NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F012790

Metagenome / Metatranscriptome Family F012790

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F012790
Family Type Metagenome / Metatranscriptome
Number of Sequences 277
Average Sequence Length 43 residues
Representative Sequence DLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGRLLAPAA
Number of Associated Samples 175
Number of Associated Scaffolds 277

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.61 %
% of genes near scaffold ends (potentially truncated) 92.06 %
% of genes from short scaffolds (< 2000 bps) 94.95 %
Associated GOLD sequencing projects 162
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (53.069 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(41.516 % of family members)
Environment Ontology (ENVO) Unclassified
(53.430 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(42.960 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 24.64%    β-sheet: 8.70%    Coil/Unstructured: 66.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 277 Family Scaffolds
PF04545Sigma70_r4 1.44
PF01022HTH_5 1.44
PF08002DUF1697 1.08
PF06689zf-C4_ClpX 1.08
PF08044DUF1707 1.08
PF07676PD40 0.72
PF03466LysR_substrate 0.72
PF12697Abhydrolase_6 0.72
PF07883Cupin_2 0.72
PF01872RibD_C 0.72
PF10137TIR-like 0.72
PF01381HTH_3 0.72
PF00248Aldo_ket_red 0.72
PF13302Acetyltransf_3 0.72
PF05988DUF899 0.72
PF12307DUF3631 0.72
PF01738DLH 0.72
PF04542Sigma70_r2 0.72
PF03167UDG 0.72
PF00196GerE 0.72
PF00797Acetyltransf_2 0.36
PF03631Virul_fac_BrkB 0.36
PF01695IstB_IS21 0.36
PF01212Beta_elim_lyase 0.36
PF13808DDE_Tnp_1_assoc 0.36
PF07929PRiA4_ORF3 0.36
PF00589Phage_integrase 0.36
PF01323DSBA 0.36
PF00872Transposase_mut 0.36
PF00543P-II 0.36
PF07724AAA_2 0.36
PF08757CotH 0.36
PF13358DDE_3 0.36
PF01914MarC 0.36
PF14117DUF4287 0.36
PF11946DUF3463 0.36
PF07690MFS_1 0.36
PF14015DUF4231 0.36
PF00171Aldedh 0.36
PF04402SIMPL 0.36
PF13193AMP-binding_C 0.36
PF04185Phosphoesterase 0.36
PF00571CBS 0.36
PF04149DUF397 0.36
PF13191AAA_16 0.36
PF06441EHN 0.36
PF00149Metallophos 0.36
PF01145Band_7 0.36
PF01734Patatin 0.36
PF03703bPH_2 0.36
PF00583Acetyltransf_1 0.36
PF13474SnoaL_3 0.36
PF13489Methyltransf_23 0.36
PF00449Urease_alpha 0.36
PF09335SNARE_assoc 0.36
PF06742DUF1214 0.36
PF13472Lipase_GDSL_2 0.36
PF13602ADH_zinc_N_2 0.36
PF00174Oxidored_molyb 0.36
PF01243Putative_PNPOx 0.36
PF01522Polysacc_deac_1 0.36
PF10517DM13 0.36
PF12796Ank_2 0.36
PF01494FAD_binding_3 0.36
PF14333DUF4389 0.36

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 277 Family Scaffolds
COG3797Uncharacterized conserved protein, DUF1697 familyFunction unknown [S] 1.08
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 0.72
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.72
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.72
COG1573Uracil-DNA glycosylaseReplication, recombination and repair [L] 0.72
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.72
COG1167DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domainTranscription [K] 0.72
COG0692Uracil-DNA glycosylaseReplication, recombination and repair [L] 0.72
COG3663G:T/U-mismatch repair DNA glycosylaseReplication, recombination and repair [L] 0.72
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.72
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 0.72
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.72
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.72
COG3033TryptophanaseAmino acid transport and metabolism [E] 0.36
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.36
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 0.36
COG2041Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductasesEnergy production and conversion [C] 0.36
COG5361Uncharacterized conserved proteinMobilome: prophages, transposons [X] 0.36
COG5337Spore coat protein CotHCell wall/membrane/envelope biogenesis [M] 0.36
COG2095Small neutral amino acid transporter SnatA, MarC familyAmino acid transport and metabolism [E] 0.36
COG2162Arylamine N-acetyltransferaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.36
COG2859Outer membrane channel-forming protein BP26/OMP28, SIMPL familyCell wall/membrane/envelope biogenesis [M] 0.36
COG4992Acetylornithine/succinyldiaminopimelate/putrescine aminotransferaseAmino acid transport and metabolism [E] 0.36
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.36
COG2968Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domainFunction unknown [S] 0.36
COG3915Uncharacterized conserved proteinFunction unknown [S] 0.36
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.36
COG3402Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domainFunction unknown [S] 0.36
COG3428Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domainFunction unknown [S] 0.36
COG5402Uncharacterized protein, contains DUF1214 domainFunction unknown [S] 0.36
COG3471Predicted secreted (periplasmic) proteinFunction unknown [S] 0.36
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.36
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 0.36
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 0.36
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.36
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.36
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 0.36
COG0076Glutamate or tyrosine decarboxylase or a related PLP-dependent proteinAmino acid transport and metabolism [E] 0.36
COG0112Glycine/serine hydroxymethyltransferaseAmino acid transport and metabolism [E] 0.36
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.36
COG0347Nitrogen regulatory protein PIISignal transduction mechanisms [T] 0.36
COG0398Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 familyFunction unknown [S] 0.36
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.36
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.36
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.36
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.36
COG0586Membrane integrity protein DedA, putative transporter, DedA/Tvp38 familyCell wall/membrane/envelope biogenesis [M] 0.36
COG05962-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase foldCoenzyme transport and metabolism [H] 0.36
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 0.36
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.36
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.36
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 0.36
COG0804Urease alpha subunitAmino acid transport and metabolism [E] 0.36
COG1003Glycine cleavage system protein P (pyridoxal-binding), C-terminal domainAmino acid transport and metabolism [E] 0.36
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.36
COG1104Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS familyAmino acid transport and metabolism [E] 0.36
COG1238Uncharacterized membrane protein YqaA, VTT domainFunction unknown [S] 0.36
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 0.36
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 0.36
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 0.36
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.36


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms53.07 %
UnclassifiedrootN/A46.93 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001867|JGI12627J18819_10263513All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300003219|JGI26341J46601_10029843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1773Open in IMG/M
3300004631|Ga0058899_11954837Not Available516Open in IMG/M
3300005332|Ga0066388_103606654Not Available790Open in IMG/M
3300005347|Ga0070668_102049904Not Available528Open in IMG/M
3300005355|Ga0070671_102050115Not Available509Open in IMG/M
3300005363|Ga0008090_15801976Not Available501Open in IMG/M
3300005436|Ga0070713_101079598All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300005436|Ga0070713_101096163All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300005445|Ga0070708_101440876Not Available642Open in IMG/M
3300005577|Ga0068857_101864651All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300005591|Ga0070761_10333547All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300005602|Ga0070762_10518563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales783Open in IMG/M
3300005764|Ga0066903_107290091All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300005764|Ga0066903_107774169Not Available551Open in IMG/M
3300006028|Ga0070717_10402088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1230Open in IMG/M
3300006028|Ga0070717_10787591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia865Open in IMG/M
3300006028|Ga0070717_11664876Not Available578Open in IMG/M
3300006028|Ga0070717_11799546Not Available554Open in IMG/M
3300006059|Ga0075017_100609103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia835Open in IMG/M
3300006162|Ga0075030_101547247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia519Open in IMG/M
3300006175|Ga0070712_101970790Not Available511Open in IMG/M
3300006354|Ga0075021_10969241All Organisms → cellular organisms → Bacteria → Terrabacteria group554Open in IMG/M
3300006354|Ga0075021_11164460Not Available506Open in IMG/M
3300006796|Ga0066665_10824457Not Available728Open in IMG/M
3300006903|Ga0075426_11117921Not Available597Open in IMG/M
3300006903|Ga0075426_11521993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia509Open in IMG/M
3300006904|Ga0075424_101811376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia645Open in IMG/M
3300006954|Ga0079219_10073899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1572Open in IMG/M
3300006954|Ga0079219_11883207Not Available564Open in IMG/M
3300007076|Ga0075435_100022437All Organisms → cellular organisms → Bacteria4871Open in IMG/M
3300009038|Ga0099829_10613125All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300009101|Ga0105247_10317795Not Available1085Open in IMG/M
3300009792|Ga0126374_11837478Not Available508Open in IMG/M
3300010043|Ga0126380_11895884Not Available542Open in IMG/M
3300010048|Ga0126373_10035094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4368Open in IMG/M
3300010048|Ga0126373_12441949Not Available582Open in IMG/M
3300010048|Ga0126373_12626547Not Available562Open in IMG/M
3300010358|Ga0126370_10002587All Organisms → cellular organisms → Bacteria8613Open in IMG/M
3300010358|Ga0126370_10262306Not Available1347Open in IMG/M
3300010358|Ga0126370_10927519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales789Open in IMG/M
3300010359|Ga0126376_11297906Not Available748Open in IMG/M
3300010359|Ga0126376_11955564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria627Open in IMG/M
3300010360|Ga0126372_11735371Not Available666Open in IMG/M
3300010361|Ga0126378_10277582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1775Open in IMG/M
3300010361|Ga0126378_10481918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus1355Open in IMG/M
3300010361|Ga0126378_10508871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1319Open in IMG/M
3300010366|Ga0126379_10710080Not Available1100Open in IMG/M
3300010366|Ga0126379_11768201Not Available722Open in IMG/M
3300010366|Ga0126379_11935357Not Available693Open in IMG/M
3300010376|Ga0126381_103502409Not Available616Open in IMG/M
3300010376|Ga0126381_104795291Not Available520Open in IMG/M
3300010379|Ga0136449_103429855Not Available606Open in IMG/M
3300010397|Ga0134124_10493097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1183Open in IMG/M
3300010398|Ga0126383_11344750Not Available804Open in IMG/M
3300010398|Ga0126383_11884804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria686Open in IMG/M
3300010398|Ga0126383_12009435Not Available666Open in IMG/M
3300010398|Ga0126383_12340565Not Available620Open in IMG/M
3300010398|Ga0126383_12802349Not Available569Open in IMG/M
3300010876|Ga0126361_10680410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus griseoplanus1215Open in IMG/M
3300010880|Ga0126350_10158063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5050Open in IMG/M
3300012351|Ga0137386_11188193Not Available534Open in IMG/M
3300012356|Ga0137371_10579936Not Available862Open in IMG/M
3300012955|Ga0164298_11228644Not Available569Open in IMG/M
3300012957|Ga0164303_10520130Not Available766Open in IMG/M
3300012971|Ga0126369_11771619Not Available706Open in IMG/M
3300012971|Ga0126369_12160592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia644Open in IMG/M
3300012971|Ga0126369_13331321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia526Open in IMG/M
3300012971|Ga0126369_13474833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia516Open in IMG/M
3300012986|Ga0164304_11491301Not Available559Open in IMG/M
3300012988|Ga0164306_11419891Not Available591Open in IMG/M
3300012989|Ga0164305_10234512Not Available1315Open in IMG/M
3300015372|Ga0132256_101645881Not Available751Open in IMG/M
3300016270|Ga0182036_11338736Not Available598Open in IMG/M
3300016294|Ga0182041_10083369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2293Open in IMG/M
3300016319|Ga0182033_10498411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1046Open in IMG/M
3300016341|Ga0182035_10467417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1072Open in IMG/M
3300016341|Ga0182035_10574008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria972Open in IMG/M
3300016357|Ga0182032_11289125Not Available630Open in IMG/M
3300016357|Ga0182032_12030171Not Available505Open in IMG/M
3300016371|Ga0182034_10543200Not Available974Open in IMG/M
3300016387|Ga0182040_11144757All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300016387|Ga0182040_11759108Not Available530Open in IMG/M
3300016404|Ga0182037_10262757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1371Open in IMG/M
3300016404|Ga0182037_11625021All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300016422|Ga0182039_10837006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium819Open in IMG/M
3300016422|Ga0182039_10976656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia759Open in IMG/M
3300016422|Ga0182039_11062678All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4728Open in IMG/M
3300016422|Ga0182039_11571708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia600Open in IMG/M
3300016445|Ga0182038_10560151Not Available982Open in IMG/M
3300016445|Ga0182038_11008883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia737Open in IMG/M
3300017792|Ga0163161_11140609Not Available672Open in IMG/M
3300017932|Ga0187814_10419149Not Available523Open in IMG/M
3300017937|Ga0187809_10264006Not Available626Open in IMG/M
3300017973|Ga0187780_10687110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → unclassified Nocardia → Nocardia sp. CS682737Open in IMG/M
3300017974|Ga0187777_11223491All Organisms → cellular organisms → Bacteria → Terrabacteria group550Open in IMG/M
3300017975|Ga0187782_11507796All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300017995|Ga0187816_10145702Not Available1024Open in IMG/M
3300017999|Ga0187767_10040975All Organisms → cellular organisms → Bacteria1109Open in IMG/M
3300018001|Ga0187815_10117889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1120Open in IMG/M
3300018058|Ga0187766_10356827Not Available959Open in IMG/M
3300018058|Ga0187766_11023424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Gordoniaceae → Millisia → Millisia brevis589Open in IMG/M
3300018058|Ga0187766_11198278Not Available549Open in IMG/M
3300018090|Ga0187770_11706336Not Available515Open in IMG/M
3300018431|Ga0066655_11307354Not Available521Open in IMG/M
3300020581|Ga0210399_10185018Not Available1730Open in IMG/M
3300021180|Ga0210396_10893787Not Available757Open in IMG/M
3300021402|Ga0210385_10582494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii852Open in IMG/M
3300021407|Ga0210383_10728707Not Available851Open in IMG/M
3300021433|Ga0210391_10660936Not Available819Open in IMG/M
3300021560|Ga0126371_10828382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → Jatrophihabitans telluris1071Open in IMG/M
3300021560|Ga0126371_10907858All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300021560|Ga0126371_12733368Not Available598Open in IMG/M
3300021560|Ga0126371_13731724Not Available514Open in IMG/M
3300021560|Ga0126371_13802301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
3300025898|Ga0207692_11056153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia537Open in IMG/M
3300025900|Ga0207710_10480159Not Available644Open in IMG/M
3300025905|Ga0207685_10752877Not Available534Open in IMG/M
3300025917|Ga0207660_11443394Not Available557Open in IMG/M
3300025922|Ga0207646_10618637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium971Open in IMG/M
3300025928|Ga0207700_10202813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1672Open in IMG/M
3300025928|Ga0207700_10778857All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300025928|Ga0207700_11083964Not Available716Open in IMG/M
3300025931|Ga0207644_10145455All Organisms → cellular organisms → Bacteria1830Open in IMG/M
3300025938|Ga0207704_11495074Not Available579Open in IMG/M
3300025938|Ga0207704_11965660Not Available503Open in IMG/M
3300025945|Ga0207679_10330636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1322Open in IMG/M
3300026908|Ga0207787_1006270All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. 6-11-21287Open in IMG/M
3300027096|Ga0208099_1012075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1157Open in IMG/M
3300027119|Ga0209522_1037502All Organisms → cellular organisms → Bacteria → Proteobacteria599Open in IMG/M
3300027165|Ga0208608_109878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium623Open in IMG/M
3300027826|Ga0209060_10131460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1165Open in IMG/M
3300028379|Ga0268266_11258731Not Available715Open in IMG/M
3300028906|Ga0308309_11655389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300030494|Ga0310037_10232131Not Available807Open in IMG/M
3300030598|Ga0210287_1060849Not Available814Open in IMG/M
3300030730|Ga0307482_1290317Not Available524Open in IMG/M
3300031545|Ga0318541_10046981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2203Open in IMG/M
3300031546|Ga0318538_10256320Not Available940Open in IMG/M
3300031546|Ga0318538_10506722Not Available654Open in IMG/M
3300031561|Ga0318528_10039630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2351Open in IMG/M
3300031561|Ga0318528_10373017Not Available766Open in IMG/M
3300031564|Ga0318573_10448809Not Available694Open in IMG/M
3300031572|Ga0318515_10147684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1252Open in IMG/M
3300031572|Ga0318515_10166139Not Available1179Open in IMG/M
3300031572|Ga0318515_10588126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium592Open in IMG/M
3300031572|Ga0318515_10692246Not Available540Open in IMG/M
3300031573|Ga0310915_10212485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1355Open in IMG/M
3300031573|Ga0310915_10494831Not Available869Open in IMG/M
3300031573|Ga0310915_10613431Not Available771Open in IMG/M
3300031573|Ga0310915_10860206Not Available636Open in IMG/M
3300031640|Ga0318555_10361712Not Available786Open in IMG/M
3300031679|Ga0318561_10171794All Organisms → cellular organisms → Bacteria1170Open in IMG/M
3300031680|Ga0318574_10362810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium845Open in IMG/M
3300031680|Ga0318574_10393979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Blastococcus → Blastococcus endophyticus809Open in IMG/M
3300031680|Ga0318574_10416855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium785Open in IMG/M
3300031680|Ga0318574_10597271Not Available647Open in IMG/M
3300031680|Ga0318574_10674174All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300031681|Ga0318572_10208500All Organisms → cellular organisms → Bacteria1142Open in IMG/M
3300031682|Ga0318560_10812446Not Available505Open in IMG/M
3300031708|Ga0310686_102352629Not Available645Open in IMG/M
3300031708|Ga0310686_118646159All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium559Open in IMG/M
3300031713|Ga0318496_10086083All Organisms → cellular organisms → Bacteria1673Open in IMG/M
3300031713|Ga0318496_10406086Not Available753Open in IMG/M
3300031715|Ga0307476_10931923Not Available641Open in IMG/M
3300031719|Ga0306917_11182848Not Available594Open in IMG/M
3300031723|Ga0318493_10015336All Organisms → cellular organisms → Bacteria3267Open in IMG/M
3300031723|Ga0318493_10427923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia726Open in IMG/M
3300031723|Ga0318493_10546311Not Available643Open in IMG/M
3300031723|Ga0318493_10695596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia570Open in IMG/M
3300031724|Ga0318500_10732174Not Available505Open in IMG/M
3300031736|Ga0318501_10622492Not Available593Open in IMG/M
3300031744|Ga0306918_10180521All Organisms → cellular organisms → Bacteria1580Open in IMG/M
3300031744|Ga0306918_10797042Not Available738Open in IMG/M
3300031747|Ga0318502_10050781All Organisms → cellular organisms → Bacteria2182Open in IMG/M
3300031747|Ga0318502_10294019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia954Open in IMG/M
3300031747|Ga0318502_10361147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia860Open in IMG/M
3300031747|Ga0318502_10866886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia548Open in IMG/M
3300031764|Ga0318535_10095687All Organisms → cellular organisms → Bacteria1296Open in IMG/M
3300031768|Ga0318509_10502842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria677Open in IMG/M
3300031770|Ga0318521_10467427Not Available756Open in IMG/M
3300031770|Ga0318521_10731291Not Available602Open in IMG/M
3300031771|Ga0318546_10059081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2413Open in IMG/M
3300031771|Ga0318546_10419955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium935Open in IMG/M
3300031771|Ga0318546_11233388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia525Open in IMG/M
3300031777|Ga0318543_10509445Not Available539Open in IMG/M
3300031778|Ga0318498_10357572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria651Open in IMG/M
3300031778|Ga0318498_10366346All Organisms → cellular organisms → Bacteria → Terrabacteria group642Open in IMG/M
3300031778|Ga0318498_10403018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia608Open in IMG/M
3300031782|Ga0318552_10696047Not Available518Open in IMG/M
3300031792|Ga0318529_10164894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1023Open in IMG/M
3300031793|Ga0318548_10447732Not Available632Open in IMG/M
3300031794|Ga0318503_10124286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria827Open in IMG/M
3300031795|Ga0318557_10107221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1240Open in IMG/M
3300031795|Ga0318557_10259818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium796Open in IMG/M
3300031795|Ga0318557_10281818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia762Open in IMG/M
3300031796|Ga0318576_10240549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia853Open in IMG/M
3300031797|Ga0318550_10078303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1531Open in IMG/M
3300031805|Ga0318497_10213529Not Available1067Open in IMG/M
3300031819|Ga0318568_10287946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1019Open in IMG/M
3300031819|Ga0318568_10487942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura fibrosa768Open in IMG/M
3300031821|Ga0318567_10181184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia1173Open in IMG/M
3300031831|Ga0318564_10442877Not Available566Open in IMG/M
3300031846|Ga0318512_10094249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1400Open in IMG/M
3300031860|Ga0318495_10095071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1339Open in IMG/M
3300031860|Ga0318495_10312892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura fibrosa698Open in IMG/M
3300031879|Ga0306919_10135310Not Available1781Open in IMG/M
3300031879|Ga0306919_11492639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia509Open in IMG/M
3300031890|Ga0306925_10719596All Organisms → cellular organisms → Bacteria1043Open in IMG/M
3300031890|Ga0306925_10911476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia903Open in IMG/M
3300031890|Ga0306925_11692651Not Available611Open in IMG/M
3300031893|Ga0318536_10121024Not Available1321Open in IMG/M
3300031894|Ga0318522_10354802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium555Open in IMG/M
3300031896|Ga0318551_10929293Not Available508Open in IMG/M
3300031897|Ga0318520_10575773Not Available699Open in IMG/M
3300031910|Ga0306923_11122904Not Available845Open in IMG/M
3300031912|Ga0306921_10861954Not Available1031Open in IMG/M
3300031912|Ga0306921_11055950Not Available913Open in IMG/M
3300031912|Ga0306921_11448365Not Available753Open in IMG/M
3300031939|Ga0308174_10413672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1088Open in IMG/M
3300031945|Ga0310913_10172587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1503Open in IMG/M
3300031946|Ga0310910_11072864Not Available628Open in IMG/M
3300031946|Ga0310910_11122233Not Available612Open in IMG/M
3300031954|Ga0306926_10437810All Organisms → cellular organisms → Bacteria1611Open in IMG/M
3300031981|Ga0318531_10386038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria634Open in IMG/M
3300032001|Ga0306922_10576562Not Available1194Open in IMG/M
3300032001|Ga0306922_11268709All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300032001|Ga0306922_11310729Not Available732Open in IMG/M
3300032001|Ga0306922_12090492Not Available549Open in IMG/M
3300032008|Ga0318562_10292467All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300032008|Ga0318562_10747260Not Available561Open in IMG/M
3300032008|Ga0318562_10755725Not Available558Open in IMG/M
3300032008|Ga0318562_10865873Not Available516Open in IMG/M
3300032009|Ga0318563_10147481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1261Open in IMG/M
3300032035|Ga0310911_10351436Not Available851Open in IMG/M
3300032039|Ga0318559_10143856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1080Open in IMG/M
3300032039|Ga0318559_10572243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium527Open in IMG/M
3300032042|Ga0318545_10196235Not Available722Open in IMG/M
3300032043|Ga0318556_10302542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia836Open in IMG/M
3300032043|Ga0318556_10550889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia602Open in IMG/M
3300032044|Ga0318558_10604156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia548Open in IMG/M
3300032044|Ga0318558_10658245Not Available523Open in IMG/M
3300032052|Ga0318506_10246015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria792Open in IMG/M
3300032052|Ga0318506_10380610All Organisms → cellular organisms → Bacteria → Terrabacteria group626Open in IMG/M
3300032054|Ga0318570_10022088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2428Open in IMG/M
3300032055|Ga0318575_10354074All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300032055|Ga0318575_10364308All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300032055|Ga0318575_10463257All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300032059|Ga0318533_10421301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria976Open in IMG/M
3300032063|Ga0318504_10220447Not Available889Open in IMG/M
3300032063|Ga0318504_10321776All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300032063|Ga0318504_10331770Not Available722Open in IMG/M
3300032065|Ga0318513_10248344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria862Open in IMG/M
3300032065|Ga0318513_10319307Not Available755Open in IMG/M
3300032065|Ga0318513_10570830All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium554Open in IMG/M
3300032066|Ga0318514_10534366Not Available624Open in IMG/M
3300032066|Ga0318514_10534742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales624Open in IMG/M
3300032066|Ga0318514_10801154Not Available501Open in IMG/M
3300032067|Ga0318524_10315512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia809Open in IMG/M
3300032067|Ga0318524_10652316Not Available554Open in IMG/M
3300032067|Ga0318524_10721325Not Available526Open in IMG/M
3300032068|Ga0318553_10131392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1291Open in IMG/M
3300032068|Ga0318553_10618011Not Available567Open in IMG/M
3300032076|Ga0306924_10232880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2115Open in IMG/M
3300032076|Ga0306924_11017078Not Available909Open in IMG/M
3300032076|Ga0306924_12206257All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium561Open in IMG/M
3300032090|Ga0318518_10168943Not Available1114Open in IMG/M
3300032094|Ga0318540_10579147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. MH-G8541Open in IMG/M
3300032261|Ga0306920_100611323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1612Open in IMG/M
3300032770|Ga0335085_10080330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4282Open in IMG/M
3300032805|Ga0335078_10030861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia7963Open in IMG/M
3300032828|Ga0335080_10639596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium paraterrae1115Open in IMG/M
3300032897|Ga0335071_10492940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1178Open in IMG/M
3300032954|Ga0335083_10774421Not Available772Open in IMG/M
3300033158|Ga0335077_11528984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia638Open in IMG/M
3300033290|Ga0318519_10531139All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300033290|Ga0318519_10793184Not Available582Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil41.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.08%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil11.91%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.05%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.53%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.17%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.81%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.44%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.44%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.44%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.44%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.44%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.08%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.08%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.72%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.72%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.72%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.72%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.36%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.36%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.36%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.36%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.36%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.36%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.36%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.36%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.36%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.36%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300003219Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3EnvironmentalOpen in IMG/M
3300004631Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026908Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 77 (SPAdes)EnvironmentalOpen in IMG/M
3300027096Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes)EnvironmentalOpen in IMG/M
3300027119Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027165Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF035 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030598Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE048SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030730Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12627J18819_1026351323300001867Forest SoilGQRMRPEKLQAWQALRQRYGNRDESRVDRGRLLAPAA*
JGI26341J46601_1002984313300003219Bog Forest SoilDLYDGQQMRPEKLDAWRALRERYGNRDESRVDRGALLTPAA*
Ga0058899_1195483713300004631Forest SoilHGLYDGQQMRPEKLDTWRALRERYGNRDESRVDRGALLAPAA*
Ga0066388_10360665423300005332Tropical Forest SoilCYVHDLYDGQRMRQEKLAAWQALRERFGDRDESRVDHGTLLAPAA*
Ga0070668_10204990413300005347Switchgrass RhizosphereVLSCYVHELYDGQRMRPEKLAAWRALRERYGNRDESRVVRGTLLASAA*
Ga0070671_10205011513300005355Switchgrass RhizosphereSFNCWVHDLYDGQRMRPEKLRAWRALRERYGNRDESRVDRGRLLPPAT*
Ga0008090_1580197623300005363Tropical Rainforest SoilDLYDRRQRMRPEKLQGWQALRERYGNRDESRVDRGRLLPSAA*
Ga0070713_10107959813300005436Corn, Switchgrass And Miscanthus RhizosphereHELYDGQRMRPEKLTAWRALRERYGNRDESRVDRGTLLASAA*
Ga0070713_10109616313300005436Corn, Switchgrass And Miscanthus RhizosphereGDLYDGRRMRPEKLAAWQALRERYGNRDESRIDRGNLLAPTA*
Ga0070708_10144087613300005445Corn, Switchgrass And Miscanthus RhizosphereVHDLYDRQRMRPEKLAAWQALRERYGNRDESRVDRGNLFAPAI*
Ga0068857_10186465123300005577Corn RhizosphereRMRPEKLAAWQALRERYGNRDESRIDQGNLLAPTA*
Ga0070761_1033354713300005591SoilCYVHDLYDGQQMRPEKLAAWQALRERYGNRDESRVDRGALLAPAA*
Ga0070762_1051856313300005602SoilYVDELYDGQQMRPEKLDTWRALRERYGNRDESRVDRGALLTPAA*
Ga0066903_10729009123300005764Tropical Forest SoilMRPEKLEAWQALRERYGNRDESKVDRGALLAPAA*
Ga0066903_10777416913300005764Tropical Forest SoilGRRMRPEKLAAWRALRERYGDRDESRVDHGTLLAPAA*
Ga0070717_1040208813300006028Corn, Switchgrass And Miscanthus RhizosphereVHDLYEGERMRPEKLQAWRALRERYGNRDESRVDPGTLLAPAA*
Ga0070717_1078759123300006028Corn, Switchgrass And Miscanthus RhizosphereCYVHELYDGQRMRPEKLAAWQALRERYGSRDESRVERGSLLAPAA*
Ga0070717_1166487613300006028Corn, Switchgrass And Miscanthus RhizosphereHCGVHDLYEGERMRPEKLAAWRALRERYGNRDESKVDQGTLTAPAA*
Ga0070717_1179954623300006028Corn, Switchgrass And Miscanthus RhizosphereCGVHDLYEGERMRPEKLAAWRALRERYGNRDESKVDQGTLMAPAA*
Ga0075017_10060910313300006059WatershedsCYVHDLYDGERMRPEKLEAWRGLRERYGNRDESRVDQGTLLAPAA*
Ga0075030_10154724723300006162WatershedsRMRPEKLAAWQALRKRYGNRDESRVDRGILVAPAA*
Ga0070712_10197079013300006175Corn, Switchgrass And Miscanthus RhizosphereVRNGLHCFVHDLYDGQQMRPEELEAWRALRERYGNRDESMVDRGTLLPPAA*
Ga0075021_1096924113300006354WatershedsMHDLYDGQRMRPEKLEAWRALRERYGNRDESRVDRGTLLAPAA*
Ga0075021_1116446023300006354WatershedsGERMRPEKLQAWRALRERYGNRDESRVDRGTLLDPAA*
Ga0066665_1082445713300006796SoilMRPEKLEAWRALREPYGDRDESRVDRGTLLAPAA*
Ga0075426_1111792123300006903Populus RhizosphereLYDGERLRPEKLEAWRALRERYGNRDESRVVRGTLLASAARTRCSPGLS*
Ga0075426_1152199323300006903Populus RhizosphereDGQRMRPEKLAAWRALRERYGNRDESRVDRGTLLVSAA*
Ga0075424_10181137613300006904Populus RhizosphereCYVHDLYDGQQMRPEKLDAWRALRERYGNRDESRVGRGALLAPAA*
Ga0079219_1007389933300006954Agricultural SoilGERMRPEKLAAWRALRERYGNRDESKVDQGTLMAPAARRNS*
Ga0079219_1188320723300006954Agricultural SoilMRPEKLRAWRALRERYGNRDESRVDRGRLLPPAA*
Ga0075435_10002243713300007076Populus RhizosphereQMRPEKLDAWRALRERYGNRDESRVGRGALLAPAA*
Ga0099829_1061312523300009038Vadose Zone SoilVLYCYVHELYDGQRMRLEKLDAWLELRRRYGNRDESRIDQGALLALAA*
Ga0105247_1031779513300009101Switchgrass RhizosphereYVHELYDGQRMRPEKLAAWRALRERYGNRDESRVVRGTLLASAA*
Ga0126374_1183747813300009792Tropical Forest SoilMVLHCGAHDLYEGERMRPEKLEAWRALRERYGNRDESRVDRGILLDPAA*
Ga0126380_1189588423300010043Tropical Forest SoilFGCGVPHLYDGQRMRPEKLAAWQTLRERYGNRDESRVDRGTLVAPAA*
Ga0126373_1003509413300010048Tropical Forest SoilFVHDLYDGQRMRPEKLAAWQALRERYGNRDESKVDRGTLVAPAA*
Ga0126373_1244194913300010048Tropical Forest SoilDLYDGQRMRLEKLAAWQALRERYGNRDESRVDRGTLVAPAA*
Ga0126373_1262654713300010048Tropical Forest SoilVLHCFVHDLYDGERMRPEKLQAWQALRARYGNRDESRVDRGRLLPPAA*
Ga0126370_1000258793300010358Tropical Forest SoilVHDLFDGQQMRLEKREAWRALRERYGNRDESRVDRGTLFARPPDAS*
Ga0126370_1026230613300010358Tropical Forest SoilDLYDGERMRPERLQAWQALRERYGNRDESRVDRGRLLPPAA*
Ga0126370_1092751923300010358Tropical Forest SoilPNLYRGRRMRPEKLAAWQALRERYGNRDESRVDRGRLLPPAA*
Ga0126376_1129790623300010359Tropical Forest SoilVHDLFDGQQMRLEKLEAWRALRERYGNRDESMVNRGTLLPPAT*
Ga0126376_1195556413300010359Tropical Forest SoilRMRPEKLAAWLALRERYGNRDESRVDRGALLAQAA*
Ga0126372_1173537123300010360Tropical Forest SoilVLWCYVHDLYKRQRMRPEKLAAWQALRERYGNRDESRVDRGILVAPAA*
Ga0126378_1027758213300010361Tropical Forest SoilVLHCFVHDLYDGERMRPEKLQAWQALRERYGNRDESRVDRGR
Ga0126378_1048191833300010361Tropical Forest SoilMRPEKLAAWQALRERYGNRDESRVDRGRLLPPAA*
Ga0126378_1050887113300010361Tropical Forest SoilKGRRMRPERLAAWQALRERYGNRDESSVNRGTLQAPAA*
Ga0126379_1071008013300010366Tropical Forest SoilVLHCFVHDLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGTLAAPAA*
Ga0126379_1176820113300010366Tropical Forest SoilVHDLYDGKRMRPEKLAAWQALRERYGNRDESRVDRGRLLPLAA*
Ga0126379_1193535723300010366Tropical Forest SoilYDGERMRPQKLEAWRTVRERYGNRIESRVDQGTLLAPAA*
Ga0126381_10350240913300010376Tropical Forest SoilYDGERMRPERLQAWQALRERYGNRDESRVDRGRLLSPAA*
Ga0126381_10479529113300010376Tropical Forest SoilHCYVHDLYDGERMRPEKLAAWQALRERYGNRDESRVDRGRLLPPAA*
Ga0136449_10342985513300010379Peatlands SoilDLYDGQQMRPEKLAAWRALRERYGDRDELRVDRGTLLAPAV*
Ga0134124_1049309723300010397Terrestrial SoilYDGQRMRPEKLETWRALRERYGNRDESRVDRGTLLARLPEPS*
Ga0126383_1134475013300010398Tropical Forest SoilHDLYDGQRMRPEKLQAWQALRERYGNRDESRVDRGTLVAPAA*
Ga0126383_1188480423300010398Tropical Forest SoilLHCFVHDLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA*
Ga0126383_1200943513300010398Tropical Forest SoilERMRPERLQAWQALRERYGNRDESRVDRGRLLPPAA*
Ga0126383_1234056523300010398Tropical Forest SoilYDGQRMRPEKLAAWQALRERYGSRDESRVDRGTLVAPAA*
Ga0126383_1280234913300010398Tropical Forest SoilRMRPEKLAAWQALRERYGNRDESRVDRGRLLPPAA*
Ga0126361_1068041023300010876Boreal Forest SoilMRPEKLDAWRALRERYGNRDESRVDQGTLLALAA*
Ga0126350_1015806373300010880Boreal Forest SoilLYCYVADLYDGQQMRPEKLDTWRALRERYGNRDESRVDRGALLAPAA*
Ga0137386_1118819313300012351Vadose Zone SoilYVGDLYDGERMRPEKLAAWRTVRERYGNRDESRVDQGTLLALAA*
Ga0137371_1057993623300012356Vadose Zone SoilLYDGQQMRPEKLDAWRALRERYGNRDESRVDRGALLAPAA*
Ga0164298_1122864413300012955SoilQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA*
Ga0164303_1052013023300012957SoilFVHDLYDGQRMRPEKLAAWQALRERYGNRDESRVARGTLVAPAA*
Ga0126369_1177161933300012971Tropical Forest SoilGGRMRPEKLAAWRALRERYGNRDESRVDRGTLVAMAA*
Ga0126369_1216059223300012971Tropical Forest SoilCYLYDLYDGQRMRQERLAAWQALRERYGNRDKSRVDRGTLFAPAA*
Ga0126369_1333132123300012971Tropical Forest SoilRMRPEKLQAWQALRERYGNRDESRVDRGTLVAPAA*
Ga0126369_1347483323300012971Tropical Forest SoilYVHDLYDSRQQMRPEKLEAWRALRERYGNRDESRVERGTLLAPAA*
Ga0164304_1149130113300012986SoilLHCYLHDLYDGERMRPEKLQAWRALRERYGNRDESRVDRGTLLDPAA*
Ga0164306_1141989113300012988SoilKVLHCGVHDLYEGERMRPEKLAAWRALRERYGNRDESKVDQGTLTAPAA*
Ga0164305_1023451213300012989SoilDLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA*
Ga0132256_10164588113300015372Arabidopsis RhizosphereVGDLNDGERLRPEKLAAWRALRGRYGNRDESRVDQGTLLA
Ga0182036_1133873613300016270SoilGGDSVLYCYMDVYDGQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA
Ga0182041_1008336913300016294SoilCYVGDLYDGQRMRPEKLAAWRALRERYGNRDESGVDGGRLLPPAA
Ga0182033_1049841113300016319SoilQRMRPEKLAAWQALRERYGNRDESRVDRGRLLAPAA
Ga0182035_1046741713300016341SoilRMRPEKLAAWQALRERYGNRDESWVDRGTLVARAR
Ga0182035_1057400823300016341SoilHCFVHDLYDGQRMRPERLAAWQALRERYGNRDESRIDGGTLVAPAA
Ga0182032_1128912523300016357SoilDLYDGERLRPEKLAAWRALRERYGNRDESRVDQGTLQAPAA
Ga0182032_1203017113300016357SoilVLHCFVHDLYDGEQMRPEKLAAWQALRERYGNRDESRVDRGRLLPPAA
Ga0182034_1054320033300016371SoilLGCYMHDLYRGRRMRQEKLEAWQALRERYGNRDESRVDRGTLLAPAA
Ga0182040_1114475713300016387SoilYCYVGDLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGNLFAPAT
Ga0182040_1175910813300016387SoilYDGQRMRPEKLAAWQELRERYGNRDESRVDRGTLVAPAA
Ga0182037_1026275723300016404SoilFVHDLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA
Ga0182037_1162502123300016404SoilYDSKRMRPEKLQAWQALRERYGNRDESRIDRGTLVAPAA
Ga0182039_1083700613300016422SoilCYVHDLYDGERMRPAKLEAWRALRERYGNRDEARVDQGALLAPAA
Ga0182039_1097665613300016422SoilQRMRPEKLAAWRALRERYGNRDESRVERGTLLAPAA
Ga0182039_1106267823300016422SoilQRMRPEKLQAWQALRERYGNRDESRVDRGILLSPAA
Ga0182039_1157170813300016422SoilTVLYCYVHDLYDGRRMRPEKLDAWRALRERYGNRDESRVDRGTLLAPAA
Ga0182038_1056015123300016445SoilLYDGQRMRPEKLQAWQALRERYGNRDESRVDRGRLLPPAA
Ga0182038_1100888313300016445SoilCYVHDLYDRRQRMRPEKLEAWRALRERYGDRDESRVDQGTLRAPAA
Ga0163161_1114060913300017792Switchgrass RhizosphereLYDGQRMRPEKLAAWRALRERYGNRDESRVVRGTLLASAA
Ga0187814_1041914923300017932Freshwater SedimentVGDLYDGERLRPEKLAAWRALRDRYGNRDESRVDQGTLRAPAA
Ga0187809_1026400613300017937Freshwater SedimentVEAGRDGQRMRPEKLEAWQALRERFGNRDESRVDRGTLLAPAA
Ga0187780_1068711023300017973Tropical PeatlandYDGQRMRPEKLAAWRALRERYGNRDESRVDQGTLLAPAA
Ga0187777_1122349113300017974Tropical PeatlandGKRMRPEKLAAWQALRERYGNRDESRVDRGRLLAPAA
Ga0187782_1150779613300017975Tropical PeatlandGQRMRPEKLEAWRALRERYGNRDESRVDRGTLLDPAA
Ga0187816_1014570223300017995Freshwater SedimentVLYCFVGELYDGQRMRPDKLAAWRALRERYGNRDESRVDRGTLVAPAA
Ga0187767_1004097523300017999Tropical PeatlandLYCYLHDLYDGQQMRPEKLEAWQALRERYGNRGESRVDRGALLAPVS
Ga0187815_1011788923300018001Freshwater SedimentQRMRPEKLAAWHALRERYGNRDESRVDQGTLLAPAA
Ga0187766_1035682723300018058Tropical PeatlandYIHDLYDGERMRPEKLEAWRALRERYGNRDESRVDRGTILDPAA
Ga0187766_1102342423300018058Tropical PeatlandCYVHDLYDGQQMRPERLEAWRALRERYGNRDKSRVDGGALLAPAA
Ga0187766_1119827813300018058Tropical PeatlandSGEDVLHCFVHDLYDGQQMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA
Ga0187770_1170633613300018090Tropical PeatlandGDTALHCYIHDLYDGQWMRPEKLEAWRALRERYGNRDESRVDRGSLLDPAA
Ga0066655_1130735413300018431Grasslands SoilEGQRMRPEKLEAWRALREPYGDRDESRVDRGTLLAPAA
Ga0210399_1018501813300020581SoilGQRMRPEKLEAWQALRERYGNRDESRVDRGRLLPPAA
Ga0210396_1089378713300021180SoilDQLYDGQRMRPEKLAAWQTLRERYGNRDESTIDAGTLSAAAA
Ga0210385_1058249413300021402SoilLYCYVHELYDGQRMRPEKLAAWRALRGGYGNRDESRVDRGALLAPAA
Ga0210383_1072870713300021407SoilGQRRRPEKLEAWQALRERYGNRDESRVDRGRLLPPAA
Ga0210391_1066093613300021433SoilHCYVHDLYDGQRMRPEKLEAWRTLRERYGNRDESRVDRGTLLAPAA
Ga0126371_1082838223300021560Tropical Forest SoilYDGQRMRPEKLAAWQELRERYGNRAESRVDQGTLFAPAA
Ga0126371_1090785813300021560Tropical Forest SoilGDSVLHCFVHDLYDGQLMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA
Ga0126371_1273336813300021560Tropical Forest SoilMRPEKLEAWQALREGYGDRDELRVDRGTLLALPPEPL
Ga0126371_1373172413300021560Tropical Forest SoilSALSCYVHDLYKGHRLRQEKLAAWQALRERYGNRDESRVDRGRLLPPAA
Ga0126371_1380230123300021560Tropical Forest SoilYDGQRMRPEKLAAWQALRERYGNRDESRVDRGRLLPPAA
Ga0207692_1105615313300025898Corn, Switchgrass And Miscanthus RhizosphereGNKVLHCGVHDLYDGERMRPEKLAAWRALRERYGDRGESRVDQGALRAPAA
Ga0207710_1048015913300025900Switchgrass RhizosphereDTVLNCYVHELYDGQRMRPEKLAAWRALRERYGNRDESRVVRGTLLASAA
Ga0207685_1075287713300025905Corn, Switchgrass And Miscanthus RhizosphereGQRMRPEKLAAWQTLRERYGNRDESRVDRGTLVAPAA
Ga0207660_1144339423300025917Corn RhizosphereDLYDGQRMRPEKLRAWRALRERYGNRDESRVDRGRLLPPAT
Ga0207646_1061863713300025922Corn, Switchgrass And Miscanthus RhizosphereGEQMRPEKLEAWRALRERYGDRDESRVDRGALLAAAA
Ga0207700_1020281333300025928Corn, Switchgrass And Miscanthus RhizosphereCFVHDLYDGQRMRPEKLQAWRALRERYGNRDESRVDRGRLLRPAA
Ga0207700_1077885713300025928Corn, Switchgrass And Miscanthus RhizosphereGDLYDGRRMRPEKLAAWQALRERYGNRDESRIDRGNLLAPTA
Ga0207700_1108396413300025928Corn, Switchgrass And Miscanthus RhizosphereSALGCFVHDLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA
Ga0207644_1014545533300025931Switchgrass RhizosphereCGVHDLYEGEHMRPEKLAAWRALRERYGNRDESKVDQGILMAPAA
Ga0207704_1149507423300025938Miscanthus RhizosphereFNCWVHDLYDGQRMRPEKLRAWRALRERYGNRDESRVDRGRLLPPAT
Ga0207704_1196566013300025938Miscanthus RhizosphereCYVHELYDGQRMRPEKLAAWRTLRERYGNRDESKVARGTLLASAA
Ga0207679_1033063633300025945Corn RhizosphereGQRMRPEKLRAWRALRERYGNRDESRVDRGRLLPPAT
Ga0207787_100627023300026908Tropical Forest SoilMHELYDGQRMRPETLAAWQTLRERYGNRDESRVDRGTLLAPAA
Ga0208099_101207513300027096Forest SoilVLHCYIHDLYDGQRMRPEKLAAWRALRERYGSRDESRVDQGTLIASAA
Ga0209522_103750223300027119Forest SoilPDGESSFSCWVHDLYDGQRMRPERLAAWQALRERYGNRDESRVDQGRLLPPAA
Ga0208608_10987813300027165Forest SoilCYVHDLYDGQQMRPEKLDAWRALRQRYGNRDESRVDRGVLLAPAA
Ga0209060_1013146013300027826Surface SoilVLSCYVDELYDGQRMRPEKLQVWQTLRERYGNRDQSRVDRGALLTAAA
Ga0268266_1125873113300028379Switchgrass RhizosphereRMRPEKLRAWRALRERYGNRDESRVDRGRLLPPAT
Ga0308309_1165538923300028906SoilETPLHCYVHDLYDGQRTRLEKLEAWRALRERYGNRDESRVDRGTLLTPAA
Ga0310037_1023213113300030494Peatlands SoilDQRMRPEKLEAWQALRERYGNRDESRVDRGTLLTPAA
Ga0210287_106084923300030598SoilCYVHDLYDGQQMRPEKLDAWRALRERYGDRDESRVDRGALLAPAG
Ga0307482_129031713300030730Hardwood Forest SoilYVHELYDGQRMRPEKLAAWRALRERYGNRDESRVNRGTLLASAA
Ga0318541_1004698143300031545SoilMDVYDGQRMRPEKLAAWQELRERYGNRDESRVDRGTLVAPAA
Ga0318538_1025632013300031546SoilDLYDGQRMRADKLETWQALRERYGNRDESRVDRGRLLPPAA
Ga0318538_1050672223300031546SoilFLHCYVGDLYDGRRMRPERLAAWQALRERYGNRDESRVDRGNLLAPTA
Ga0318528_1003963013300031561SoilCFVHDLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA
Ga0318528_1037301713300031561SoilHDLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGILVAPAA
Ga0318573_1044880913300031564SoilFVHDLYDGQRMRPERLAAWQALRERYGNRDESRIDGGTLVAPAA
Ga0318515_1014768413300031572SoilDMLHCFVHDLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA
Ga0318515_1016613933300031572SoilYVHELYRRQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA
Ga0318515_1058812613300031572SoilESVLWCYVHELYRRQRMRPEKLAAWQALRERYGNRDESRIDRGTLVAPAA
Ga0318515_1069224613300031572SoilVLHCYVHDPYHGWRMRPEKLDAWQALRERYGSRDESSIDQGRLRPPAA
Ga0310915_1021248533300031573SoilDLYDGERMRPAKLEAWRALRERYGNRDESRVDQGALLAPAA
Ga0310915_1049483123300031573SoilYDGERMRPERLQAWQALRERYGNRDESRVDGGRLLPPAA
Ga0310915_1061343113300031573SoilKTPLHCYIHDLYDGQRMRPEKLEAWRALRERYGNRDESRVDRGSLLDPAA
Ga0310915_1086020613300031573SoilYHGRRMRPKKLAAWQALRERYGNRGESRVERGSLLPSAPVTR
Ga0318555_1036171213300031640SoilLYHGRRMRPKKLAAWQALRERYGNRGESRVERGSLLPSAPVTH
Ga0318561_1017179443300031679SoilGRRMRPEKLAAWQALRERYGNRDESRVDRGNLLAPAI
Ga0318574_1036281023300031680SoilCYVHELYRGQRMRPEKLAAWQALRERYGNRDESRIDRGTLVAPAA
Ga0318574_1039397913300031680SoilYEGQRMRPEKLAAWRALRERYGNRDESRVDRGTLMAPAA
Ga0318574_1041685513300031680SoilEDTFLHCYVGDLYDGRRMRPERLAAWQALRERYGNRDESRVDRGNLLAPTA
Ga0318574_1059727113300031680SoilCYIHDLYRGRRMRPEKLAAWQALRERYGNRDESRVDRGTLLPPPA
Ga0318574_1067417413300031680SoilHDLYDGERMRPEKLQAWQALREQYGNRDESRVDRGRLLPRAA
Ga0318572_1020850013300031681SoilVHDLYDGERMRPERLQAWQALRERYGNRDESRVDEGRLLPRAA
Ga0318560_1081244613300031682SoilFLHCYVGDLYDGRRMRPEKLAAWQALRERYGNRDESRVDRGNLLAPTA
Ga0310686_10235262923300031708SoilSCWVHDLYDGERMRPERLQAWQALRERYGNRDESRVDRGRLLPPAA
Ga0310686_11864615913300031708SoilLGCFVHDLYDGQRMRPEKLQAWQALRERYGNRDESRVDRGRLLPPAA
Ga0318496_1008608313300031713SoilLYDRRQRMRPEKLQAWRALRERYGNRDESRVDRGILLPLAA
Ga0318496_1040608613300031713SoilVLYCYVGDLYDGQRMRPEKLAAWRALRERYGNRDESGVDGGRLLPPAA
Ga0307476_1093192313300031715Hardwood Forest SoilDLYDGERMRPERLQAWQALRERYGNRDESRVDRGRLLPPAA
Ga0306917_1118284813300031719SoilRGRRMRPEKLAAWQALRERYGNRDESRVDRGRLLPPAA
Ga0318493_1001533613300031723SoilYDRRQRMRPEKLQAWRALRERYGNRDESRVDRGILLPLAA
Ga0318493_1042792313300031723SoilGCYVHDLYDRRQRMRPEKLEAWRALRERYGDRDESRVDQGTLRAPAA
Ga0318493_1054631133300031723SoilYDSKRMRPEKLQAWQALRERYGNRDESTVDRGSLLPLAV
Ga0318493_1069559623300031723SoilSCYVHELYDGEQMRPEKLAAWRALRERYGNRDESRVEQGALLAPAA
Ga0318500_1073217423300031724SoilYIHDLYDGQRMRPEKLEAWRALRERYGNRDESRVDRGSLLDPAA
Ga0318501_1062249213300031736SoilMVLHCYVGDLYDGQRMRPEKLAAWQALRERYGDRDESRVEQGTLLAPAA
Ga0306918_1018052143300031744SoilWLGCYVHDLYDSKRMRPEKLQAWQALRERYGNRDESTVDRGSLLPLAV
Ga0306918_1079704223300031744SoilGRRMRPEKLAAWQALRERYGNRDESRVDRGTLLPPPA
Ga0318502_1005078163300031747SoilRRQRMRPEKLQAWRALRERYGNRDESRVDRGILLPLAA
Ga0318502_1029401933300031747SoilLYHGQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA
Ga0318502_1036114723300031747SoilLHCYIHDLYDGERMRPEKLAAWRALRERYGNRDESRVDRGTLLDPAA
Ga0318502_1086688613300031747SoilLYDGQLMRPEKLAAWQALRERYGNGDESRVDRGNLVAPTA
Ga0318535_1009568733300031764SoilYVHDLYDRRQRMRPEKLQAWRALRERYGNRDESRVDRGILLPLAA
Ga0318509_1050284223300031768SoilLYDRRQRMRPEKLQAWRALRERYGNRDESRVDRGRLLAPAA
Ga0318521_1046742723300031770SoilLYDRRQRMRPEKLAAWQALRERYGNRDESRVERGILLAPAA
Ga0318521_1073129113300031770SoilVLYCYVGELYDGQRMRPEKLAAWRALRERYGNRDESRVDRGRFLPPAA
Ga0318546_1005908113300031771SoilQQMRPEKLQAWQALRERYGNRDESIVDRGRLLAPAA
Ga0318546_1041995513300031771SoilSLGCWVHDLYDRERMRPERRQAWQALRERYGSRDASRVDGGRLLPPAA
Ga0318546_1123338823300031771SoilYDGQRMRPEKLQAWQALRERYGNRDESRVDRGRLLPPAA
Ga0318543_1050944513300031777SoilFVDDLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGRLLAPAA
Ga0318498_1035757213300031778SoilDKVFGCGVPDLYRGRRMRPEKLAAWQALRERYGNRDESRVDRGRLLPPAA
Ga0318498_1036634623300031778SoilDSVLHCFVDDLYDGQRMRPEKLAVWQALRERYGNRDESRVDRGILLPPAA
Ga0318498_1040301823300031778SoilLYDGQRMRPEKLEAWRALRERYGNRDESSVDQGTLLAPAA
Ga0318552_1069604713300031782SoilHDLYRGRRMRPEKLAAWQALRERYGNRDESRVDRGTLLPPPA
Ga0318529_1016489433300031792SoilLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGRLLAPAA
Ga0318548_1044773233300031793SoilLYCYVGELYDGQRMRPEKLAAWRALRERYGNRDESRVDRGRFLPPAA
Ga0318503_1012428613300031794SoilLYRGRRMRPEKLAAWQALRERYGNRDESRVDRGNLLAPAI
Ga0318557_1010722113300031795SoilPNLYHGQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA
Ga0318557_1025981813300031795SoilEKLQAWQALRERYGNRDESRVDRGRLLPRPPPDLL
Ga0318557_1028181813300031795SoilVLSCYVHELYDGQRMRPEKLAAWRALRERYGYRDESRVERGTLLAPAA
Ga0318576_1024054933300031796SoilYHGQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA
Ga0318550_1007830333300031797SoilHDLYKRQRMRPEKLAAWQALRERYGNRDESRVDRGRLLAPAA
Ga0318497_1021352913300031805SoilTVLYCYVHELYDGQRMRPEKLGTWRALRERYGNRDESRVDRGTLLAPAA
Ga0318568_1028794623300031819SoilVLSCYVHELYDGQRMRPEKLAAWRALRERYGNRDESRVERGTLLAPAA
Ga0318568_1048794223300031819SoilLYDGQRMRPEKLEAWRALRERYGNRDESRVDRGSLLEPAA
Ga0318567_1018118423300031821SoilVHELYDGQRMRPEKLAAWQALRERYGNRDESRVERGALLAPAA
Ga0318564_1044287713300031831SoilDVLHCFVHDLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA
Ga0318512_1009424913300031846SoilELYDGQRMRPEKLAAWRALRERYGNRDESRVERGTLLAPAA
Ga0318495_1009507123300031860SoilLYCYMDVYDGQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA
Ga0318495_1031289213300031860SoilGEKTPLHCYIHDLYDGQRMRPEKLEAWRALRERYGNRDESRVDRGSLLEPAA
Ga0306919_1013531013300031879SoilYHGRRMRPEKLQAWQALRERYGNRDESRVDRGTLLPPVT
Ga0306919_1149263913300031879SoilSCYVHELYDGQRMRPEKLAAWRALRERYGNRDESRVERGTLLAPAA
Ga0306925_1071959613300031890SoilLHCYVHELYDGRRMRPEKLAAWQALRERYGNRDESRVERGALLAPAA
Ga0306925_1091147613300031890SoilGGENWLGCYVHDLYDGQRMRPEKLAAWQALRERYGDRDESRVDRGRLLPPAE
Ga0306925_1169265123300031890SoilHDLYKGRRMRPERLAAWQALRERYGSRDESRVDRGTLQAPAA
Ga0318536_1012102413300031893SoilEDKVFGCGVPNLYRGRRMRPEKLAAWQALRERYGNRDESRVERGILLAPAA
Ga0318522_1035480223300031894SoilYDGQRMRPDKPAAWYALRERYGNRDESRVDHGTLLALDA
Ga0318551_1092929323300031896SoilYCYVHELYDGQRMRPEKLEAWRALREDYGDRDESRVDRGTLFAPAA
Ga0318520_1057577313300031897SoilHDLYHGRRMRPEKLQAWQALRERYGNRDESRVDRGTLLPPVN
Ga0306923_1112290423300031910SoilDRRQRMRPEKLAAWQALRERYGNRDESRVERGILLAPAA
Ga0306921_1086195413300031912SoilHCFVHDLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA
Ga0306921_1105595013300031912SoilADTALHCYIHDLYRGRRMRPEKLAAWQALRERYGNRDESRVERGILLAPAA
Ga0306921_1144836513300031912SoilFCYVHELYDGQRMRPEKLAAWQALRERYGNRDESRVDRGALSAPALVSPAQS
Ga0308174_1041367213300031939SoilRMRPEKLEAWRALRERYGNRDESSVDRGALLAPAA
Ga0310913_1017258733300031945SoilQRMRPEKLAAWRALRERYGNRDESRVEQGILLAPAA
Ga0310910_1107286423300031946SoilDLYDGRRMRPERLAAWQALRERYGNRDESRVDRGNLLAPTA
Ga0310910_1112223313300031946SoilERMRPERLQAWQALRERYGNRDESRVDEGRLLPRAA
Ga0306926_1043781033300031954SoilGDAVLHCYVHELYDGRRMRPEKLAAWQALRERYGNRDESRVERGALLAPAA
Ga0318531_1038603823300031981SoilYDSERMRPERLAAWQALRERYGNRDESRVDRGRLLPPPA
Ga0306922_1057656223300032001SoilYIHDLYDGERMRPEKLAAWRALRERYGNRDESRVDRGTLLDPAA
Ga0306922_1126870923300032001SoilRMRPEKLAAWQALRERYGNRDESRVERGALLAPAA
Ga0306922_1131072923300032001SoilLHCFVEDLYDGQRMRPEKLQAWQALRERYGNRDESRVDRGRLLPPAA
Ga0306922_1209049223300032001SoilCGVHELYDGQLMRPEKLAAWQALRERYGNGDESRVDRGNLVAPTA
Ga0318562_1029246713300032008SoilCYVGELYDGQRMRPEKLAAWQALRERYGNRDESRVERGRLLPPAA
Ga0318562_1074726013300032008SoilVLHCFVHDLYDGQRMRPEKLTAWQALRERYGNRDESRVDRGTLVAPAA
Ga0318562_1075572513300032008SoilRRMRPEKLAAWQALRERYGNRDESRVDRGTLLPPPA
Ga0318562_1086587313300032008SoilYKGRRMRREKLAAWQALRERYGNRDESRVDRGNLFAPAI
Ga0318563_1014748133300032009SoilYDGQRMCPEKLAAWRALRERYGNRDESGVDGGRLLPPAA
Ga0310911_1035143633300032035SoilHDLYDGEQMRPEKLAAWQALRERYGNRDESRVDRGRLLPPAA
Ga0318559_1014385613300032039SoilHGLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA
Ga0318559_1057224313300032039SoilCYVHDLYDGQRMRPDKPAAWHALRERYGNRDESRVDHGTLLALDA
Ga0318545_1019623523300032042SoilLYDGQRMRPEKLAAWRALRERYGNRDESRVDRGTLLAPAA
Ga0318556_1030254213300032043SoilYDGQLMRPEKLAAWQALRERYGNGDESRVDRGNLVAPTA
Ga0318556_1055088913300032043SoilLYKGRRMRPERLAAWQALRERYGSRDESRVDRGTLQAPAA
Ga0318558_1060415613300032044SoilAVGCYVHDLYKGRRMRPERLAAWQALRERYGSRDESRVDRGTLQAPAA
Ga0318558_1065824523300032044SoilWVPDLYDGERIRLERLQAWQALRERYGNRDESRVDRGRLLPPAA
Ga0318506_1024601533300032052SoilQRMRPEELAAWQALRERYGNRDESRVDRGRLLPPAA
Ga0318506_1038061023300032052SoilGDSVLHCFVDDLYDGQRMRPEKLAVWQALRERYGNRDESRVDRGILLPPAA
Ga0318570_1002208813300032054SoilYVGDLYDGQRMRPEKLAAWRALRERYGNRDESRVDRGTLLAPAA
Ga0318575_1035407423300032055SoilPGGESAVGCYVHDLYKGRRMRPERLAAWQALRERYGSRDESRVDRGTLQAPAA
Ga0318575_1036430823300032055SoilYDGERMRPEKLQAWQALREQYGNRDESRVDRGRLLPRAA
Ga0318575_1046325713300032055SoilVLYCYVHELYDGQRMRPEKLAAWQALRERYGNRDESRVERGALLAPAA
Ga0318533_1042130133300032059SoilDLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGRLLAPAA
Ga0318504_1022044713300032063SoilLYHGRRMRPEKLAAWQALRERYGNRDESRVDRGTLLPPPA
Ga0318504_1032177613300032063SoilGGESWLGCYVHDLYDRRQRMRPEKLQAWRALRERYGNRDESRVDRGILLPLAA
Ga0318504_1033177013300032063SoilDLYDGQRMRPEKLEAWRALRERYGNRDESRVDRGTLLAPAA
Ga0318513_1024834413300032065SoilGEDSVLYCYMDVYDGQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA
Ga0318513_1031930713300032065SoilVHDLYHGRRMRPKKLAAWQALRERYGNRGESRVERGSLLPSAPVTR
Ga0318513_1057083023300032065SoilGKSLLHCFVDDLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGRLLAPAA
Ga0318514_1053436613300032066SoilYIHDLYRGRRMRPEKLAAWQALRERYGNRDESRVDRGTLLPPAA
Ga0318514_1053474223300032066SoilGCYVHDLYKGRRMRPERLAAWQALRERYGNRDESSVNRGTLQAPAA
Ga0318514_1080115413300032066SoilVLHCYLGGLYHGRRMRPEKLAAWQALRERYGNRDESRVEQGTLLAAAT
Ga0318524_1031551213300032067SoilLYDGQRMRPEKLAAWRALRERYGNRDESRVERGTLLAPAA
Ga0318524_1065231613300032067SoilLHCFVDDLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGRLLAPAA
Ga0318524_1072132513300032067SoilYVHDLYHGRRMRPEKLAAWRALRERYGDRDESRVDQGTLLAPAA
Ga0318553_1013139233300032068SoilVLHCFVDDLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGRLLPPAA
Ga0318553_1061801123300032068SoilKVFGCGVPNLYKGRRMRREKLAAWQALRERYGNRDESRVDRGNLFAPAI
Ga0306924_1023288033300032076SoilHELYDGQRMRPEKLAAWRALRERYGNRDESRVERGTLLAPAA
Ga0306924_1101707823300032076SoilLGCWVHDLYDGERMRPERLQAWQALRERYGNRDESRVDRGTLAAPAA
Ga0306924_1220625723300032076SoilRMRPEKLAAWQALRERYGNRDESRVDRGRLLAPAA
Ga0318518_1016894313300032090SoilQRMRPEKLQAWQALRERYGNRDESRVDRGRLLPPAA
Ga0318540_1057914713300032094SoilYKGRRMRPERLAAWQALRERYGNRDESSVNRGTLQAPAA
Ga0306920_10061132333300032261SoilLHCYIHDLYRGRRMRPEKLAAWQALRERYGNRDESRVDRGTLLPPAA
Ga0335085_1008033013300032770SoilELYDGERMRPEKQQAWRSLRERYGNRDESRVDRGALLAPAA
Ga0335078_1003086153300032805SoilRMRPEKLAAWQALRERYGNRDESTVDRGTLLAPAA
Ga0335080_1063959613300032828SoilDGQRIRPEKLAAWQALRERYGNRDESRVDRGNLFAPAA
Ga0335071_1049294013300032897SoilVHDLYDGQRMRPEKLEAWRALRERYGNRDESRVDRSTLVTPAA
Ga0335083_1077442113300032954SoilDAVLHCYVHELYDGQRMRPEKLAAWRALRERYGDRDESRVDQGALLAPVP
Ga0335077_1152898413300033158SoilGCGVHDLYDGQRMRPEKLEAWRALRERYGNRDESRVDRGTLQAPAA
Ga0318519_1053113913300033290SoilGGDSVLYCFLDVYDGQRMRPEKLAAWQALRERYGNRDESRVEQGALLTPAA
Ga0318519_1079318413300033290SoilVHDPYHGWRMRPEKLDAWQALRERYGSRDESSIDQGRLRPPAA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.