Basic Information | |
---|---|
Family ID | F012802 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 277 |
Average Sequence Length | 42 residues |
Representative Sequence | MPELVVRGWRRALHNQRALYVKRLLLFEPHVILASVPYQLVR |
Number of Associated Samples | 227 |
Number of Associated Scaffolds | 277 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 4.33 % |
% of genes near scaffold ends (potentially truncated) | 91.34 % |
% of genes from short scaffolds (< 2000 bps) | 90.61 % |
Associated GOLD sequencing projects | 214 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.32 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (81.227 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.163 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.910 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.736 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.86% β-sheet: 0.00% Coil/Unstructured: 67.14% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 277 Family Scaffolds |
---|---|---|
PF13520 | AA_permease_2 | 17.69 |
PF00582 | Usp | 16.97 |
PF03030 | H_PPase | 6.86 |
PF01554 | MatE | 2.89 |
PF00107 | ADH_zinc_N | 2.53 |
PF08240 | ADH_N | 2.17 |
PF00486 | Trans_reg_C | 1.81 |
PF02746 | MR_MLE_N | 1.44 |
PF13602 | ADH_zinc_N_2 | 1.08 |
PF12697 | Abhydrolase_6 | 1.08 |
PF14667 | Polysacc_synt_C | 1.08 |
PF03006 | HlyIII | 0.72 |
PF09948 | DUF2182 | 0.72 |
PF06772 | LtrA | 0.72 |
PF04185 | Phosphoesterase | 0.72 |
PF02790 | COX2_TM | 0.72 |
PF03814 | KdpA | 0.72 |
PF01872 | RibD_C | 0.72 |
PF05199 | GMC_oxred_C | 0.72 |
PF13493 | DUF4118 | 0.72 |
PF08281 | Sigma70_r4_2 | 0.72 |
PF00719 | Pyrophosphatase | 0.72 |
PF05988 | DUF899 | 0.36 |
PF00313 | CSD | 0.36 |
PF00324 | AA_permease | 0.36 |
PF04828 | GFA | 0.36 |
PF08002 | DUF1697 | 0.36 |
PF00224 | PK | 0.36 |
PF13751 | DDE_Tnp_1_6 | 0.36 |
PF00933 | Glyco_hydro_3 | 0.36 |
PF01083 | Cutinase | 0.36 |
PF07963 | N_methyl | 0.36 |
PF08447 | PAS_3 | 0.36 |
PF02597 | ThiS | 0.36 |
PF13378 | MR_MLE_C | 0.36 |
PF03793 | PASTA | 0.36 |
PF08331 | QueG_DUF1730 | 0.36 |
PF00580 | UvrD-helicase | 0.36 |
PF04951 | Peptidase_M55 | 0.36 |
PF01883 | FeS_assembly_P | 0.36 |
PF00589 | Phage_integrase | 0.36 |
PF07992 | Pyr_redox_2 | 0.36 |
PF01966 | HD | 0.36 |
PF01243 | Putative_PNPOx | 0.36 |
PF00156 | Pribosyltran | 0.36 |
PF00892 | EamA | 0.36 |
PF00583 | Acetyltransf_1 | 0.36 |
PF03703 | bPH_2 | 0.36 |
PF00534 | Glycos_transf_1 | 0.36 |
PF12802 | MarR_2 | 0.36 |
PF01642 | MM_CoA_mutase | 0.36 |
PF00704 | Glyco_hydro_18 | 0.36 |
COG ID | Name | Functional Category | % Frequency in 277 Family Scaffolds |
---|---|---|---|
COG3808 | Na+ or H+-translocating membrane pyrophosphatase | Energy production and conversion [C] | 6.86 |
COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 2.89 |
COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 0.72 |
COG4292 | Low temperature requirement protein LtrA (function unknown) | Function unknown [S] | 0.72 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.72 |
COG2060 | K+-transporting ATPase, KdpA subunit | Inorganic ion transport and metabolism [P] | 0.72 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.72 |
COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.72 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.72 |
COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 0.72 |
COG3402 | Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.36 |
COG0210 | Superfamily I DNA or RNA helicase | Replication, recombination and repair [L] | 0.36 |
COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.36 |
COG3973 | DNA helicase IV | Replication, recombination and repair [L] | 0.36 |
COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.36 |
COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 0.36 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.36 |
COG0531 | Serine transporter YbeC, amino acid:H+ symporter family | Amino acid transport and metabolism [E] | 0.36 |
COG3428 | Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.36 |
COG0833 | Amino acid permease | Amino acid transport and metabolism [E] | 0.36 |
COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 0.36 |
COG1074 | 3’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 0.36 |
COG1113 | L-asparagine transporter or related permease | Amino acid transport and metabolism [E] | 0.36 |
COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 0.36 |
COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 0.36 |
COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 0.36 |
COG1600 | Epoxyqueuosine reductase QueG (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.36 |
COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.36 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 81.23 % |
Unclassified | root | N/A | 18.77 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2070309009|GPKNP_GG3DY5402HHQVZ | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
2166559005|cont_contig73682 | Not Available | 702 | Open in IMG/M |
2170459010|GIO7OMY01B0TJD | Not Available | 504 | Open in IMG/M |
2170459019|G14TP7Y02I7D1D | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
3300000550|F24TB_16796791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
3300000956|JGI10216J12902_103549214 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
3300001333|A21PFW6_1192700 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300001686|C688J18823_10217615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1282 | Open in IMG/M |
3300002070|JGI24750J21931_1074317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 558 | Open in IMG/M |
3300004479|Ga0062595_100409550 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
3300004643|Ga0062591_100945856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 813 | Open in IMG/M |
3300004643|Ga0062591_101645869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 648 | Open in IMG/M |
3300005171|Ga0066677_10320618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 887 | Open in IMG/M |
3300005171|Ga0066677_10831169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
3300005178|Ga0066688_10115974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1651 | Open in IMG/M |
3300005178|Ga0066688_10783958 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300005186|Ga0066676_11183341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
3300005329|Ga0070683_100437744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1247 | Open in IMG/M |
3300005330|Ga0070690_100983348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 664 | Open in IMG/M |
3300005332|Ga0066388_103524455 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300005334|Ga0068869_101078674 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300005338|Ga0068868_100992353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 768 | Open in IMG/M |
3300005341|Ga0070691_10813280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 570 | Open in IMG/M |
3300005439|Ga0070711_100109496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 2025 | Open in IMG/M |
3300005439|Ga0070711_100247147 | All Organisms → cellular organisms → Bacteria | 1397 | Open in IMG/M |
3300005467|Ga0070706_101911659 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300005468|Ga0070707_100008142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 9725 | Open in IMG/M |
3300005526|Ga0073909_10299070 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300005532|Ga0070739_10408020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 630 | Open in IMG/M |
3300005545|Ga0070695_101875403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
3300005555|Ga0066692_10848459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 561 | Open in IMG/M |
3300005556|Ga0066707_10248428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1160 | Open in IMG/M |
3300005556|Ga0066707_10896201 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300005558|Ga0066698_10235611 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
3300005560|Ga0066670_10655877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 637 | Open in IMG/M |
3300005561|Ga0066699_10177504 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
3300005563|Ga0068855_101475766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 699 | Open in IMG/M |
3300005566|Ga0066693_10115337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 982 | Open in IMG/M |
3300005566|Ga0066693_10138267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 908 | Open in IMG/M |
3300005568|Ga0066703_10345192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 895 | Open in IMG/M |
3300005568|Ga0066703_10774981 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300005587|Ga0066654_10876627 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300005616|Ga0068852_102162737 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300005764|Ga0066903_103798283 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300005764|Ga0066903_107650649 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300005764|Ga0066903_108830041 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300005840|Ga0068870_10924840 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300005937|Ga0081455_10030991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4847 | Open in IMG/M |
3300005993|Ga0080027_10231471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 726 | Open in IMG/M |
3300006032|Ga0066696_10176468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1350 | Open in IMG/M |
3300006032|Ga0066696_10839495 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300006032|Ga0066696_10998460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 532 | Open in IMG/M |
3300006046|Ga0066652_101004310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 792 | Open in IMG/M |
3300006046|Ga0066652_101190336 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300006173|Ga0070716_100793209 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300006173|Ga0070716_101713577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
3300006175|Ga0070712_100584853 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
3300006577|Ga0074050_11165675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 536 | Open in IMG/M |
3300006797|Ga0066659_10782575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 787 | Open in IMG/M |
3300006800|Ga0066660_10489803 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
3300006806|Ga0079220_10943277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 676 | Open in IMG/M |
3300006852|Ga0075433_11655269 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300006871|Ga0075434_101077917 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
3300007076|Ga0075435_100118213 | All Organisms → cellular organisms → Bacteria | 2210 | Open in IMG/M |
3300009012|Ga0066710_100171718 | All Organisms → cellular organisms → Bacteria | 3049 | Open in IMG/M |
3300009038|Ga0099829_11096140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 660 | Open in IMG/M |
3300009098|Ga0105245_11314627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 772 | Open in IMG/M |
3300009098|Ga0105245_12627346 | Not Available | 557 | Open in IMG/M |
3300009100|Ga0075418_10335540 | All Organisms → cellular organisms → Bacteria | 1613 | Open in IMG/M |
3300009100|Ga0075418_10648312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1137 | Open in IMG/M |
3300009137|Ga0066709_100760232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1400 | Open in IMG/M |
3300009137|Ga0066709_100905169 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
3300009156|Ga0111538_11244108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 940 | Open in IMG/M |
3300009156|Ga0111538_11279353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 926 | Open in IMG/M |
3300009156|Ga0111538_13548771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 541 | Open in IMG/M |
3300009176|Ga0105242_10318292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1426 | Open in IMG/M |
3300009545|Ga0105237_11397049 | Not Available | 706 | Open in IMG/M |
3300009551|Ga0105238_11422472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 721 | Open in IMG/M |
3300009789|Ga0126307_10433561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1060 | Open in IMG/M |
3300009789|Ga0126307_10863262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 731 | Open in IMG/M |
3300010042|Ga0126314_10296455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1153 | Open in IMG/M |
3300010046|Ga0126384_12471367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
3300010152|Ga0126318_10727626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 560 | Open in IMG/M |
3300010323|Ga0134086_10390781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
3300010325|Ga0134064_10223663 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300010333|Ga0134080_10423347 | Not Available | 620 | Open in IMG/M |
3300010333|Ga0134080_10690536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
3300010337|Ga0134062_10756344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
3300010371|Ga0134125_11553315 | Not Available | 720 | Open in IMG/M |
3300010375|Ga0105239_13602643 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300010376|Ga0126381_100691866 | Not Available | 1458 | Open in IMG/M |
3300010376|Ga0126381_105079402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
3300010396|Ga0134126_11649281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 705 | Open in IMG/M |
3300010398|Ga0126383_10076552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2902 | Open in IMG/M |
3300010400|Ga0134122_12215291 | Not Available | 593 | Open in IMG/M |
3300011269|Ga0137392_10639848 | Not Available | 882 | Open in IMG/M |
3300011270|Ga0137391_10919432 | Not Available | 715 | Open in IMG/M |
3300012014|Ga0120159_1060264 | Not Available | 1167 | Open in IMG/M |
3300012189|Ga0137388_11387876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 641 | Open in IMG/M |
3300012199|Ga0137383_10289843 | Not Available | 1199 | Open in IMG/M |
3300012200|Ga0137382_11128955 | Not Available | 559 | Open in IMG/M |
3300012205|Ga0137362_10869837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 770 | Open in IMG/M |
3300012208|Ga0137376_10212090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1677 | Open in IMG/M |
3300012208|Ga0137376_11507377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
3300012209|Ga0137379_11184657 | Not Available | 670 | Open in IMG/M |
3300012209|Ga0137379_11494811 | Not Available | 576 | Open in IMG/M |
3300012210|Ga0137378_10573529 | Not Available | 1037 | Open in IMG/M |
3300012210|Ga0137378_10994689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
3300012210|Ga0137378_11422232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 606 | Open in IMG/M |
3300012211|Ga0137377_11756433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 541 | Open in IMG/M |
3300012212|Ga0150985_100434699 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300012350|Ga0137372_10093047 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2543 | Open in IMG/M |
3300012350|Ga0137372_11215708 | Not Available | 508 | Open in IMG/M |
3300012353|Ga0137367_10134337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1811 | Open in IMG/M |
3300012354|Ga0137366_10930184 | Not Available | 610 | Open in IMG/M |
3300012355|Ga0137369_10287102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1227 | Open in IMG/M |
3300012356|Ga0137371_10082389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2497 | Open in IMG/M |
3300012358|Ga0137368_10176691 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
3300012358|Ga0137368_10489295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 794 | Open in IMG/M |
3300012358|Ga0137368_10956656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 517 | Open in IMG/M |
3300012359|Ga0137385_11618811 | Not Available | 511 | Open in IMG/M |
3300012360|Ga0137375_10889371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 708 | Open in IMG/M |
3300012363|Ga0137390_11199467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 706 | Open in IMG/M |
3300012896|Ga0157303_10179118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 594 | Open in IMG/M |
3300012897|Ga0157285_10067564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 914 | Open in IMG/M |
3300012898|Ga0157293_10025769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1140 | Open in IMG/M |
3300012899|Ga0157299_10153217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 653 | Open in IMG/M |
3300012905|Ga0157296_10095298 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300012923|Ga0137359_10028357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 4792 | Open in IMG/M |
3300012951|Ga0164300_10170617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1039 | Open in IMG/M |
3300012955|Ga0164298_11503371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 526 | Open in IMG/M |
3300012958|Ga0164299_11663422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
3300012960|Ga0164301_10139035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1467 | Open in IMG/M |
3300012960|Ga0164301_11684428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 529 | Open in IMG/M |
3300012961|Ga0164302_11583690 | Not Available | 544 | Open in IMG/M |
3300012972|Ga0134077_10034615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1811 | Open in IMG/M |
3300012975|Ga0134110_10516108 | Not Available | 545 | Open in IMG/M |
3300012977|Ga0134087_10638081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 556 | Open in IMG/M |
3300012989|Ga0164305_10118469 | All Organisms → cellular organisms → Bacteria | 1738 | Open in IMG/M |
3300012989|Ga0164305_10382586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1071 | Open in IMG/M |
3300013100|Ga0157373_10954347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 638 | Open in IMG/M |
3300013105|Ga0157369_10075031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3626 | Open in IMG/M |
3300013297|Ga0157378_12705511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 549 | Open in IMG/M |
3300013765|Ga0120172_1015057 | All Organisms → cellular organisms → Bacteria | 2362 | Open in IMG/M |
3300014157|Ga0134078_10237756 | Not Available | 759 | Open in IMG/M |
3300014157|Ga0134078_10295905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 695 | Open in IMG/M |
3300014157|Ga0134078_10415570 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300014314|Ga0075316_1104134 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300014325|Ga0163163_10491085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1289 | Open in IMG/M |
3300014497|Ga0182008_10141224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1205 | Open in IMG/M |
3300014968|Ga0157379_10158790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2041 | Open in IMG/M |
3300014968|Ga0157379_11011650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 793 | Open in IMG/M |
3300015077|Ga0173483_10396719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 707 | Open in IMG/M |
3300015264|Ga0137403_11467958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 532 | Open in IMG/M |
3300015265|Ga0182005_1209400 | Not Available | 589 | Open in IMG/M |
3300015357|Ga0134072_10252386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 636 | Open in IMG/M |
3300015359|Ga0134085_10166180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 941 | Open in IMG/M |
3300015359|Ga0134085_10547324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
3300015371|Ga0132258_11503064 | Not Available | 1701 | Open in IMG/M |
3300015372|Ga0132256_101242533 | Not Available | 858 | Open in IMG/M |
3300015372|Ga0132256_103284559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
3300015373|Ga0132257_100056709 | All Organisms → cellular organisms → Bacteria | 4383 | Open in IMG/M |
3300015373|Ga0132257_100835631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1151 | Open in IMG/M |
3300015373|Ga0132257_101023701 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
3300015373|Ga0132257_103574670 | Not Available | 566 | Open in IMG/M |
3300015374|Ga0132255_100181576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2964 | Open in IMG/M |
3300015374|Ga0132255_103647215 | Not Available | 655 | Open in IMG/M |
3300016319|Ga0182033_10383825 | Not Available | 1183 | Open in IMG/M |
3300017937|Ga0187809_10182409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 738 | Open in IMG/M |
3300017959|Ga0187779_10112634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1649 | Open in IMG/M |
3300017974|Ga0187777_10234021 | Not Available | 1244 | Open in IMG/M |
3300017974|Ga0187777_11485151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 502 | Open in IMG/M |
3300018027|Ga0184605_10417264 | Not Available | 597 | Open in IMG/M |
3300018028|Ga0184608_10095353 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
3300018054|Ga0184621_10110127 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
3300018060|Ga0187765_10288768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 979 | Open in IMG/M |
3300018061|Ga0184619_10148900 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
3300018061|Ga0184619_10218121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 877 | Open in IMG/M |
3300018061|Ga0184619_10270005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 781 | Open in IMG/M |
3300018064|Ga0187773_10111778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1361 | Open in IMG/M |
3300018071|Ga0184618_10172986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 893 | Open in IMG/M |
3300018071|Ga0184618_10373032 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300018076|Ga0184609_10210438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 907 | Open in IMG/M |
3300018431|Ga0066655_10794809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 643 | Open in IMG/M |
3300018468|Ga0066662_10610638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1023 | Open in IMG/M |
3300019878|Ga0193715_1062607 | Not Available | 789 | Open in IMG/M |
3300019886|Ga0193727_1053005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1304 | Open in IMG/M |
3300019888|Ga0193751_1157397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 808 | Open in IMG/M |
3300020018|Ga0193721_1029548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1450 | Open in IMG/M |
3300020080|Ga0206350_11615297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
3300021078|Ga0210381_10051366 | Not Available | 1236 | Open in IMG/M |
3300021377|Ga0213874_10023223 | Not Available | 1728 | Open in IMG/M |
3300021560|Ga0126371_12340242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 646 | Open in IMG/M |
3300022694|Ga0222623_10239408 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300022737|Ga0247747_1006235 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
3300022899|Ga0247795_1011501 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
3300024290|Ga0247667_1014295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1577 | Open in IMG/M |
3300024331|Ga0247668_1063084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 749 | Open in IMG/M |
3300025898|Ga0207692_10196180 | Not Available | 1184 | Open in IMG/M |
3300025905|Ga0207685_10079011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1356 | Open in IMG/M |
3300025910|Ga0207684_10023478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5266 | Open in IMG/M |
3300025911|Ga0207654_11137818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 569 | Open in IMG/M |
3300025916|Ga0207663_10268777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1262 | Open in IMG/M |
3300025921|Ga0207652_10881638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 791 | Open in IMG/M |
3300025922|Ga0207646_11085438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 705 | Open in IMG/M |
3300025924|Ga0207694_11363863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 599 | Open in IMG/M |
3300025927|Ga0207687_11532201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 572 | Open in IMG/M |
3300025928|Ga0207700_10102006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2291 | Open in IMG/M |
3300025929|Ga0207664_10021904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 4762 | Open in IMG/M |
3300025929|Ga0207664_11753148 | Not Available | 543 | Open in IMG/M |
3300025931|Ga0207644_11176711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 644 | Open in IMG/M |
3300025939|Ga0207665_10672610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 813 | Open in IMG/M |
3300025941|Ga0207711_10706438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 940 | Open in IMG/M |
3300025945|Ga0207679_11994442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 528 | Open in IMG/M |
3300025990|Ga0208527_1009398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1194 | Open in IMG/M |
3300026021|Ga0208140_1021393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 902 | Open in IMG/M |
3300026023|Ga0207677_11983077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 541 | Open in IMG/M |
3300026075|Ga0207708_10240061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1457 | Open in IMG/M |
3300026078|Ga0207702_12444692 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300026300|Ga0209027_1206671 | Not Available | 632 | Open in IMG/M |
3300026308|Ga0209265_1011342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2769 | Open in IMG/M |
3300026316|Ga0209155_1009462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4273 | Open in IMG/M |
3300026324|Ga0209470_1093741 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
3300026326|Ga0209801_1285456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 596 | Open in IMG/M |
3300026331|Ga0209267_1063732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1628 | Open in IMG/M |
3300026547|Ga0209156_10111740 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
3300027821|Ga0209811_10123297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 946 | Open in IMG/M |
3300027882|Ga0209590_10764418 | Not Available | 616 | Open in IMG/M |
3300027909|Ga0209382_11955116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
3300027986|Ga0209168_10095959 | Not Available | 1533 | Open in IMG/M |
3300028047|Ga0209526_10421649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 882 | Open in IMG/M |
3300028711|Ga0307293_10005287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3418 | Open in IMG/M |
3300028716|Ga0307311_10069603 | Not Available | 955 | Open in IMG/M |
3300028718|Ga0307307_10238427 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300028719|Ga0307301_10042318 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
3300028721|Ga0307315_10183097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 645 | Open in IMG/M |
3300028771|Ga0307320_10180552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 822 | Open in IMG/M |
3300028784|Ga0307282_10208736 | Not Available | 934 | Open in IMG/M |
3300028787|Ga0307323_10287857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 591 | Open in IMG/M |
3300028787|Ga0307323_10323326 | Not Available | 553 | Open in IMG/M |
3300028793|Ga0307299_10392467 | Not Available | 520 | Open in IMG/M |
3300028799|Ga0307284_10011656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2648 | Open in IMG/M |
3300028799|Ga0307284_10106768 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
3300028814|Ga0307302_10138540 | Not Available | 1175 | Open in IMG/M |
3300028814|Ga0307302_10218228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 932 | Open in IMG/M |
3300028824|Ga0307310_10321299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 756 | Open in IMG/M |
3300028828|Ga0307312_10936661 | Not Available | 574 | Open in IMG/M |
3300028872|Ga0307314_10137704 | Not Available | 696 | Open in IMG/M |
3300028872|Ga0307314_10183670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
3300028876|Ga0307286_10007948 | All Organisms → cellular organisms → Bacteria | 3232 | Open in IMG/M |
3300028878|Ga0307278_10016028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3477 | Open in IMG/M |
3300028881|Ga0307277_10091994 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
3300028884|Ga0307308_10181859 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
3300029989|Ga0311365_10161190 | All Organisms → cellular organisms → Bacteria | 1929 | Open in IMG/M |
3300029990|Ga0311336_11924901 | Not Available | 524 | Open in IMG/M |
3300030838|Ga0311335_10049125 | Not Available | 2628 | Open in IMG/M |
3300031170|Ga0307498_10352005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 566 | Open in IMG/M |
3300031251|Ga0265327_10043670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2396 | Open in IMG/M |
3300031544|Ga0318534_10369050 | Not Available | 825 | Open in IMG/M |
3300031572|Ga0318515_10209637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1045 | Open in IMG/M |
3300031716|Ga0310813_10852758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 823 | Open in IMG/M |
3300031753|Ga0307477_10027943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3859 | Open in IMG/M |
3300031753|Ga0307477_10504193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 822 | Open in IMG/M |
3300031768|Ga0318509_10571639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 630 | Open in IMG/M |
3300031805|Ga0318497_10862836 | Not Available | 508 | Open in IMG/M |
3300031858|Ga0310892_11296226 | Not Available | 521 | Open in IMG/M |
3300031893|Ga0318536_10328463 | Not Available | 775 | Open in IMG/M |
3300031996|Ga0308176_10604573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1127 | Open in IMG/M |
3300032001|Ga0306922_11899797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 583 | Open in IMG/M |
3300032035|Ga0310911_10719823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 578 | Open in IMG/M |
3300032892|Ga0335081_10838373 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
3300032897|Ga0335071_10382415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1361 | Open in IMG/M |
3300033551|Ga0247830_11011836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces acidiscabies | 663 | Open in IMG/M |
3300033807|Ga0314866_037844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 762 | Open in IMG/M |
3300033807|Ga0314866_090490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
3300034125|Ga0370484_0138722 | Not Available | 649 | Open in IMG/M |
3300034354|Ga0364943_0175520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 780 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.16% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.11% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.14% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.05% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.25% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.25% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.89% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.53% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.17% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.81% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.81% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.81% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.81% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.44% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.44% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.44% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.44% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.08% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.08% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.08% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.08% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.08% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.08% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.08% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.72% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.72% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.72% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.72% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.72% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.72% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.72% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.72% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.72% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.36% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.36% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.36% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.36% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.36% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.36% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.36% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.36% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.36% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.36% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.36% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.36% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.36% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.36% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.36% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.36% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.36% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.36% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.36% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.36% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.36% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.36% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.36% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.36% |
Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.36% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2070309009 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001333 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-PF)- 6 month illumina | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014314 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300022737 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5 | Environmental | Open in IMG/M |
3300022899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6 | Environmental | Open in IMG/M |
3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025990 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 (SPAdes) | Environmental | Open in IMG/M |
3300026021 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPKNP_09460080 | 2070309009 | Soil | LVFNGARKLLHNQRALYIKRLLLFEPRVFLSSVPYHLP |
cont_0682.00005250 | 2166559005 | Simulated | VLVLMPELFTRGWRRLLHNQKALYVKRLLFEPHVVLASVPYQLLR |
F62_08352650 | 2170459010 | Grass Soil | MPEMIVRGWARALHNQRALYIKRLLLFEPHVILSSVPYQLFR |
4MG_04282050 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | DEQRATASSLPELSLRGWRRLLHNQRALYAKRLLLVEPNVDPGLVPYQLIR |
F24TB_167967911 | 3300000550 | Soil | PELIFTGSARLLHNQRALYIKRLLLFEPRVILASVPYRLD* |
JGI10216J12902_1035492143 | 3300000956 | Soil | IVRGADRLLHNQRALYLKRLLLFEPRVILTSVPYQLL* |
A21PFW6_11927002 | 3300001333 | Permafrost | VAVVVMPELVVRGANRLLHNQRALYLKRLLLFEPRVILTSVPFQLT* |
C688J18823_102176153 | 3300001686 | Soil | WQRLLHNQRALYVKRLLLFEPRVILSSVPYQLFR* |
JGI24750J21931_10743173 | 3300002070 | Corn, Switchgrass And Miscanthus Rhizosphere | GWRRALHNQRALYVKRLLLFEPRVILTSVPYQLLR* |
Ga0062595_1004095501 | 3300004479 | Soil | ELVFSGPQRLLHNQRALYIKRLLLFEPRVILTSVPYRAG* |
Ga0062591_1009458562 | 3300004643 | Soil | ELIFSGPQRLLHNQRALYIKRLLLFEPRVILTSVPYRLS* |
Ga0062591_1016458691 | 3300004643 | Soil | VNIVMPEVVVRGWARFLHNQRALYVKRLLLFERHVILSSVPYQLFR* |
Ga0066677_103206182 | 3300005171 | Soil | VMPELVVRGPTRVLHNQRALYLKRLLLFEPRVILASVPYQLLR* |
Ga0066677_108311692 | 3300005171 | Soil | VAAVMPEIVVRGRSRLLHNQRALYVKRLLLFEPRVLLTSVPYQLFR* |
Ga0066688_101159741 | 3300005178 | Soil | MPELVVRGLSRALHNQKALYLKRLLLFEPHVILASVPYQLMR* |
Ga0066688_107839581 | 3300005178 | Soil | ELIFSGPQRLLHNQRALYIKRLLLFEPRVILSSVPYSLG* |
Ga0066676_111833412 | 3300005186 | Soil | MPELIFRGWRRLLHNQRAVYVKRLLLFEPRVILATVPYPLN* |
Ga0070683_1004377441 | 3300005329 | Corn Rhizosphere | MPEVVVRGWARVLHNQRALYIKRLLLFERHVILSSVPYQLFR* |
Ga0070690_1009833482 | 3300005330 | Switchgrass Rhizosphere | VMPELVFGGMSRALHNQRALYIKRLLLFEPRVILASVPYRLD* |
Ga0066388_1035244552 | 3300005332 | Tropical Forest Soil | ELTADESTVVLVVMPEIVTRGWRRLLHNHRALYIKRLLLLEPGVILASVPYQVL* |
Ga0068869_1010786743 | 3300005334 | Miscanthus Rhizosphere | MPELVVRGTDRLLHNQRALYLKRLLLFEPRVILTSVPFQLT* |
Ga0068868_1009923533 | 3300005338 | Miscanthus Rhizosphere | VLVVVPELVVRGPARLLHNQRALYVKRLLLFEPRVVLAAVPFQLG* |
Ga0070691_108132802 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | PELIFSGPQRLMHNQRALYVKRLLLFEPRVILTAVPYRLT* |
Ga0070711_1001094961 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | EIVVRGWQRLLHNQRALYVKRLLLFEPRVILSSVPYQLFR* |
Ga0070711_1002471472 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LVMPELVVRGLSRVLHNRRALYLKRLLLFEPHVILASVPYQLLR* |
Ga0070706_1019116591 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | ELVTRGWRRALHNQRSLYVKRLLLFEPNVILASVPYQILR* |
Ga0070707_1000081421 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | ELVVRGLSRALHNQKALYLKRLLLFEPHVILASVPYQLLR* |
Ga0073909_102990701 | 3300005526 | Surface Soil | VVMPELVFNGARKLLHNQRALYIKRLLLFEPRVILSSVPYHLP* |
Ga0070739_104080201 | 3300005532 | Surface Soil | GTEVLVVMPELVFRGWRRLLHNQRALYVKRLLLVEPHVALASVPYQLLR* |
Ga0070695_1018754032 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LRELTAEEGTEVLVVMPELFTRGWRRLLHNQKALYVKRLLLFEPHVILASVPYQLLR* |
Ga0066692_108484592 | 3300005555 | Soil | SLAAVVMPELIVRGTDRLLHNQRAMYLKRLLLFEPRVILTSVPYQLV* |
Ga0066707_102484282 | 3300005556 | Soil | VVMPELVVRGARRVLHNQRALYLKRLLLFEPRVILVSVPYQLIR* |
Ga0066707_108962011 | 3300005556 | Soil | AVVVMPELVVRGTDRLLHNQRALYLKRLLLFEPRVILTSVPYQLL* |
Ga0066698_102356111 | 3300005558 | Soil | IFHGPSRLLHNQRALYIKRLLLFERRVILASVPYRLN* |
Ga0066670_106558771 | 3300005560 | Soil | MPELIVRGTDRLLHNQRAMYLKRLLLFEPRVILTSVPYQLV* |
Ga0066699_101775043 | 3300005561 | Soil | VLMPELVFGGTARLLHNQRALYIKRLLLFEPRVILASVPYRLD* |
Ga0068855_1014757661 | 3300005563 | Corn Rhizosphere | VMPEIVVRGWARALHNQRALYIKRLLLFEPRVILSSVPYQLFR* |
Ga0066693_101153372 | 3300005566 | Soil | GWRRLLHNQRALYVKRLLLVEPHVILASVPYQLIR* |
Ga0066693_101382671 | 3300005566 | Soil | MPEIVTRGWRRVLHNHRALYVKRLLLLEPGVVLASVPYQVL* |
Ga0066703_103451921 | 3300005568 | Soil | VVMPELVVRGASRVLHNQRALYFKRLLLFEPRVILVSVPYQLIR* |
Ga0066703_107749811 | 3300005568 | Soil | GGDDVLVVLPELILRGWARLLHNQRALYVKRLLLVEPHVILASVPYQLIR* |
Ga0066654_108766272 | 3300005587 | Soil | LRGWARVLHNQRALYVKRLLLVEPNVILASVPYQLLR* |
Ga0068852_1021627372 | 3300005616 | Corn Rhizosphere | LTAEDRDVLVVLPELILRGWRRLLHNQRALYVKRLLLVEPHVILASVPYQLIR* |
Ga0066903_1037982832 | 3300005764 | Tropical Forest Soil | ELIVRGTDRLLHNQRALYLKRLLLFEPQVILTSVPFQLT* |
Ga0066903_1076506492 | 3300005764 | Tropical Forest Soil | GTDRLLHNQRALYLKRLLLFEPRVILTSVPFQLT* |
Ga0066903_1088300411 | 3300005764 | Tropical Forest Soil | WRRLLHNQRALYLKRLLLFEPNVVLLSVPYQLLR* |
Ga0068870_109248401 | 3300005840 | Miscanthus Rhizosphere | VMPELVFTGVRKLLHNQRALYIKRLLLFEPRVFLSSVPYHLP* |
Ga0081455_100309911 | 3300005937 | Tabebuia Heterophylla Rhizosphere | NGVRKLLHNQRALYIKRLLLFEPNVLLTSVPYHLP* |
Ga0080027_102314711 | 3300005993 | Prmafrost Soil | EPGTVVNLVMPEIVVRGRARLLHNQRALYIKRLLLFEPHVILSSVPYQIFR* |
Ga0066696_101764681 | 3300006032 | Soil | EIVVRGRSRLLHNQRALYVKRLLLFEPHVLLTSVPYQLFR* |
Ga0066696_108394952 | 3300006032 | Soil | LVMPELVVRGLSRVLHNQKALYVKRLLLFEPHVILASVPYQLLR* |
Ga0066696_109984602 | 3300006032 | Soil | VRGWARLLHNQRALYLKRLLLFEPHIILSSVPYQLFR* |
Ga0066652_1010043102 | 3300006046 | Soil | LVVRGADRLLHNQRALYLKRLLLFEPQVILTSVPYQLS* |
Ga0066652_1011903362 | 3300006046 | Soil | RGWRRLLHNQKALYVKRLLLFESNVILASVPYQLLR* |
Ga0070716_1007932092 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LVVLPELILRGWARLLHNQRALYVKRLLLVEPHVILASVPYQLIR* |
Ga0070716_1017135772 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | EVLVVMPELFTRGWRRLLHNQKALYVKRLLLFEPHVILASVPYQLLR* |
Ga0070712_1005848531 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | TVVNIVMPEMVVRGSARLLHNQRALYIKRLLLFERHVILSSVPYQLFR* |
Ga0074050_111656751 | 3300006577 | Soil | ELIFSGLSRTLHNQRALYIKRLLLFEPRVILSSVPYRLD* |
Ga0066659_107825751 | 3300006797 | Soil | PEIVVRGRSRLLHNQRALYVKRLLLFEPRVILTSVPYQLLR* |
Ga0066660_104898033 | 3300006800 | Soil | ELIFRGRQRLLHNQRALYIKRLLLFEERVILTAVPYRLN* |
Ga0079220_109432771 | 3300006806 | Agricultural Soil | LRGWRRLLHNQRALYVKRLLLVEPNVILASVPYHLIR* |
Ga0075433_116552692 | 3300006852 | Populus Rhizosphere | ELTADGRTEVVLVMPELVVRGLSRVLHNRRALYLKRLLLFEPHVILASVPYQLLR* |
Ga0075434_1010779171 | 3300006871 | Populus Rhizosphere | AITDDGRDVLVVLPELILRGWARLLHNQRALYVKRLLIVEPHVILASVPYQLIR* |
Ga0075435_1001182131 | 3300007076 | Populus Rhizosphere | NVVMPEIVVRGWARLLHNQRALYIKRLLLFEKHVILSSVPYQVFR* |
Ga0066710_1001717183 | 3300009012 | Grasslands Soil | MPELVLNGPRKHLHNQRALYVKRLLLFEPRVILISVPYQLPR |
Ga0099829_110961401 | 3300009038 | Vadose Zone Soil | FSGLARTLHNQRALYVKRLLLFEPRVVLSSVPYRLD* |
Ga0105245_113146272 | 3300009098 | Miscanthus Rhizosphere | VVMPELVFSGMARALHNQRALYIKRLLLFEPRVILASVPYRMD* |
Ga0105245_126273461 | 3300009098 | Miscanthus Rhizosphere | RGWARVLHNQRALYIKRLLLFERHVILSSVPYQLFR* |
Ga0075418_103355401 | 3300009100 | Populus Rhizosphere | VVVRGTDRLLHNQRALYLKRLLLFEPRVILTSVPFQLT* |
Ga0075418_106483122 | 3300009100 | Populus Rhizosphere | VRGWARLLHNQRALYIKRLLLFEERVVLATVPYQL* |
Ga0066709_1007602323 | 3300009137 | Grasslands Soil | MPELVLNGPRKHLHNQRALYVKRLLLFEPRVILISVPYQLPR* |
Ga0066709_1009051692 | 3300009137 | Grasslands Soil | VAVVVMPELVVRGTDRLPHNQRALYLKRLLLFEPRVILTSVPFQLT* |
Ga0111538_112441081 | 3300009156 | Populus Rhizosphere | TADDTAVNVVMPELVLRGRARLLHNQRALYLKRLLLFERRIILSSVPYQLFR* |
Ga0111538_112793533 | 3300009156 | Populus Rhizosphere | VVMPELVFNGARKLLHNQRALYIKRLLLFEPRVVLSTVPYHLP* |
Ga0111538_135487711 | 3300009156 | Populus Rhizosphere | MPELVVRGWARLLHNQRALYIKRLLLFEERVVLATVPYQL* |
Ga0105242_103182923 | 3300009176 | Miscanthus Rhizosphere | VVMPELVFHGMRKVLHNQRALYIKRLLLFERRVILSSVPYHLP* |
Ga0105237_113970492 | 3300009545 | Corn Rhizosphere | YTRGWRRLLHNQKALYVKRLLLFEPHVILASVPYQLLR* |
Ga0105238_114224722 | 3300009551 | Corn Rhizosphere | RGWRRLLHNQRALYVKRLLLLEPNVLLASVPYPLVR* |
Ga0126307_104335613 | 3300009789 | Serpentine Soil | ELRIHGLPRVLHSQAALYIKRLLLFEPRIILTSVPYRLE* |
Ga0126307_108632623 | 3300009789 | Serpentine Soil | PGIAVNVLMPELVLRGRARLLHNQRALYIKRLLLFEQRVILSSVPYQLFR* |
Ga0126314_102964553 | 3300010042 | Serpentine Soil | ELVLRGRARLLHNQRALYIKRLLLFERRVILSSVPYQLFR* |
Ga0126384_124713671 | 3300010046 | Tropical Forest Soil | LIFSGPQRLLHNQRALYIKRLLLFEPRVILTSVPYRLD* |
Ga0126318_107276262 | 3300010152 | Soil | RGWARFLHNQRALYIKRLLLFEPHVILSSVPYQLFR* |
Ga0134086_103907812 | 3300010323 | Grasslands Soil | LHDLTEDGRTEVVLVMPELVVRGLSRALHNQKALYLKRLLLFEPHVILASVPYQLIK* |
Ga0134064_102236632 | 3300010325 | Grasslands Soil | GPSRLLHNQRALYIKRLLLFEPRVILASVPYRLN* |
Ga0134080_104233471 | 3300010333 | Grasslands Soil | VLLPELVTRGRRRLLQNQRALYIKRLLLFGPDAVLASVPYQLLREPD* |
Ga0134080_106905362 | 3300010333 | Grasslands Soil | EGQDVLVVLPEVILRGWRRLLHNQRALYVKRLLLVEPHVILASVPYQLIR* |
Ga0134062_107563442 | 3300010337 | Grasslands Soil | VLNRAQRLLHNQRALYIKRLLLFEPRVILTSVPYRLG* |
Ga0134125_115533152 | 3300010371 | Terrestrial Soil | VLVLMPELFTRGWRRLLHNQKALYVKRLLLFEPHVILASVPYQLLR* |
Ga0105239_136026432 | 3300010375 | Corn Rhizosphere | VRGWRRLLHNQRALYVKRLLLFEPRVILSSVPYQLFR* |
Ga0126381_1006918661 | 3300010376 | Tropical Forest Soil | LIFRGWRRLLHNQRAIYIKRLLLFEPRVILVTVPYRLN* |
Ga0126381_1050794021 | 3300010376 | Tropical Forest Soil | EIVVGGMRRVLHNQRALYVKRMLLFEPRVILSAVPYQLV* |
Ga0134126_116492811 | 3300010396 | Terrestrial Soil | LLFTGPLRLLHNQRALYVKRLLLFEPRVILTAVPYRLT* |
Ga0126383_100765524 | 3300010398 | Tropical Forest Soil | PEVVVRGWSRLLHNQRALYVKRLLLFEPHVILSSVPTQAAA* |
Ga0134122_122152911 | 3300010400 | Terrestrial Soil | PELVVRGWRRLLHNQRALYVKRLLLFEPNVVLAAVPYQLLR* |
Ga0137392_106398482 | 3300011269 | Vadose Zone Soil | LVLMPELFVRGWRRLLHNQKALYVKRLLLFEPHVILASVPYQLLR* |
Ga0137391_109194321 | 3300011270 | Vadose Zone Soil | AEEGTEVLVLMPELFVRGWRRLLHNQKALYVKRLLLFEPHVILASVPYQLLR* |
Ga0120159_10602642 | 3300012014 | Permafrost | TRGWRRLLHNQKALYVKRLLLFEPHVILASVPYQLLR* |
Ga0137388_113878762 | 3300012189 | Vadose Zone Soil | MPELVVRGTDRLLHNQRALYMKRLLLFEPRVILTSVPYQLL* |
Ga0137383_102898431 | 3300012199 | Vadose Zone Soil | LSRALHNQKALYLKRLLLFEPHVILASVPYQLLR* |
Ga0137382_111289551 | 3300012200 | Vadose Zone Soil | WARALHNQRALYVKRLLLFERHVILSSVPYQLFR* |
Ga0137362_108698372 | 3300012205 | Vadose Zone Soil | PELVVRGASRVLHNQRALYFKRLLLFEPRVILVSVPYQLIR* |
Ga0137376_102120902 | 3300012208 | Vadose Zone Soil | VMPELFTRGWRRLLHNQKALYVKRLLLFEPHVILASVPYQLLR* |
Ga0137376_115073771 | 3300012208 | Vadose Zone Soil | VHGWARLLHNQRALYVKRLLLFEPHVVLASVPYQLP* |
Ga0137379_111846572 | 3300012209 | Vadose Zone Soil | GWRRLLHNQKALYVKRLLLFEPHVILASVPYQLLR* |
Ga0137379_114948111 | 3300012209 | Vadose Zone Soil | IFSGPQRLLHNQRALYIKRLLLFEPRVILTSVPYRLD* |
Ga0137378_105735292 | 3300012210 | Vadose Zone Soil | LVMPELVVRGLSRALHNQKALYLKRLLLFEPHVILASVPYQLLR* |
Ga0137378_109946891 | 3300012210 | Vadose Zone Soil | ELVIPGWRKLLHNQRALYLKRLLLFEPRVVLSSVPYHLP* |
Ga0137378_114222321 | 3300012210 | Vadose Zone Soil | LNVVMPEVVVRGWARVLHNQRALYIKRLLLFERHVILSSVPYQFFR* |
Ga0137377_117564331 | 3300012211 | Vadose Zone Soil | PESVAVVVMPELIVRGTDRLLHNQRALYLKRLLIFEPRVILASVPYQLV* |
Ga0150985_1004346993 | 3300012212 | Avena Fatua Rhizosphere | IGLRSLLSVHGPARLLHNQRAFYVKRLLLFEPRVVLASVPYQLR* |
Ga0137372_100930475 | 3300012350 | Vadose Zone Soil | VRGTDRLLHNQRALYLKRLLIFEPRVILASVPYQLV* |
Ga0137372_112157082 | 3300012350 | Vadose Zone Soil | RTEVVLVLPELVVRGLSRALHNQKALYLKRLLLFEPHVILASVPYQLLR* |
Ga0137367_101343373 | 3300012353 | Vadose Zone Soil | FSGPQRLLHNQRALYIKRLLLFEPRVILTSVPYRLG* |
Ga0137366_109301841 | 3300012354 | Vadose Zone Soil | SGSQRLLHNQRALYIKRLLLFEPRVILTSVPYRLD* |
Ga0137369_102871023 | 3300012355 | Vadose Zone Soil | RGRRPLLHNQRALYIKPLLRFAPRVILASVPYRLN* |
Ga0137371_100823891 | 3300012356 | Vadose Zone Soil | VAIMPELIFSGAARLLHNQRALYIKRLLLFEPRVILTSVPYRLN* |
Ga0137368_101766911 | 3300012358 | Vadose Zone Soil | PELIFSGPQRLLHNQRALYIKRLLLFEPQVILTSVPYRLG* |
Ga0137368_104892952 | 3300012358 | Vadose Zone Soil | ELIVRGTDRLLHNQRALYLKRLLIFEPRVILASVPYQLV* |
Ga0137368_109566562 | 3300012358 | Vadose Zone Soil | VAVVIMPELIFRGWRRLLHNQRALYIKRLLVFEPRVILASVPYRLN* |
Ga0137385_116188112 | 3300012359 | Vadose Zone Soil | EVVLVMPELVVRGLSRALHNQKALYLKRLLLFEPHVILASVPYQLLR* |
Ga0137375_108893711 | 3300012360 | Vadose Zone Soil | RNVAVVVMPELVFHGWRRLLHNQRAFYVKRLLLFEPRVVLAAVPYSLD* |
Ga0137390_111994672 | 3300012363 | Vadose Zone Soil | VVVMPELVVRGTDRLLHNQRALYMKRLLLFEPRVILTSVPYQLL* |
Ga0157303_101791182 | 3300012896 | Soil | RELTGSGHDVLVVLPELILRGWARLLHNQRALYVKRLLLVEPHVILASVPYQLIR* |
Ga0157285_100675643 | 3300012897 | Soil | MLEPVVHGWKPLLHNQRALYVKRLLLFEPRTTLSSVPYQLS* |
Ga0157293_100257693 | 3300012898 | Soil | AVVVMPELVFSGVRKLLHNQRALYIKRLLLFEPRVFLSSVPYHLP* |
Ga0157299_101532171 | 3300012899 | Soil | GPQRLMHNQRALYVKRLLLFEPHVILTAVPYRLT* |
Ga0157296_100952982 | 3300012905 | Soil | VFSGPQRLLHNQRALYIKRLLLFEPRVILTSVPYRLS* |
Ga0137359_100283576 | 3300012923 | Vadose Zone Soil | MPELVTRGWARLLHNQRALYIKRLLLVEPGVILASVPYQLL* |
Ga0164300_101706171 | 3300012951 | Soil | SGLSRTLHNQRALYIKRLLLFEPRVILASVPYRMD* |
Ga0164298_115033712 | 3300012955 | Soil | LMPELVTRGWRRLLHNQRALYVKRLLLFEPNVILAAVPYQLLR* |
Ga0164299_116634222 | 3300012958 | Soil | LPELILRGWRRLLHNQRALYVKRLLLVEPNVILASVPYQLIR* |
Ga0164301_101390353 | 3300012960 | Soil | LVVLPELILRGWRRLLHNQRALYVKRLLLVEPNVILASVPYQLIR* |
Ga0164301_116844282 | 3300012960 | Soil | EAMAIVVMPELVVRGVDRLLHHQRALYLKRLLLFEPRVILASVPYQLL* |
Ga0164302_115836901 | 3300012961 | Soil | GWARVLHNQRALYIKRLLLFERHVILSSVPYQLFR* |
Ga0134077_100346151 | 3300012972 | Grasslands Soil | VVVMPELIFRGWRRLLHNQRAVYVKRLLLFEPRVILATVPYPLN* |
Ga0134110_105161082 | 3300012975 | Grasslands Soil | FTRGWRRLLHNQKALYVKRLLLFEPHVILASVPYQLLR* |
Ga0134087_106380811 | 3300012977 | Grasslands Soil | GTDRLLHNQRALYLKRLLIFEPRVILASVPYQLV* |
Ga0164305_101184691 | 3300012989 | Soil | ELVVRGWRRALHNQRALYVKRLLLFESHVILASVPYQLVR* |
Ga0164305_103825862 | 3300012989 | Soil | GLSRSLHNQRALYIKRLLLFEPRVILTSVPYRLD* |
Ga0157373_109543471 | 3300013100 | Corn Rhizosphere | DDGHDVLVVLPELILRGWARLLHNQRALYVKRLLLVEPHVILASVPYQLLR* |
Ga0157369_100750311 | 3300013105 | Corn Rhizosphere | PELILRGWRRLLHNQRALYVKRLLLVEPNVILASVPYHLIR* |
Ga0157378_127055111 | 3300013297 | Miscanthus Rhizosphere | GRARVLHNQRALYLKRVLLFERRVMLTSVPYQLFR* |
Ga0120172_10150571 | 3300013765 | Permafrost | DGRTEAILVMPELVVRGPRRVLHNQRALYLKRLLLFEPRVILVSVPYQLMR* |
Ga0134078_102377562 | 3300014157 | Grasslands Soil | VVRGLSRALHKQRALYLKRLLLFEPNVILASVPYQLMR* |
Ga0134078_102959052 | 3300014157 | Grasslands Soil | ELTAEEQDVLVVLPEVILRGWRRLLHNQRALYVKRLLLVEPHVILASVPYQLIR* |
Ga0134078_104155702 | 3300014157 | Grasslands Soil | DDLTDDGRTEVIMVLPELVVRGASRLLHNQRALYIKRLLMFEPNVILASVPYQIMR* |
Ga0075316_11041342 | 3300014314 | Natural And Restored Wetlands | LVVLPELVLPGWRRLLHNERALYVKRLLLFEPNVVLTAVPYQIVD* |
Ga0163163_104910851 | 3300014325 | Switchgrass Rhizosphere | MPELIFSGPQRLMHNQRALYVKRLLLFEPRVILTAVPYRLT* |
Ga0182008_101412243 | 3300014497 | Rhizosphere | WARILHNQRALYIKRLLLFEQHVILSSVPYQLFR* |
Ga0157379_101587902 | 3300014968 | Switchgrass Rhizosphere | VTPPDFVPAGGAQLLHNQRALYIKRLLLFEPRVILASVPYQLIH* |
Ga0157379_110116501 | 3300014968 | Switchgrass Rhizosphere | PELVFRGWRRLLHNQRALYIKRLLIFEPRVILTAVPYRLN* |
Ga0173483_103967192 | 3300015077 | Soil | VRGVSRVLHNRRALYLKRLLLFEPHVILASVPYQLLR* |
Ga0137403_114679582 | 3300015264 | Vadose Zone Soil | IMPELVVRGWRRLPHNQRALYVKRRLLFEPRVILSSVPYQLT* |
Ga0182005_12094002 | 3300015265 | Rhizosphere | VTRGWRRLLHNQKALYVKRLLLFEPGVVLAAVPYQLLR* |
Ga0134072_102523862 | 3300015357 | Grasslands Soil | MPELIVRGTDRLLHNQRAMYLKRLLLFEPPVILTSVPYQLV* |
Ga0134085_101661801 | 3300015359 | Grasslands Soil | SRALHNQKALYLKRLLLFEPHVILASVPYQLLRS* |
Ga0134085_105473242 | 3300015359 | Grasslands Soil | PELILRGWRRLLHNQRALYVKRLLLVEPNVILASVPYQLIK* |
Ga0132258_115030642 | 3300015371 | Arabidopsis Rhizosphere | PEVVVRGWSRLLHNQRALYVKRLLLFESHVILSSVPYQLFR* |
Ga0132256_1012425332 | 3300015372 | Arabidopsis Rhizosphere | MPELVVRGWRRLLHNQRALYVKRQLLFEPNVILAAVPYQLLR* |
Ga0132256_1032845592 | 3300015372 | Arabidopsis Rhizosphere | EETLVLVVLPELVVHGVGRLLHNQRALYVKRLLLFEPGVALAAVPFRLS* |
Ga0132257_1000567097 | 3300015373 | Arabidopsis Rhizosphere | ELVVHGWKRLLHNQRALYVKRLLLFEPRTILSSVPYQLP* |
Ga0132257_1008356312 | 3300015373 | Arabidopsis Rhizosphere | WARLLHNQRALYIKRVLLFEPHVVLSSVPYQLFR* |
Ga0132257_1010237012 | 3300015373 | Arabidopsis Rhizosphere | GTDRLLHNQRALYLKRLLLFEPRVILTSVPLQLT* |
Ga0132257_1035746701 | 3300015373 | Arabidopsis Rhizosphere | LRAYLDPLTGPDRAVNVVMPEVVVRGRARLLHNQRALYVKRLLRFEPHVILSSVPYQVFR |
Ga0132255_1001815764 | 3300015374 | Arabidopsis Rhizosphere | DIGEPLRAYLDPLTSPDRAVNVVMPEVVVRGRARLLHNQRALYVKRLLLFEPHVILSSVPYQVFR* |
Ga0132255_1036472152 | 3300015374 | Arabidopsis Rhizosphere | MPELVFNGARKLLHNQRALYLKRLLLFEPRVILTSVPYQLFR* |
Ga0182033_103838252 | 3300016319 | Soil | VRGWARLLHNQRALYIKRLLLFEPRVILSSVPYQLFR |
Ga0187809_101824092 | 3300017937 | Freshwater Sediment | LVVMPELVVRGWRRLLHNQRALYVKRLLLFEPHVLLAAVPYQLLR |
Ga0187779_101126342 | 3300017959 | Tropical Peatland | VVMPEIVVRGWSRVLHNQRAIYVKRLLLFEPHVILSSVPYQLFR |
Ga0187777_102340211 | 3300017974 | Tropical Peatland | HWWQHPLHGQRGLFVKRLLLFEDRVILSSVPYKIS |
Ga0187777_114851511 | 3300017974 | Tropical Peatland | LVFSGPQRLLHNQRALYVKRLLLFEPRVILTSVPYRLS |
Ga0184605_104172642 | 3300018027 | Groundwater Sediment | EVVLVMPELVVRGLSRALHNQKALYLKRLLLFEPHVILASVPYQLMR |
Ga0184608_100953532 | 3300018028 | Groundwater Sediment | LTEDGRTEVVLVMPELVVRGLSRALHNQKALYLKRLLLFEPHVILASVPYQLLR |
Ga0184621_101101273 | 3300018054 | Groundwater Sediment | VMPELVVRGANRLLHNQRALYLKRLLLFEPRVILTSVPYRVG |
Ga0187765_102887683 | 3300018060 | Tropical Peatland | YLRDLTADEETEVLVLMPGLVTHGWRRLLHNQRSLYIKRLLLLEPGVILASVPYQILR |
Ga0184619_101489001 | 3300018061 | Groundwater Sediment | MAELVARGTDRLLHNQRALYLKRLLLFEPRVILTSVPLQLT |
Ga0184619_102181212 | 3300018061 | Groundwater Sediment | VAVVIMPELIFRGRQRLLHNQRALYIKRLLLFEERVILTAVPYRLN |
Ga0184619_102700053 | 3300018061 | Groundwater Sediment | EVAVSVLMPELVFSGSRKLLHNQRALYIKRLLLFEPRVLLSSVPYHLP |
Ga0187773_101117783 | 3300018064 | Tropical Peatland | EEGTAVLVLMPELITRGWRRLLHNQRALYIKRLLLLEPNIILASVPYQILR |
Ga0184618_101729861 | 3300018071 | Groundwater Sediment | VMPELVVRGARRVLHNQRALYLKRLLLFEPRVILVSVPYQLIR |
Ga0184618_103730321 | 3300018071 | Groundwater Sediment | SATERLLHNQRALYLKRLLLFEPRVILASAPFQLT |
Ga0184609_102104383 | 3300018076 | Groundwater Sediment | SGWRALLHNQRAFYLKRLLLFEPGIILSSVPYHLP |
Ga0066655_107948091 | 3300018431 | Grasslands Soil | ELIVRGTDRLLHNQRALYLKRLLIFEPRVILASVPYQLV |
Ga0066662_106106383 | 3300018468 | Grasslands Soil | VVSGWSRALHNQRALYLKRLLLFEPRVILSAVPYQLG |
Ga0193715_10626072 | 3300019878 | Soil | EGVLGMPELVVGGLSRALHNQRALYLKRLLLFEPRVILASVPYQLVR |
Ga0193727_10530051 | 3300019886 | Soil | GRTEVVLVMPELVVRGLSRALHNQKALYLKRLLLFEPHVILASVPYQLLR |
Ga0193751_11573971 | 3300019888 | Soil | VVMPELVTRGWRRLLHNQRALYVKRLLLLEPGVILASVPYQVL |
Ga0193721_10295481 | 3300020018 | Soil | MPELVVRGARRVLHNQRALYLKRLLLFEPRVILVSVPYQLIR |
Ga0206350_116152971 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | PEIVVRGWARLLHNQRALYIKRLLLFEPHVILSSVPYQLFR |
Ga0210381_100513661 | 3300021078 | Groundwater Sediment | PELVVRGLSRALHNQKALYLKRLLLFEPHVILASVPYQLLR |
Ga0213874_100232232 | 3300021377 | Plant Roots | RGWARLLHNQRALYIKRVLLFEPHVILSSVPYQLFR |
Ga0126371_123402422 | 3300021560 | Tropical Forest Soil | VVRGWRRLLHNQRALYLKRLLLFEPNVVLLSVPYQLLR |
Ga0222623_102394083 | 3300022694 | Groundwater Sediment | AVSVLMPELVFSGSRKLLHNQRALYIKRLLLFEPRVLLSSVPYHLP |
Ga0247747_10062351 | 3300022737 | Soil | MPEVVVRGTDRLLHNQRALYLKRLLLFEPRVILTSVPF |
Ga0247795_10115011 | 3300022899 | Soil | EVVVRGTDRLLHNQRALYLKRLLLFEPRVILTSVPFQLT |
Ga0247667_10142951 | 3300024290 | Soil | EIVVRGWARFLHNQRALYIKRLLLFEPHVILSSVPYQLFR |
Ga0247668_10630842 | 3300024331 | Soil | RGWARFLHNQRALYIKRLLLFEPHVILSSVPYQLFR |
Ga0207692_101961801 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | RGLSRVLHNRRALYLKRLLLFEPHVILASVPYQLLR |
Ga0207685_100790113 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | DPDAVAVVLMPELVFSGTGRLLHNQRALYVKRLLLFEPRVILASVPYRLD |
Ga0207684_100234781 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPELVARGVDRILHNQRALYLKRLLLFEPRVILTSVPFQLT |
Ga0207654_111378181 | 3300025911 | Corn Rhizosphere | MPEVVVRGWARVLHNQRALYIKRLLLFERHVILSSVPYQLFR |
Ga0207663_102687771 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LILRGWRRLLHNQRALYVKRLLLVEPNVILASVPYQLIR |
Ga0207652_108816381 | 3300025921 | Corn Rhizosphere | IVMPEIVVRGWARFLHNQRALYIKRLLLFEPHVILSSVPYQLFR |
Ga0207646_110854383 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | RGWARLLHNQRALYIKRLLLFEQHVILSSVPYQLFR |
Ga0207694_113638631 | 3300025924 | Corn Rhizosphere | ELVLRGWRRLLHNQRALYVKRLLLLEPNVLLASVPYPLVR |
Ga0207687_115322012 | 3300025927 | Miscanthus Rhizosphere | VVHGWRRLLHNQRALYLKRLLLFEPRVILSSVPYRL |
Ga0207700_101020061 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ELILRGWRRLLHNQRALYVKRLLLVEPNVILASVPYQLIR |
Ga0207664_100219041 | 3300025929 | Agricultural Soil | VLPELILRGWRRLLHNQRALYVKRLLLVEPNVILASVPYQLIR |
Ga0207664_117531481 | 3300025929 | Agricultural Soil | VRGWARVLHNQRALYIKRLLLFEPHVILSSVPYQLFR |
Ga0207644_111767112 | 3300025931 | Switchgrass Rhizosphere | PELILRGWRRLLHNQRALYVKRLLLVEPNVILASVPYHLIR |
Ga0207665_106726102 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | ELTDDGHDVLVVLPELILRGWARLLHNQRALYVKRLLLVEPHVILASVPYQLIR |
Ga0207711_107064383 | 3300025941 | Switchgrass Rhizosphere | DGDDVLVVLPELILRGWRRLLHNQRALYVKRLLLLEPHVLLASVPYPLVR |
Ga0207679_119944421 | 3300025945 | Corn Rhizosphere | FGGMSRALHNQRALYIKRLLLFEPRVILASVPYRLD |
Ga0208527_10093981 | 3300025990 | Rice Paddy Soil | VMPELITRGWRRALHNQRALYIKRLLLFEPGVILASVPYQVMR |
Ga0208140_10213932 | 3300026021 | Rice Paddy Soil | LITRGWRRALHNQRALYIKRLLLFEPGVILASVPYQVMR |
Ga0207677_119830771 | 3300026023 | Miscanthus Rhizosphere | PELVFTGVRKLLHNQRALYIKRLLLFEPRVFLSSVPYHLP |
Ga0207708_102400612 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | SGPQRLMHNQRALYVKRLLLFEPRVILTAVPYRLT |
Ga0207702_124446921 | 3300026078 | Corn Rhizosphere | VMPEVIVRGTDRLLHNQRALYLKRLLLFEPRVILTSVPFQLT |
Ga0209027_12066711 | 3300026300 | Grasslands Soil | PELFTRGWRRLLHNQKALYVKRLLLFEPHVILASVPYQLLR |
Ga0209265_10113422 | 3300026308 | Soil | MPELIVRGTDRLLHNQRAMYLKRLLLFEPRVILTSVPYQLV |
Ga0209155_10094624 | 3300026316 | Soil | VLVMPELVVRGLSRALHKQRALYLKRLLLFEPNVILASVPYQLMR |
Ga0209470_10937411 | 3300026324 | Soil | NGARKLLHNQRALYIKRLLLFEPRVFLSSVPYHLP |
Ga0209801_12854562 | 3300026326 | Soil | RRLTEGGRTEVVLVMPELVVRGPSRALHNQKALYLKRLLLFEPHVILASVPYQLMR |
Ga0209267_10637322 | 3300026331 | Soil | MPELVVRGLSRALHNQKALYLKRLLLFEPHVILASVPYQLMR |
Ga0209156_101117403 | 3300026547 | Soil | PELVARGTDRLLHNQRALYLKRLLLFEPRVILTSVPFQLT |
Ga0209811_101232973 | 3300027821 | Surface Soil | AVSVVMPELVFNGARKLLHNQRALYIKRLLLFEPRVILSSVPYHLP |
Ga0209590_107644181 | 3300027882 | Vadose Zone Soil | FSGPQRLLHNQRALYIKRLLLFEPRVILTSVPYRLD |
Ga0209382_119551162 | 3300027909 | Populus Rhizosphere | VVVMPELVFSGFSRSLHNQRALYIKRLLLFEPRVILASVPYRMD |
Ga0209168_100959592 | 3300027986 | Surface Soil | GWRRLLHNQRALYVKRLLLFEPGVILASVPYQLLR |
Ga0209526_104216492 | 3300028047 | Forest Soil | MPEVVTRGFRRILHNQRALYVKRLLLFEPRVILASVPYQLLR |
Ga0307293_100052871 | 3300028711 | Soil | LTEDGATEVIVVMPELVVSGPRRLLHNQRALYLKRLLLFEPGVILVSVPYQLLR |
Ga0307311_100696033 | 3300028716 | Soil | LIFSGPQRLLHNQKALYIKRLLLFEPRVILTSVPYRLD |
Ga0307307_102384272 | 3300028718 | Soil | ELVVSGPRRLLHNQRALYLKRLLLFEPGVILVSVPYQLLR |
Ga0307301_100423181 | 3300028719 | Soil | ELVVRGTDRLLHNQRALYVKRLLLFEPRVILTSVPFQLT |
Ga0307315_101830972 | 3300028721 | Soil | VVRGWARVLHNQRALYIKRLLLFERHVILSSVPYQLFR |
Ga0307320_101805521 | 3300028771 | Soil | FSGQQRLLHNQRALYIKRLLLFEPRVILTSVPYRMG |
Ga0307282_102087361 | 3300028784 | Soil | EGTEVLVVMPELFTRGWRRLLHNQKALYVKRLLLFEPHVILASVPYQLLR |
Ga0307323_102878571 | 3300028787 | Soil | ELVFRGWRRLLHNQRALYIKRLLIFEPRVILTAVPYRLN |
Ga0307323_103233261 | 3300028787 | Soil | LVTRGWRRLLHNQRALYVKRLLLFEPNVVLAAVPYQLLR |
Ga0307299_103924671 | 3300028793 | Soil | GGLSRALHNQRALYLKRLLLFEPNVILASVPYQLVR |
Ga0307284_100116561 | 3300028799 | Soil | ELVVRGARRVLHNQRALYLKRLLLFEPRVILVSVPYQLIR |
Ga0307284_101067682 | 3300028799 | Soil | MPELVVRGTDRLLHNQRALYVKRLLLFEPRVILTSVPFQLT |
Ga0307302_101385401 | 3300028814 | Soil | LVMPELVVRGLSRALHNQKALYLKRLLLFEPHVILASVPYQLLR |
Ga0307302_102182283 | 3300028814 | Soil | MPELVFNGARKLLHNQRALYIKRLLLFEPRVILSSVPYHLP |
Ga0307310_103212992 | 3300028824 | Soil | EDGATEAIVVMPELVVSGPRRLLHNQRALYLKRLLLFEPGVILVSVPYQLLR |
Ga0307312_109366611 | 3300028828 | Soil | TRGWRRLLHNQKALYVKRLLLFEPHVILASVPYQLLR |
Ga0307314_101377041 | 3300028872 | Soil | GWRRLLHNQRALYVKRLLLFEPNVVLAAVPYQLLR |
Ga0307314_101836701 | 3300028872 | Soil | SGLSRSLHNQRALYIKRLLLFEPRVILTSVPYRLD |
Ga0307286_100079482 | 3300028876 | Soil | MPELVVRGWRRALHNQRALYVKRLLLFEPHVILASVPYQLVR |
Ga0307278_100160286 | 3300028878 | Soil | VLMPELVFSGSRKLLHNQRALYIKRLLLFEPRVLLSSVPYHLP |
Ga0307277_100919943 | 3300028881 | Soil | ELIFSGPQRLLHNQRALYIKRLLLFEPRVILTSVPYRVG |
Ga0307308_101818593 | 3300028884 | Soil | LLMPELVISGSRKLLHNQRALYIKRLLLFEPRVLLSSVPYHLP |
Ga0311365_101611901 | 3300029989 | Fen | VAVVVMPELIVRGVDRMLHNQRALYLKRLLLFEPNVILASVPYQFL |
Ga0311336_119249011 | 3300029990 | Fen | EMVVRGSARLLHNQRALYIKRVLLFERHVILSSVPYQLFR |
Ga0311335_100491251 | 3300030838 | Fen | RGVDRMLHNQRALYLKRLLLFEPNVILASVPYQFL |
Ga0307498_103520052 | 3300031170 | Soil | MLELVFGGMSRALHNQRALYIKRLLLFEPRMILGSVPYRLD |
Ga0265327_100436704 | 3300031251 | Rhizosphere | PEMVVHGMARLLHNQRALYIKRMLLFERHVILSSVPYQLFR |
Ga0318534_103690503 | 3300031544 | Soil | DDARCVVILPELVVRKRWRLLHNQRAFFVKRVLLFEPRVALTSVPQALA |
Ga0318515_102096372 | 3300031572 | Soil | PELIFSGLARTLHNQRALYVKRLLLFEPQVILSSVPYRLD |
Ga0310813_108527582 | 3300031716 | Soil | VFNGTARLLHNQRALYVKRLLLFEPRVILASVPYRMD |
Ga0307477_100279435 | 3300031753 | Hardwood Forest Soil | VMPELVTRGWRRLLHNQRALYIKRLLLVEPGVILASVPYQAL |
Ga0307477_105041931 | 3300031753 | Hardwood Forest Soil | VMPELVTRGLVRVLHNQRALYIKRLLLFEPGVVLASVPYQILR |
Ga0318509_105716392 | 3300031768 | Soil | SGLTRALHNQRAIYLKRLLLFEPRVILSSVPYQLG |
Ga0318497_108628362 | 3300031805 | Soil | PEVVVAGWRELLHNQRSLYVKRLLLFEPNVVLTSVPFQIIA |
Ga0310892_112962262 | 3300031858 | Soil | EVVLVMPELVVRGLSRVLHNRRALYLKRLLLFEPHVILASVPYQLLR |
Ga0318536_103284631 | 3300031893 | Soil | PELVVRGIDRILHNHRALYFKRLLLFEPRVILASVPYRLL |
Ga0308176_106045731 | 3300031996 | Soil | ELVLRGWARLLHNQRALYIKRLLLVEPNVILASVPYPLVR |
Ga0306922_118997971 | 3300032001 | Soil | RGWARVLHNQRALYLKRLLLFEPRVILSSVPYQFLR |
Ga0310911_107198232 | 3300032035 | Soil | EIVVGGLRRVLHNQRALYVKRMLLFEPRVILSAVPYQLD |
Ga0335081_108383731 | 3300032892 | Soil | RHWWQQPLHGQRGLFVKRLLLFEERVILSSVPYRIP |
Ga0335071_103824151 | 3300032897 | Soil | LPELITPGWRRLLHNQRALYIKRLLLLEPGVILASVPYQLLR |
Ga0247830_110118363 | 3300033551 | Soil | LDLERQRLLHNQRALYIKRLLLFEPRVIVVDVPYRLN |
Ga0314866_037844_276_404 | 3300033807 | Peatland | MPELIVPGWRRLLHNQRALYIKRLLLLEPGVILASVPYQLLR |
Ga0314866_090490_398_526 | 3300033807 | Peatland | MPEIVVRGSVRLLHNQRALYIKRLLLFEPHVILSSVPYQLFR |
Ga0370484_0138722_3_131 | 3300034125 | Untreated Peat Soil | MPEMVVRGTARLLHNQRALYIKRVLLFERHVILSSVPYQLFR |
Ga0364943_0175520_672_779 | 3300034354 | Sediment | SGLSRSLHNQRALYIKRLLLFEPRVILSSVPYRLD |
⦗Top⦘ |