959413300016270SoilLIEQVASDAYDAGANVDDVGCVLVTSEALDRVSRSA
Ga0182032_1010660433300016357SoilFETYRELIEQVASDAYDAEGPYDMEGRILVTSEALARVLRSA
Ga0182034_1097468533300016371SoilRELIEDLASEAFDAEGPFDQHGRVLITSEAIARITRSA
Ga0182040_1115377313300016387SoilIEDVASEAFDAEGPFDQHGRVLVTSEAIARITRSA
Ga0182037_1006799113300016404SoilAYRELIEDLASEAFDIEGPFDQHGRILVTSEAIARITRSA
Ga0163161_1205829713300017792Switchgrass RhizosphereHFSGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA
Ga0187785_1016549813300017947Tropical PeatlandHLNGSDSKVFETYRELIEDLASEAFDAEGPFDRNGRVLVTSEALARVTRSA
Ga0187779_1112302313300017959Tropical PeatlandDHAERAHLSGSDGVVFETYRELIEELASEAFDAEGPFDRHGRVLVTSEAVARVTRSA
Ga0187767_1003026833300017999Tropical PeatlandAYRELIEQVASDAYDAGANVDDTGCVLVTSEALDRVSRSA
Ga0184608_1016446323300018028Groundwater SedimentMAFASSEDEAGSTVACRVSHEALRDLAHRMHFSGTGGPVFDAYRELIEGVASKAHDAEGPFDARGRILVTPEALARVMRSA
Ga0184623_1018803513300018056Groundwater SedimentVSHEALRDHAGRMHYSGTDGAVFDAYRELIEGIASEAHDAEGPFDAHGRILVTSEALARVTRSA
Ga0187766_1090514613300018058Tropical PeatlandTDGVVFETYREIIEQIASDAYNAERPFDKDGQILVTSEALARVTRSA
Ga0184637_1067287813300018063Groundwater SedimentALRDHADRMHFSGTDGAVFDAYRELIEGIASEAHDAEGPFDAHGRILVTSEALARVTRSA
Ga0184609_1025572223300018076Groundwater SedimentAYRELIEEGASDAYDDAEGPSDDHGRILVTSGALARVSRSA
Ga0187774_1119060613300018089Tropical PeatlandDCKVFETYRELIEELASEAFDAEGPFDRHGRVLVTSEALARVMRSA
Ga0190269_1107492023300018465SoilMKDCDNHADRMHFSGSAGAVFKAHPELIEEIASEAYEAEGPFDAHGRVLVTSEGLARVTRSA
Ga0190271_1065766313300018481SoilSRELIEQIASDAHDAEGPFDDHGRVLVTSEAIARVMRSA
Ga0173481_1028912833300019356SoilAERSHASGTDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSGALTRITRSA
Ga0173481_1033607023300019356SoilMHFSGTDGAVFEAYRELIEEVASAAYDAEAPFDDHGRILVTSEALARITRSA
Ga0173482_1016853313300019361SoilQGLRIYRELIEQVACDAYDAGANVDDAGCVLVTSEALDRVSRSA
Ga0247800_106289333300023263SoilFSGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA
Ga0209986_1053909213300024433Deep SubsurfaceRMHISGTDGAVFDAYRELIEEVASEAHDAEGPFDEHGRILVTSEALARVTRSA
Ga0209001_108416513300025002SoilELIEQIASDAYDAEGPFDDHGRVLVTSEALARVTRSA
Ga0209108_1029142443300025165SoilAYRELIEGGASEAHDAEGPFDAHGRILVTSEALARVTRSA
Ga0209641_1049974113300025322SoilDHADRRHFSGTDGAVFEAYRELIEAVASEAHDAEGPFDAHGRILVTSEALARVTRSA
Ga0209640_1006453813300025324SoilGAVFDAYRELIEGVASEAHDAEGPFDAHGRILVTSEALARVTRSA
Ga0209341_1103891713300025325SoilEALRDHAARVQLSGRDGDVFQAYRELIESVASDAFDAEGPFDDHGRVLVTSEALARVTRS
Ga0209342_1112403923300025326SoilLIEQIASDAYDAEGPFDDHGRVLVTSEALARVTRSA
Ga0209751_1048776413300025327SoilVHFSGTDGAVFEAYRELIEDLASEAFDAEGPFDEHGRVLVTSEALARVTRSA
Ga0210131_104062113300025551Natural And Restored WetlandsVSHEALRDHADRMHFSGTDSAIFDAYRELIEGVASDAHDAEGPFDAHGRIIVTSEALARVMRSA
Ga0207642_1013795743300025899Miscanthus RhizosphereGTDGAVFEAYRELIEEVASEAHDAEGPFDDHGRILVTSEALTRVMRSA
Ga0207688_1013755933300025901Corn, Switchgrass And Miscanthus RhizosphereELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA
Ga0207688_1037616323300025901Corn, Switchgrass And Miscanthus RhizosphereQTFRELIEELASDAFDAEGPFDNHGRVLISSEALARITRSA
Ga0207688_1061368713300025901Corn, Switchgrass And Miscanthus RhizosphereDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSGALTRITRSA
Ga0207647_1002357613300025904Corn RhizosphereALRDHADRLHFSGTDGAVFEAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA
Ga0207685_1001251933300025905Corn, Switchgrass And Miscanthus RhizosphereERSHASGTDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSGALTRITRSA
Ga0207699_1014993513300025906Corn, Switchgrass And Miscanthus RhizosphereDSAVFQAYRELIEEPASDAFDAEGPFDNHGRVLVTSEALTRITRSA
Ga0207699_1123947313300025906Corn, Switchgrass And Miscanthus RhizosphereDATIFEAYRELIEQIASDAYDAEGPVDDHGRILVTSEALARVTRSA
Ga0207645_1023126733300025907Miscanthus RhizosphereAVFQAYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA
Ga0207693_1052888233300025915Corn, Switchgrass And Miscanthus RhizosphereAYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA
Ga0207693_1080388923300025915Corn, Switchgrass And Miscanthus RhizosphereFQAYRELIEELASDAFDAEGPFDNHGRVLVTSGALTRITRSA
Ga0207663_1012490043300025916Corn, Switchgrass And Miscanthus RhizosphereFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA
Ga0207662_1002543953300025918Switchgrass RhizosphereDRLHFSGTDGAVFEAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA
Ga0207657_1000731313300025919Corn RhizosphereHEALRDHADRVHFSGTDGAVFEAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA
Ga0207657_1014940223300025919Corn RhizosphereRELIEQVASDAYDAGAKVDDAGCVLVTSEAIDRVSRSA
Ga0207649_1079262413300025920Corn RhizosphereVHFSGTDGAAFEAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA
Ga0207649_1100190213300025920Corn RhizosphereLIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA
Ga0207681_1028130623300025923Switchgrass RhizosphereLIEELSIDAFDAEGPFDNHGRVLVTSGALTRITRSA
Ga0207681_1044836023300025923Switchgrass RhizosphereRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA
Ga0207650_1029645813300025925Switchgrass RhizosphereRAQAERVHFSGSDSAVFQAYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA
Ga0207664_1018355743300025929Agricultural SoilIVLFFQAYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA
Ga0207644_1005798013300025931Switchgrass RhizosphereEAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA
Ga0207690_1005068313300025932Corn RhizosphereHFSGTDGAAFEAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA
Ga0207670_1098963713300025936Switchgrass RhizosphereIEELASDAFDAEGPFDNHGRVLVTSGALTRITRSA
Ga0207704_10017320113300025938Miscanthus RhizosphereYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA
Ga0207665_1100992913300025939Corn, Switchgrass And Miscanthus RhizospherePDEKVFEAYRELIEQVASDAYDAGTSFDDAGLILVASEALARVGRSA
Ga0207691_1013045033300025940Miscanthus RhizosphereYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA
Ga0207679_1091327033300025945Corn RhizosphereKVSHEALRAHAERSHASGTDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSGALTRITRSA
Ga0207667_1071956023300025949Corn RhizosphereVACKVNHEALRAQAERVHFSGSDSAVFQAYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA
Ga0207667_1147066413300025949Corn RhizosphereELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA
Ga0207667_1205823613300025949Corn RhizosphereVADDNVFEAYRELIEQVASDACDAGANVDDAGCVLVTSEALDRVSRSA
Ga0207712_1032041913300025961Switchgrass RhizosphereQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA
Ga0207712_1038460133300025961Switchgrass RhizosphereRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA
Ga0207640_1036104313300025981Corn RhizosphereGSDSAIFQAYRELIEELASDAFDAEGPFDNHGRALVTSEALTRITRSA
Ga0207658_1007669913300025986Switchgrass RhizosphereALRDHADCLHFSGTDGAVFEAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA
Ga0207641_1037639113300026088Switchgrass RhizosphereMRFSGTDGAVFEAYRELIEEVASEAHDAEGPFDDHGRILVTTEALTRVMRSA
Ga0207648_1046956213300026089Miscanthus RhizosphereCKVSHEALRAQAERVHFSGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSGALTRITRSA
Ga0207698_1217963013300026142Corn RhizosphereCRVSHEALRGHADRMRFSGTDGVVFEAYRELIEEVASEAHDAEGPFDDHGRILVTTEALTRVMRSA
Ga0209879_104673113300027056Groundwater SandRELIEGVASEAHDAEGPFDAHGRILVTSEALARVTRSA
Ga0209517_1013738213300027854Peatlands SoilELIEQVASDAFDAGASVDDAGLVLVTSEALARVGRSA
Ga0209382_1168840013300027909Populus RhizosphereVNHEALRAQAERVHFSGSDSAVFQAYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA
Ga0209889_103390823300027952Groundwater SandAYRELIEQIASDAYDAEGPFDDHGRVLVTSEALARVTRSA
Ga0209857_103152233300027957Groundwater SandMHFSGTDGAVFDAYRELIEGIASEAHDAEGPFDAHGRILVTSEALARVTRSA
Ga0268265_1048272113300028380Switchgrass RhizosphereFSGTDGAVFEAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA
Ga0247827_1133490913300028889SoilHLAANDNEIFEAYRELIEQVASDAFDAQAGVDEAGCVVVTKEALDRVGRSA
Ga0299907_1053752713300030006SoilLHLAGTDAEVFEGYRELIEQIASDTHDAEGPFDDHGRVLVTSEAIARVMRSA
Ga0299907_1097382513300030006SoilSHEALRDHADRMHFSGTDGAVFDAYRELIEEVASEAHDAEGPFDEHGRILVTSEALARVTRSA
Ga0299907_1112199313300030006SoilLPGTDADVFAACRELIEQIASDAYDAEGPFDDHGRVLVTSEALARVTRSA
Ga0311333_1129962813300030114FenFEGADKEIFEAYREIIEQIASDAFDADAGVDDDGAILVTSEALDRVGRSA
Ga0299906_1035109833300030606SoilVFEKYRELIEDIASEAFDAGGPLDHQGRILVTSEALARVTRSA
Ga0299915_1006559843300030613SoilYRELIEEVASEAHDAEGPFDAHGRVLVTSEALARVTRSA
Ga0302046_1098742913300030620SoilGRVHFSGTDGAVFEAYRELIEDLASEAFDAEGPFDEHGRVLVTSEALARVTRSA
Ga0316363_10003780173300030659Peatlands SoilEKVFEAYRELIEQVASDAFDAGASVDDAGLVLVTSEALARVGRSA
Ga0310038_1006690513300030707Peatlands SoilFEAYRELIEQVASDAFDAGASVDDAGLVLVTSEALARVGRSA
Ga0307498_1004710133300031170SoilDEKIFEVYRELIEQVASDAYDAGTSVDEAGLVLVTAEALARVGRSA
Ga0310886_1104363423300031562SoilRSHASGTDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSGALTRITRSA
Ga0318542_1040928723300031668SoilHAERVHLSSSDSEVFEAYRELIEDLASEAFDAEGPFDQHGRVLVTSEAIARITRSA
Ga0318561_1047935813300031679SoilEALRDHADRLHLSGRDGVVFETYRELIEQVASDAYDAEGPYDMEGRILVTSEALARVLRS
Ga0302321_10041904713300031726FenEIIEQIASDAFDADAGVDDDGAILVTSEALDRVGRSA
Ga0307468_10061581913300031740Hardwood Forest SoilLIEEVASETHDAEGPFDAHGGVLVTSEALARVTRSA
Ga0307468_10197582023300031740Hardwood Forest SoilFEAYRELIEQVASDTFDAGVNVDEAGCILVTKEALDRVARSA
Ga0318547_1020674943300031781SoilYRELIEDLASEAFDIEGPFDQHGRVLVTSEAIARITRSA
Ga0318576_1062939013300031796SoilLIEQVASDAYDAGANVDDIGCVLVTSEALDRVSRSA
Ga0310917_1021612523300031833SoilTYRELIEQVASDAYDAEGPYDMEGRILVTSEALARVLRSA
Ga0310917_1027468313300031833SoilVFEAYRELIEDLASEAFDIEGPFDQHGRVLVTSEAIARITRSA
Ga0310907_1006230033300031847SoilYRELIEELASVAYDAEAPIDDHGRVLVTSEAIARITRSA
Ga0310901_1004652513300031940SoilRVQLSGTDGAVFQAYRELIEELASAAYDAEAPFDDHGRVLVTSEAIARITRSA
Ga0310903_1045842613300032000SoilELVEQVASDAYDAGTSYDESGLVLVTSEALARVGRSA
Ga0310899_1050623113300032017SoilLRDHANRVQLSGTDGAVFEAYRELIEELASVAYDAETPFDEFGRVLVTSEAIARITRSA
Ga0310890_1034738713300032075SoilRELIEELASAAYDAEAPFDDHGRVLVTSEAIARITRSA
Ga0307472_10049193113300032205Hardwood Forest SoilLIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA
Ga0307472_10161311033300032205Hardwood Forest SoilEAYRELIEQVASDAYDAGTSVDDAGLVLVTSEALARVGRSA
Ga0307472_10197493813300032205Hardwood Forest SoilEKVFEAYRELIEQVASDAYDAGTSFDDAGLILVTSEALARVGRSA
Ga0306920_10306956913300032261SoilRDGVVFETYRKLIEQVASDAYDAEGPYDMEGRILVTSEALARVLRSA
Ga0335082_1060965913300032782SoilFETYRELIEDLASEAFDAEGPFDRHGRVLVTSEALARVMRSA
Ga0247830_1027742313300033551SoilRELIEQAASDAYDAEGPFDDHGRVLVTSEALARVTRSA
Ga0247830_1063880323300033551SoilEAYRELVEQVASDAYDAGTSYDESGLVLVTSEALARVGRSA
Ga0326723_0247144_652_7953300034090Peat SoilTDGAVFDAYRELIEEVASVAHDAEGPFDDHGRILVTSEALAQVTRSA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.