| Basic Information | |
|---|---|
| Family ID | F012790 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 277 |
| Average Sequence Length | 43 residues |
| Representative Sequence | DLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGRLLAPAA |
| Number of Associated Samples | 175 |
| Number of Associated Scaffolds | 277 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.61 % |
| % of genes near scaffold ends (potentially truncated) | 92.06 % |
| % of genes from short scaffolds (< 2000 bps) | 94.95 % |
| Associated GOLD sequencing projects | 162 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (53.069 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (41.516 % of family members) |
| Environment Ontology (ENVO) | Unclassified (53.430 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (42.960 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.64% β-sheet: 8.70% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 277 Family Scaffolds |
|---|---|---|
| PF04545 | Sigma70_r4 | 1.44 |
| PF01022 | HTH_5 | 1.44 |
| PF08002 | DUF1697 | 1.08 |
| PF06689 | zf-C4_ClpX | 1.08 |
| PF08044 | DUF1707 | 1.08 |
| PF07676 | PD40 | 0.72 |
| PF03466 | LysR_substrate | 0.72 |
| PF12697 | Abhydrolase_6 | 0.72 |
| PF07883 | Cupin_2 | 0.72 |
| PF01872 | RibD_C | 0.72 |
| PF10137 | TIR-like | 0.72 |
| PF01381 | HTH_3 | 0.72 |
| PF00248 | Aldo_ket_red | 0.72 |
| PF13302 | Acetyltransf_3 | 0.72 |
| PF05988 | DUF899 | 0.72 |
| PF12307 | DUF3631 | 0.72 |
| PF01738 | DLH | 0.72 |
| PF04542 | Sigma70_r2 | 0.72 |
| PF03167 | UDG | 0.72 |
| PF00196 | GerE | 0.72 |
| PF00797 | Acetyltransf_2 | 0.36 |
| PF03631 | Virul_fac_BrkB | 0.36 |
| PF01695 | IstB_IS21 | 0.36 |
| PF01212 | Beta_elim_lyase | 0.36 |
| PF13808 | DDE_Tnp_1_assoc | 0.36 |
| PF07929 | PRiA4_ORF3 | 0.36 |
| PF00589 | Phage_integrase | 0.36 |
| PF01323 | DSBA | 0.36 |
| PF00872 | Transposase_mut | 0.36 |
| PF00543 | P-II | 0.36 |
| PF07724 | AAA_2 | 0.36 |
| PF08757 | CotH | 0.36 |
| PF13358 | DDE_3 | 0.36 |
| PF01914 | MarC | 0.36 |
| PF14117 | DUF4287 | 0.36 |
| PF11946 | DUF3463 | 0.36 |
| PF07690 | MFS_1 | 0.36 |
| PF14015 | DUF4231 | 0.36 |
| PF00171 | Aldedh | 0.36 |
| PF04402 | SIMPL | 0.36 |
| PF13193 | AMP-binding_C | 0.36 |
| PF04185 | Phosphoesterase | 0.36 |
| PF00571 | CBS | 0.36 |
| PF04149 | DUF397 | 0.36 |
| PF13191 | AAA_16 | 0.36 |
| PF06441 | EHN | 0.36 |
| PF00149 | Metallophos | 0.36 |
| PF01145 | Band_7 | 0.36 |
| PF01734 | Patatin | 0.36 |
| PF03703 | bPH_2 | 0.36 |
| PF00583 | Acetyltransf_1 | 0.36 |
| PF13474 | SnoaL_3 | 0.36 |
| PF13489 | Methyltransf_23 | 0.36 |
| PF00449 | Urease_alpha | 0.36 |
| PF09335 | SNARE_assoc | 0.36 |
| PF06742 | DUF1214 | 0.36 |
| PF13472 | Lipase_GDSL_2 | 0.36 |
| PF13602 | ADH_zinc_N_2 | 0.36 |
| PF00174 | Oxidored_molyb | 0.36 |
| PF01243 | Putative_PNPOx | 0.36 |
| PF01522 | Polysacc_deac_1 | 0.36 |
| PF10517 | DM13 | 0.36 |
| PF12796 | Ank_2 | 0.36 |
| PF01494 | FAD_binding_3 | 0.36 |
| PF14333 | DUF4389 | 0.36 |
| COG ID | Name | Functional Category | % Frequency in 277 Family Scaffolds |
|---|---|---|---|
| COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 1.08 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.72 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.72 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.72 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.72 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.72 |
| COG1167 | DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain | Transcription [K] | 0.72 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.72 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.72 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.72 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.72 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.72 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.72 |
| COG3033 | Tryptophanase | Amino acid transport and metabolism [E] | 0.36 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.36 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.36 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.36 |
| COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.36 |
| COG5337 | Spore coat protein CotH | Cell wall/membrane/envelope biogenesis [M] | 0.36 |
| COG2095 | Small neutral amino acid transporter SnatA, MarC family | Amino acid transport and metabolism [E] | 0.36 |
| COG2162 | Arylamine N-acetyltransferase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.36 |
| COG2859 | Outer membrane channel-forming protein BP26/OMP28, SIMPL family | Cell wall/membrane/envelope biogenesis [M] | 0.36 |
| COG4992 | Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase | Amino acid transport and metabolism [E] | 0.36 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.36 |
| COG2968 | Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain | Function unknown [S] | 0.36 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.36 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.36 |
| COG3402 | Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.36 |
| COG3428 | Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.36 |
| COG5402 | Uncharacterized protein, contains DUF1214 domain | Function unknown [S] | 0.36 |
| COG3471 | Predicted secreted (periplasmic) protein | Function unknown [S] | 0.36 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.36 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.36 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.36 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.36 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.36 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.36 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.36 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.36 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.36 |
| COG0347 | Nitrogen regulatory protein PII | Signal transduction mechanisms [T] | 0.36 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.36 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.36 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.36 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.36 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.36 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.36 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.36 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.36 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.36 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.36 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.36 |
| COG0804 | Urease alpha subunit | Amino acid transport and metabolism [E] | 0.36 |
| COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.36 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.36 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.36 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.36 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.36 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.36 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.36 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.36 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 53.07 % |
| Unclassified | root | N/A | 46.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001867|JGI12627J18819_10263513 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300003219|JGI26341J46601_10029843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1773 | Open in IMG/M |
| 3300004631|Ga0058899_11954837 | Not Available | 516 | Open in IMG/M |
| 3300005332|Ga0066388_103606654 | Not Available | 790 | Open in IMG/M |
| 3300005347|Ga0070668_102049904 | Not Available | 528 | Open in IMG/M |
| 3300005355|Ga0070671_102050115 | Not Available | 509 | Open in IMG/M |
| 3300005363|Ga0008090_15801976 | Not Available | 501 | Open in IMG/M |
| 3300005436|Ga0070713_101079598 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300005436|Ga0070713_101096163 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300005445|Ga0070708_101440876 | Not Available | 642 | Open in IMG/M |
| 3300005577|Ga0068857_101864651 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300005591|Ga0070761_10333547 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300005602|Ga0070762_10518563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 783 | Open in IMG/M |
| 3300005764|Ga0066903_107290091 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300005764|Ga0066903_107774169 | Not Available | 551 | Open in IMG/M |
| 3300006028|Ga0070717_10402088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1230 | Open in IMG/M |
| 3300006028|Ga0070717_10787591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 865 | Open in IMG/M |
| 3300006028|Ga0070717_11664876 | Not Available | 578 | Open in IMG/M |
| 3300006028|Ga0070717_11799546 | Not Available | 554 | Open in IMG/M |
| 3300006059|Ga0075017_100609103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 835 | Open in IMG/M |
| 3300006162|Ga0075030_101547247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 519 | Open in IMG/M |
| 3300006175|Ga0070712_101970790 | Not Available | 511 | Open in IMG/M |
| 3300006354|Ga0075021_10969241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 554 | Open in IMG/M |
| 3300006354|Ga0075021_11164460 | Not Available | 506 | Open in IMG/M |
| 3300006796|Ga0066665_10824457 | Not Available | 728 | Open in IMG/M |
| 3300006903|Ga0075426_11117921 | Not Available | 597 | Open in IMG/M |
| 3300006903|Ga0075426_11521993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
| 3300006904|Ga0075424_101811376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 645 | Open in IMG/M |
| 3300006954|Ga0079219_10073899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1572 | Open in IMG/M |
| 3300006954|Ga0079219_11883207 | Not Available | 564 | Open in IMG/M |
| 3300007076|Ga0075435_100022437 | All Organisms → cellular organisms → Bacteria | 4871 | Open in IMG/M |
| 3300009038|Ga0099829_10613125 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300009101|Ga0105247_10317795 | Not Available | 1085 | Open in IMG/M |
| 3300009792|Ga0126374_11837478 | Not Available | 508 | Open in IMG/M |
| 3300010043|Ga0126380_11895884 | Not Available | 542 | Open in IMG/M |
| 3300010048|Ga0126373_10035094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4368 | Open in IMG/M |
| 3300010048|Ga0126373_12441949 | Not Available | 582 | Open in IMG/M |
| 3300010048|Ga0126373_12626547 | Not Available | 562 | Open in IMG/M |
| 3300010358|Ga0126370_10002587 | All Organisms → cellular organisms → Bacteria | 8613 | Open in IMG/M |
| 3300010358|Ga0126370_10262306 | Not Available | 1347 | Open in IMG/M |
| 3300010358|Ga0126370_10927519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 789 | Open in IMG/M |
| 3300010359|Ga0126376_11297906 | Not Available | 748 | Open in IMG/M |
| 3300010359|Ga0126376_11955564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
| 3300010360|Ga0126372_11735371 | Not Available | 666 | Open in IMG/M |
| 3300010361|Ga0126378_10277582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1775 | Open in IMG/M |
| 3300010361|Ga0126378_10481918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus | 1355 | Open in IMG/M |
| 3300010361|Ga0126378_10508871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1319 | Open in IMG/M |
| 3300010366|Ga0126379_10710080 | Not Available | 1100 | Open in IMG/M |
| 3300010366|Ga0126379_11768201 | Not Available | 722 | Open in IMG/M |
| 3300010366|Ga0126379_11935357 | Not Available | 693 | Open in IMG/M |
| 3300010376|Ga0126381_103502409 | Not Available | 616 | Open in IMG/M |
| 3300010376|Ga0126381_104795291 | Not Available | 520 | Open in IMG/M |
| 3300010379|Ga0136449_103429855 | Not Available | 606 | Open in IMG/M |
| 3300010397|Ga0134124_10493097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1183 | Open in IMG/M |
| 3300010398|Ga0126383_11344750 | Not Available | 804 | Open in IMG/M |
| 3300010398|Ga0126383_11884804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 686 | Open in IMG/M |
| 3300010398|Ga0126383_12009435 | Not Available | 666 | Open in IMG/M |
| 3300010398|Ga0126383_12340565 | Not Available | 620 | Open in IMG/M |
| 3300010398|Ga0126383_12802349 | Not Available | 569 | Open in IMG/M |
| 3300010876|Ga0126361_10680410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus griseoplanus | 1215 | Open in IMG/M |
| 3300010880|Ga0126350_10158063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5050 | Open in IMG/M |
| 3300012351|Ga0137386_11188193 | Not Available | 534 | Open in IMG/M |
| 3300012356|Ga0137371_10579936 | Not Available | 862 | Open in IMG/M |
| 3300012955|Ga0164298_11228644 | Not Available | 569 | Open in IMG/M |
| 3300012957|Ga0164303_10520130 | Not Available | 766 | Open in IMG/M |
| 3300012971|Ga0126369_11771619 | Not Available | 706 | Open in IMG/M |
| 3300012971|Ga0126369_12160592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 644 | Open in IMG/M |
| 3300012971|Ga0126369_13331321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 526 | Open in IMG/M |
| 3300012971|Ga0126369_13474833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 516 | Open in IMG/M |
| 3300012986|Ga0164304_11491301 | Not Available | 559 | Open in IMG/M |
| 3300012988|Ga0164306_11419891 | Not Available | 591 | Open in IMG/M |
| 3300012989|Ga0164305_10234512 | Not Available | 1315 | Open in IMG/M |
| 3300015372|Ga0132256_101645881 | Not Available | 751 | Open in IMG/M |
| 3300016270|Ga0182036_11338736 | Not Available | 598 | Open in IMG/M |
| 3300016294|Ga0182041_10083369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2293 | Open in IMG/M |
| 3300016319|Ga0182033_10498411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1046 | Open in IMG/M |
| 3300016341|Ga0182035_10467417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1072 | Open in IMG/M |
| 3300016341|Ga0182035_10574008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 972 | Open in IMG/M |
| 3300016357|Ga0182032_11289125 | Not Available | 630 | Open in IMG/M |
| 3300016357|Ga0182032_12030171 | Not Available | 505 | Open in IMG/M |
| 3300016371|Ga0182034_10543200 | Not Available | 974 | Open in IMG/M |
| 3300016387|Ga0182040_11144757 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300016387|Ga0182040_11759108 | Not Available | 530 | Open in IMG/M |
| 3300016404|Ga0182037_10262757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1371 | Open in IMG/M |
| 3300016404|Ga0182037_11625021 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300016422|Ga0182039_10837006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 819 | Open in IMG/M |
| 3300016422|Ga0182039_10976656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 759 | Open in IMG/M |
| 3300016422|Ga0182039_11062678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 728 | Open in IMG/M |
| 3300016422|Ga0182039_11571708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 600 | Open in IMG/M |
| 3300016445|Ga0182038_10560151 | Not Available | 982 | Open in IMG/M |
| 3300016445|Ga0182038_11008883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 737 | Open in IMG/M |
| 3300017792|Ga0163161_11140609 | Not Available | 672 | Open in IMG/M |
| 3300017932|Ga0187814_10419149 | Not Available | 523 | Open in IMG/M |
| 3300017937|Ga0187809_10264006 | Not Available | 626 | Open in IMG/M |
| 3300017973|Ga0187780_10687110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → unclassified Nocardia → Nocardia sp. CS682 | 737 | Open in IMG/M |
| 3300017974|Ga0187777_11223491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 550 | Open in IMG/M |
| 3300017975|Ga0187782_11507796 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300017995|Ga0187816_10145702 | Not Available | 1024 | Open in IMG/M |
| 3300017999|Ga0187767_10040975 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300018001|Ga0187815_10117889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1120 | Open in IMG/M |
| 3300018058|Ga0187766_10356827 | Not Available | 959 | Open in IMG/M |
| 3300018058|Ga0187766_11023424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Gordoniaceae → Millisia → Millisia brevis | 589 | Open in IMG/M |
| 3300018058|Ga0187766_11198278 | Not Available | 549 | Open in IMG/M |
| 3300018090|Ga0187770_11706336 | Not Available | 515 | Open in IMG/M |
| 3300018431|Ga0066655_11307354 | Not Available | 521 | Open in IMG/M |
| 3300020581|Ga0210399_10185018 | Not Available | 1730 | Open in IMG/M |
| 3300021180|Ga0210396_10893787 | Not Available | 757 | Open in IMG/M |
| 3300021402|Ga0210385_10582494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 852 | Open in IMG/M |
| 3300021407|Ga0210383_10728707 | Not Available | 851 | Open in IMG/M |
| 3300021433|Ga0210391_10660936 | Not Available | 819 | Open in IMG/M |
| 3300021560|Ga0126371_10828382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → Jatrophihabitans telluris | 1071 | Open in IMG/M |
| 3300021560|Ga0126371_10907858 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300021560|Ga0126371_12733368 | Not Available | 598 | Open in IMG/M |
| 3300021560|Ga0126371_13731724 | Not Available | 514 | Open in IMG/M |
| 3300021560|Ga0126371_13802301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
| 3300025898|Ga0207692_11056153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 537 | Open in IMG/M |
| 3300025900|Ga0207710_10480159 | Not Available | 644 | Open in IMG/M |
| 3300025905|Ga0207685_10752877 | Not Available | 534 | Open in IMG/M |
| 3300025917|Ga0207660_11443394 | Not Available | 557 | Open in IMG/M |
| 3300025922|Ga0207646_10618637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 971 | Open in IMG/M |
| 3300025928|Ga0207700_10202813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1672 | Open in IMG/M |
| 3300025928|Ga0207700_10778857 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300025928|Ga0207700_11083964 | Not Available | 716 | Open in IMG/M |
| 3300025931|Ga0207644_10145455 | All Organisms → cellular organisms → Bacteria | 1830 | Open in IMG/M |
| 3300025938|Ga0207704_11495074 | Not Available | 579 | Open in IMG/M |
| 3300025938|Ga0207704_11965660 | Not Available | 503 | Open in IMG/M |
| 3300025945|Ga0207679_10330636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1322 | Open in IMG/M |
| 3300026908|Ga0207787_1006270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. 6-11-2 | 1287 | Open in IMG/M |
| 3300027096|Ga0208099_1012075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1157 | Open in IMG/M |
| 3300027119|Ga0209522_1037502 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 599 | Open in IMG/M |
| 3300027165|Ga0208608_109878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 623 | Open in IMG/M |
| 3300027826|Ga0209060_10131460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1165 | Open in IMG/M |
| 3300028379|Ga0268266_11258731 | Not Available | 715 | Open in IMG/M |
| 3300028906|Ga0308309_11655389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
| 3300030494|Ga0310037_10232131 | Not Available | 807 | Open in IMG/M |
| 3300030598|Ga0210287_1060849 | Not Available | 814 | Open in IMG/M |
| 3300030730|Ga0307482_1290317 | Not Available | 524 | Open in IMG/M |
| 3300031545|Ga0318541_10046981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2203 | Open in IMG/M |
| 3300031546|Ga0318538_10256320 | Not Available | 940 | Open in IMG/M |
| 3300031546|Ga0318538_10506722 | Not Available | 654 | Open in IMG/M |
| 3300031561|Ga0318528_10039630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2351 | Open in IMG/M |
| 3300031561|Ga0318528_10373017 | Not Available | 766 | Open in IMG/M |
| 3300031564|Ga0318573_10448809 | Not Available | 694 | Open in IMG/M |
| 3300031572|Ga0318515_10147684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1252 | Open in IMG/M |
| 3300031572|Ga0318515_10166139 | Not Available | 1179 | Open in IMG/M |
| 3300031572|Ga0318515_10588126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 592 | Open in IMG/M |
| 3300031572|Ga0318515_10692246 | Not Available | 540 | Open in IMG/M |
| 3300031573|Ga0310915_10212485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1355 | Open in IMG/M |
| 3300031573|Ga0310915_10494831 | Not Available | 869 | Open in IMG/M |
| 3300031573|Ga0310915_10613431 | Not Available | 771 | Open in IMG/M |
| 3300031573|Ga0310915_10860206 | Not Available | 636 | Open in IMG/M |
| 3300031640|Ga0318555_10361712 | Not Available | 786 | Open in IMG/M |
| 3300031679|Ga0318561_10171794 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300031680|Ga0318574_10362810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 845 | Open in IMG/M |
| 3300031680|Ga0318574_10393979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Blastococcus → Blastococcus endophyticus | 809 | Open in IMG/M |
| 3300031680|Ga0318574_10416855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 785 | Open in IMG/M |
| 3300031680|Ga0318574_10597271 | Not Available | 647 | Open in IMG/M |
| 3300031680|Ga0318574_10674174 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300031681|Ga0318572_10208500 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300031682|Ga0318560_10812446 | Not Available | 505 | Open in IMG/M |
| 3300031708|Ga0310686_102352629 | Not Available | 645 | Open in IMG/M |
| 3300031708|Ga0310686_118646159 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 559 | Open in IMG/M |
| 3300031713|Ga0318496_10086083 | All Organisms → cellular organisms → Bacteria | 1673 | Open in IMG/M |
| 3300031713|Ga0318496_10406086 | Not Available | 753 | Open in IMG/M |
| 3300031715|Ga0307476_10931923 | Not Available | 641 | Open in IMG/M |
| 3300031719|Ga0306917_11182848 | Not Available | 594 | Open in IMG/M |
| 3300031723|Ga0318493_10015336 | All Organisms → cellular organisms → Bacteria | 3267 | Open in IMG/M |
| 3300031723|Ga0318493_10427923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 726 | Open in IMG/M |
| 3300031723|Ga0318493_10546311 | Not Available | 643 | Open in IMG/M |
| 3300031723|Ga0318493_10695596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 570 | Open in IMG/M |
| 3300031724|Ga0318500_10732174 | Not Available | 505 | Open in IMG/M |
| 3300031736|Ga0318501_10622492 | Not Available | 593 | Open in IMG/M |
| 3300031744|Ga0306918_10180521 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
| 3300031744|Ga0306918_10797042 | Not Available | 738 | Open in IMG/M |
| 3300031747|Ga0318502_10050781 | All Organisms → cellular organisms → Bacteria | 2182 | Open in IMG/M |
| 3300031747|Ga0318502_10294019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 954 | Open in IMG/M |
| 3300031747|Ga0318502_10361147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 860 | Open in IMG/M |
| 3300031747|Ga0318502_10866886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 548 | Open in IMG/M |
| 3300031764|Ga0318535_10095687 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| 3300031768|Ga0318509_10502842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 677 | Open in IMG/M |
| 3300031770|Ga0318521_10467427 | Not Available | 756 | Open in IMG/M |
| 3300031770|Ga0318521_10731291 | Not Available | 602 | Open in IMG/M |
| 3300031771|Ga0318546_10059081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2413 | Open in IMG/M |
| 3300031771|Ga0318546_10419955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 935 | Open in IMG/M |
| 3300031771|Ga0318546_11233388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 525 | Open in IMG/M |
| 3300031777|Ga0318543_10509445 | Not Available | 539 | Open in IMG/M |
| 3300031778|Ga0318498_10357572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 651 | Open in IMG/M |
| 3300031778|Ga0318498_10366346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 642 | Open in IMG/M |
| 3300031778|Ga0318498_10403018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 608 | Open in IMG/M |
| 3300031782|Ga0318552_10696047 | Not Available | 518 | Open in IMG/M |
| 3300031792|Ga0318529_10164894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1023 | Open in IMG/M |
| 3300031793|Ga0318548_10447732 | Not Available | 632 | Open in IMG/M |
| 3300031794|Ga0318503_10124286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 827 | Open in IMG/M |
| 3300031795|Ga0318557_10107221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1240 | Open in IMG/M |
| 3300031795|Ga0318557_10259818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 796 | Open in IMG/M |
| 3300031795|Ga0318557_10281818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 762 | Open in IMG/M |
| 3300031796|Ga0318576_10240549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 853 | Open in IMG/M |
| 3300031797|Ga0318550_10078303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1531 | Open in IMG/M |
| 3300031805|Ga0318497_10213529 | Not Available | 1067 | Open in IMG/M |
| 3300031819|Ga0318568_10287946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1019 | Open in IMG/M |
| 3300031819|Ga0318568_10487942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura fibrosa | 768 | Open in IMG/M |
| 3300031821|Ga0318567_10181184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 1173 | Open in IMG/M |
| 3300031831|Ga0318564_10442877 | Not Available | 566 | Open in IMG/M |
| 3300031846|Ga0318512_10094249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1400 | Open in IMG/M |
| 3300031860|Ga0318495_10095071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1339 | Open in IMG/M |
| 3300031860|Ga0318495_10312892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura fibrosa | 698 | Open in IMG/M |
| 3300031879|Ga0306919_10135310 | Not Available | 1781 | Open in IMG/M |
| 3300031879|Ga0306919_11492639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
| 3300031890|Ga0306925_10719596 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300031890|Ga0306925_10911476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 903 | Open in IMG/M |
| 3300031890|Ga0306925_11692651 | Not Available | 611 | Open in IMG/M |
| 3300031893|Ga0318536_10121024 | Not Available | 1321 | Open in IMG/M |
| 3300031894|Ga0318522_10354802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| 3300031896|Ga0318551_10929293 | Not Available | 508 | Open in IMG/M |
| 3300031897|Ga0318520_10575773 | Not Available | 699 | Open in IMG/M |
| 3300031910|Ga0306923_11122904 | Not Available | 845 | Open in IMG/M |
| 3300031912|Ga0306921_10861954 | Not Available | 1031 | Open in IMG/M |
| 3300031912|Ga0306921_11055950 | Not Available | 913 | Open in IMG/M |
| 3300031912|Ga0306921_11448365 | Not Available | 753 | Open in IMG/M |
| 3300031939|Ga0308174_10413672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1088 | Open in IMG/M |
| 3300031945|Ga0310913_10172587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1503 | Open in IMG/M |
| 3300031946|Ga0310910_11072864 | Not Available | 628 | Open in IMG/M |
| 3300031946|Ga0310910_11122233 | Not Available | 612 | Open in IMG/M |
| 3300031954|Ga0306926_10437810 | All Organisms → cellular organisms → Bacteria | 1611 | Open in IMG/M |
| 3300031981|Ga0318531_10386038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 634 | Open in IMG/M |
| 3300032001|Ga0306922_10576562 | Not Available | 1194 | Open in IMG/M |
| 3300032001|Ga0306922_11268709 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300032001|Ga0306922_11310729 | Not Available | 732 | Open in IMG/M |
| 3300032001|Ga0306922_12090492 | Not Available | 549 | Open in IMG/M |
| 3300032008|Ga0318562_10292467 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300032008|Ga0318562_10747260 | Not Available | 561 | Open in IMG/M |
| 3300032008|Ga0318562_10755725 | Not Available | 558 | Open in IMG/M |
| 3300032008|Ga0318562_10865873 | Not Available | 516 | Open in IMG/M |
| 3300032009|Ga0318563_10147481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1261 | Open in IMG/M |
| 3300032035|Ga0310911_10351436 | Not Available | 851 | Open in IMG/M |
| 3300032039|Ga0318559_10143856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1080 | Open in IMG/M |
| 3300032039|Ga0318559_10572243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
| 3300032042|Ga0318545_10196235 | Not Available | 722 | Open in IMG/M |
| 3300032043|Ga0318556_10302542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 836 | Open in IMG/M |
| 3300032043|Ga0318556_10550889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 602 | Open in IMG/M |
| 3300032044|Ga0318558_10604156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 548 | Open in IMG/M |
| 3300032044|Ga0318558_10658245 | Not Available | 523 | Open in IMG/M |
| 3300032052|Ga0318506_10246015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 792 | Open in IMG/M |
| 3300032052|Ga0318506_10380610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 626 | Open in IMG/M |
| 3300032054|Ga0318570_10022088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2428 | Open in IMG/M |
| 3300032055|Ga0318575_10354074 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300032055|Ga0318575_10364308 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300032055|Ga0318575_10463257 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300032059|Ga0318533_10421301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 976 | Open in IMG/M |
| 3300032063|Ga0318504_10220447 | Not Available | 889 | Open in IMG/M |
| 3300032063|Ga0318504_10321776 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300032063|Ga0318504_10331770 | Not Available | 722 | Open in IMG/M |
| 3300032065|Ga0318513_10248344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 862 | Open in IMG/M |
| 3300032065|Ga0318513_10319307 | Not Available | 755 | Open in IMG/M |
| 3300032065|Ga0318513_10570830 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 554 | Open in IMG/M |
| 3300032066|Ga0318514_10534366 | Not Available | 624 | Open in IMG/M |
| 3300032066|Ga0318514_10534742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 624 | Open in IMG/M |
| 3300032066|Ga0318514_10801154 | Not Available | 501 | Open in IMG/M |
| 3300032067|Ga0318524_10315512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 809 | Open in IMG/M |
| 3300032067|Ga0318524_10652316 | Not Available | 554 | Open in IMG/M |
| 3300032067|Ga0318524_10721325 | Not Available | 526 | Open in IMG/M |
| 3300032068|Ga0318553_10131392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1291 | Open in IMG/M |
| 3300032068|Ga0318553_10618011 | Not Available | 567 | Open in IMG/M |
| 3300032076|Ga0306924_10232880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2115 | Open in IMG/M |
| 3300032076|Ga0306924_11017078 | Not Available | 909 | Open in IMG/M |
| 3300032076|Ga0306924_12206257 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 561 | Open in IMG/M |
| 3300032090|Ga0318518_10168943 | Not Available | 1114 | Open in IMG/M |
| 3300032094|Ga0318540_10579147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. MH-G8 | 541 | Open in IMG/M |
| 3300032261|Ga0306920_100611323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1612 | Open in IMG/M |
| 3300032770|Ga0335085_10080330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4282 | Open in IMG/M |
| 3300032805|Ga0335078_10030861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7963 | Open in IMG/M |
| 3300032828|Ga0335080_10639596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium paraterrae | 1115 | Open in IMG/M |
| 3300032897|Ga0335071_10492940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1178 | Open in IMG/M |
| 3300032954|Ga0335083_10774421 | Not Available | 772 | Open in IMG/M |
| 3300033158|Ga0335077_11528984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 638 | Open in IMG/M |
| 3300033290|Ga0318519_10531139 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300033290|Ga0318519_10793184 | Not Available | 582 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 41.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.05% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.53% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.17% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.81% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.44% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.44% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.44% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.44% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.08% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.08% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.72% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.72% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.36% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.36% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.36% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.36% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.36% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.36% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.36% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.36% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.36% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026908 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 77 (SPAdes) | Environmental | Open in IMG/M |
| 3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
| 3300027119 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027165 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF035 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030598 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE048SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12627J18819_102635132 | 3300001867 | Forest Soil | GQRMRPEKLQAWQALRQRYGNRDESRVDRGRLLAPAA* |
| JGI26341J46601_100298431 | 3300003219 | Bog Forest Soil | DLYDGQQMRPEKLDAWRALRERYGNRDESRVDRGALLTPAA* |
| Ga0058899_119548371 | 3300004631 | Forest Soil | HGLYDGQQMRPEKLDTWRALRERYGNRDESRVDRGALLAPAA* |
| Ga0066388_1036066542 | 3300005332 | Tropical Forest Soil | CYVHDLYDGQRMRQEKLAAWQALRERFGDRDESRVDHGTLLAPAA* |
| Ga0070668_1020499041 | 3300005347 | Switchgrass Rhizosphere | VLSCYVHELYDGQRMRPEKLAAWRALRERYGNRDESRVVRGTLLASAA* |
| Ga0070671_1020501151 | 3300005355 | Switchgrass Rhizosphere | SFNCWVHDLYDGQRMRPEKLRAWRALRERYGNRDESRVDRGRLLPPAT* |
| Ga0008090_158019762 | 3300005363 | Tropical Rainforest Soil | DLYDRRQRMRPEKLQGWQALRERYGNRDESRVDRGRLLPSAA* |
| Ga0070713_1010795981 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | HELYDGQRMRPEKLTAWRALRERYGNRDESRVDRGTLLASAA* |
| Ga0070713_1010961631 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | GDLYDGRRMRPEKLAAWQALRERYGNRDESRIDRGNLLAPTA* |
| Ga0070708_1014408761 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VHDLYDRQRMRPEKLAAWQALRERYGNRDESRVDRGNLFAPAI* |
| Ga0068857_1018646512 | 3300005577 | Corn Rhizosphere | RMRPEKLAAWQALRERYGNRDESRIDQGNLLAPTA* |
| Ga0070761_103335471 | 3300005591 | Soil | CYVHDLYDGQQMRPEKLAAWQALRERYGNRDESRVDRGALLAPAA* |
| Ga0070762_105185631 | 3300005602 | Soil | YVDELYDGQQMRPEKLDTWRALRERYGNRDESRVDRGALLTPAA* |
| Ga0066903_1072900912 | 3300005764 | Tropical Forest Soil | MRPEKLEAWQALRERYGNRDESKVDRGALLAPAA* |
| Ga0066903_1077741691 | 3300005764 | Tropical Forest Soil | GRRMRPEKLAAWRALRERYGDRDESRVDHGTLLAPAA* |
| Ga0070717_104020881 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VHDLYEGERMRPEKLQAWRALRERYGNRDESRVDPGTLLAPAA* |
| Ga0070717_107875912 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | CYVHELYDGQRMRPEKLAAWQALRERYGSRDESRVERGSLLAPAA* |
| Ga0070717_116648761 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | HCGVHDLYEGERMRPEKLAAWRALRERYGNRDESKVDQGTLTAPAA* |
| Ga0070717_117995462 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | CGVHDLYEGERMRPEKLAAWRALRERYGNRDESKVDQGTLMAPAA* |
| Ga0075017_1006091031 | 3300006059 | Watersheds | CYVHDLYDGERMRPEKLEAWRGLRERYGNRDESRVDQGTLLAPAA* |
| Ga0075030_1015472472 | 3300006162 | Watersheds | RMRPEKLAAWQALRKRYGNRDESRVDRGILVAPAA* |
| Ga0070712_1019707901 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VRNGLHCFVHDLYDGQQMRPEELEAWRALRERYGNRDESMVDRGTLLPPAA* |
| Ga0075021_109692411 | 3300006354 | Watersheds | MHDLYDGQRMRPEKLEAWRALRERYGNRDESRVDRGTLLAPAA* |
| Ga0075021_111644602 | 3300006354 | Watersheds | GERMRPEKLQAWRALRERYGNRDESRVDRGTLLDPAA* |
| Ga0066665_108244571 | 3300006796 | Soil | MRPEKLEAWRALREPYGDRDESRVDRGTLLAPAA* |
| Ga0075426_111179212 | 3300006903 | Populus Rhizosphere | LYDGERLRPEKLEAWRALRERYGNRDESRVVRGTLLASAARTRCSPGLS* |
| Ga0075426_115219932 | 3300006903 | Populus Rhizosphere | DGQRMRPEKLAAWRALRERYGNRDESRVDRGTLLVSAA* |
| Ga0075424_1018113761 | 3300006904 | Populus Rhizosphere | CYVHDLYDGQQMRPEKLDAWRALRERYGNRDESRVGRGALLAPAA* |
| Ga0079219_100738993 | 3300006954 | Agricultural Soil | GERMRPEKLAAWRALRERYGNRDESKVDQGTLMAPAARRNS* |
| Ga0079219_118832072 | 3300006954 | Agricultural Soil | MRPEKLRAWRALRERYGNRDESRVDRGRLLPPAA* |
| Ga0075435_1000224371 | 3300007076 | Populus Rhizosphere | QMRPEKLDAWRALRERYGNRDESRVGRGALLAPAA* |
| Ga0099829_106131252 | 3300009038 | Vadose Zone Soil | VLYCYVHELYDGQRMRLEKLDAWLELRRRYGNRDESRIDQGALLALAA* |
| Ga0105247_103177951 | 3300009101 | Switchgrass Rhizosphere | YVHELYDGQRMRPEKLAAWRALRERYGNRDESRVVRGTLLASAA* |
| Ga0126374_118374781 | 3300009792 | Tropical Forest Soil | MVLHCGAHDLYEGERMRPEKLEAWRALRERYGNRDESRVDRGILLDPAA* |
| Ga0126380_118958842 | 3300010043 | Tropical Forest Soil | FGCGVPHLYDGQRMRPEKLAAWQTLRERYGNRDESRVDRGTLVAPAA* |
| Ga0126373_100350941 | 3300010048 | Tropical Forest Soil | FVHDLYDGQRMRPEKLAAWQALRERYGNRDESKVDRGTLVAPAA* |
| Ga0126373_124419491 | 3300010048 | Tropical Forest Soil | DLYDGQRMRLEKLAAWQALRERYGNRDESRVDRGTLVAPAA* |
| Ga0126373_126265471 | 3300010048 | Tropical Forest Soil | VLHCFVHDLYDGERMRPEKLQAWQALRARYGNRDESRVDRGRLLPPAA* |
| Ga0126370_100025879 | 3300010358 | Tropical Forest Soil | VHDLFDGQQMRLEKREAWRALRERYGNRDESRVDRGTLFARPPDAS* |
| Ga0126370_102623061 | 3300010358 | Tropical Forest Soil | DLYDGERMRPERLQAWQALRERYGNRDESRVDRGRLLPPAA* |
| Ga0126370_109275192 | 3300010358 | Tropical Forest Soil | PNLYRGRRMRPEKLAAWQALRERYGNRDESRVDRGRLLPPAA* |
| Ga0126376_112979062 | 3300010359 | Tropical Forest Soil | VHDLFDGQQMRLEKLEAWRALRERYGNRDESMVNRGTLLPPAT* |
| Ga0126376_119555641 | 3300010359 | Tropical Forest Soil | RMRPEKLAAWLALRERYGNRDESRVDRGALLAQAA* |
| Ga0126372_117353712 | 3300010360 | Tropical Forest Soil | VLWCYVHDLYKRQRMRPEKLAAWQALRERYGNRDESRVDRGILVAPAA* |
| Ga0126378_102775821 | 3300010361 | Tropical Forest Soil | VLHCFVHDLYDGERMRPEKLQAWQALRERYGNRDESRVDRGR |
| Ga0126378_104819183 | 3300010361 | Tropical Forest Soil | MRPEKLAAWQALRERYGNRDESRVDRGRLLPPAA* |
| Ga0126378_105088711 | 3300010361 | Tropical Forest Soil | KGRRMRPERLAAWQALRERYGNRDESSVNRGTLQAPAA* |
| Ga0126379_107100801 | 3300010366 | Tropical Forest Soil | VLHCFVHDLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGTLAAPAA* |
| Ga0126379_117682011 | 3300010366 | Tropical Forest Soil | VHDLYDGKRMRPEKLAAWQALRERYGNRDESRVDRGRLLPLAA* |
| Ga0126379_119353572 | 3300010366 | Tropical Forest Soil | YDGERMRPQKLEAWRTVRERYGNRIESRVDQGTLLAPAA* |
| Ga0126381_1035024091 | 3300010376 | Tropical Forest Soil | YDGERMRPERLQAWQALRERYGNRDESRVDRGRLLSPAA* |
| Ga0126381_1047952911 | 3300010376 | Tropical Forest Soil | HCYVHDLYDGERMRPEKLAAWQALRERYGNRDESRVDRGRLLPPAA* |
| Ga0136449_1034298551 | 3300010379 | Peatlands Soil | DLYDGQQMRPEKLAAWRALRERYGDRDELRVDRGTLLAPAV* |
| Ga0134124_104930972 | 3300010397 | Terrestrial Soil | YDGQRMRPEKLETWRALRERYGNRDESRVDRGTLLARLPEPS* |
| Ga0126383_113447501 | 3300010398 | Tropical Forest Soil | HDLYDGQRMRPEKLQAWQALRERYGNRDESRVDRGTLVAPAA* |
| Ga0126383_118848042 | 3300010398 | Tropical Forest Soil | LHCFVHDLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA* |
| Ga0126383_120094351 | 3300010398 | Tropical Forest Soil | ERMRPERLQAWQALRERYGNRDESRVDRGRLLPPAA* |
| Ga0126383_123405652 | 3300010398 | Tropical Forest Soil | YDGQRMRPEKLAAWQALRERYGSRDESRVDRGTLVAPAA* |
| Ga0126383_128023491 | 3300010398 | Tropical Forest Soil | RMRPEKLAAWQALRERYGNRDESRVDRGRLLPPAA* |
| Ga0126361_106804102 | 3300010876 | Boreal Forest Soil | MRPEKLDAWRALRERYGNRDESRVDQGTLLALAA* |
| Ga0126350_101580637 | 3300010880 | Boreal Forest Soil | LYCYVADLYDGQQMRPEKLDTWRALRERYGNRDESRVDRGALLAPAA* |
| Ga0137386_111881931 | 3300012351 | Vadose Zone Soil | YVGDLYDGERMRPEKLAAWRTVRERYGNRDESRVDQGTLLALAA* |
| Ga0137371_105799362 | 3300012356 | Vadose Zone Soil | LYDGQQMRPEKLDAWRALRERYGNRDESRVDRGALLAPAA* |
| Ga0164298_112286441 | 3300012955 | Soil | QRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA* |
| Ga0164303_105201302 | 3300012957 | Soil | FVHDLYDGQRMRPEKLAAWQALRERYGNRDESRVARGTLVAPAA* |
| Ga0126369_117716193 | 3300012971 | Tropical Forest Soil | GGRMRPEKLAAWRALRERYGNRDESRVDRGTLVAMAA* |
| Ga0126369_121605922 | 3300012971 | Tropical Forest Soil | CYLYDLYDGQRMRQERLAAWQALRERYGNRDKSRVDRGTLFAPAA* |
| Ga0126369_133313212 | 3300012971 | Tropical Forest Soil | RMRPEKLQAWQALRERYGNRDESRVDRGTLVAPAA* |
| Ga0126369_134748332 | 3300012971 | Tropical Forest Soil | YVHDLYDSRQQMRPEKLEAWRALRERYGNRDESRVERGTLLAPAA* |
| Ga0164304_114913011 | 3300012986 | Soil | LHCYLHDLYDGERMRPEKLQAWRALRERYGNRDESRVDRGTLLDPAA* |
| Ga0164306_114198911 | 3300012988 | Soil | KVLHCGVHDLYEGERMRPEKLAAWRALRERYGNRDESKVDQGTLTAPAA* |
| Ga0164305_102345121 | 3300012989 | Soil | DLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA* |
| Ga0132256_1016458811 | 3300015372 | Arabidopsis Rhizosphere | VGDLNDGERLRPEKLAAWRALRGRYGNRDESRVDQGTLLA |
| Ga0182036_113387361 | 3300016270 | Soil | GGDSVLYCYMDVYDGQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA |
| Ga0182041_100833691 | 3300016294 | Soil | CYVGDLYDGQRMRPEKLAAWRALRERYGNRDESGVDGGRLLPPAA |
| Ga0182033_104984111 | 3300016319 | Soil | QRMRPEKLAAWQALRERYGNRDESRVDRGRLLAPAA |
| Ga0182035_104674171 | 3300016341 | Soil | RMRPEKLAAWQALRERYGNRDESWVDRGTLVARAR |
| Ga0182035_105740082 | 3300016341 | Soil | HCFVHDLYDGQRMRPERLAAWQALRERYGNRDESRIDGGTLVAPAA |
| Ga0182032_112891252 | 3300016357 | Soil | DLYDGERLRPEKLAAWRALRERYGNRDESRVDQGTLQAPAA |
| Ga0182032_120301711 | 3300016357 | Soil | VLHCFVHDLYDGEQMRPEKLAAWQALRERYGNRDESRVDRGRLLPPAA |
| Ga0182034_105432003 | 3300016371 | Soil | LGCYMHDLYRGRRMRQEKLEAWQALRERYGNRDESRVDRGTLLAPAA |
| Ga0182040_111447571 | 3300016387 | Soil | YCYVGDLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGNLFAPAT |
| Ga0182040_117591081 | 3300016387 | Soil | YDGQRMRPEKLAAWQELRERYGNRDESRVDRGTLVAPAA |
| Ga0182037_102627572 | 3300016404 | Soil | FVHDLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA |
| Ga0182037_116250212 | 3300016404 | Soil | YDSKRMRPEKLQAWQALRERYGNRDESRIDRGTLVAPAA |
| Ga0182039_108370061 | 3300016422 | Soil | CYVHDLYDGERMRPAKLEAWRALRERYGNRDEARVDQGALLAPAA |
| Ga0182039_109766561 | 3300016422 | Soil | QRMRPEKLAAWRALRERYGNRDESRVERGTLLAPAA |
| Ga0182039_110626782 | 3300016422 | Soil | QRMRPEKLQAWQALRERYGNRDESRVDRGILLSPAA |
| Ga0182039_115717081 | 3300016422 | Soil | TVLYCYVHDLYDGRRMRPEKLDAWRALRERYGNRDESRVDRGTLLAPAA |
| Ga0182038_105601512 | 3300016445 | Soil | LYDGQRMRPEKLQAWQALRERYGNRDESRVDRGRLLPPAA |
| Ga0182038_110088831 | 3300016445 | Soil | CYVHDLYDRRQRMRPEKLEAWRALRERYGDRDESRVDQGTLRAPAA |
| Ga0163161_111406091 | 3300017792 | Switchgrass Rhizosphere | LYDGQRMRPEKLAAWRALRERYGNRDESRVVRGTLLASAA |
| Ga0187814_104191492 | 3300017932 | Freshwater Sediment | VGDLYDGERLRPEKLAAWRALRDRYGNRDESRVDQGTLRAPAA |
| Ga0187809_102640061 | 3300017937 | Freshwater Sediment | VEAGRDGQRMRPEKLEAWQALRERFGNRDESRVDRGTLLAPAA |
| Ga0187780_106871102 | 3300017973 | Tropical Peatland | YDGQRMRPEKLAAWRALRERYGNRDESRVDQGTLLAPAA |
| Ga0187777_112234911 | 3300017974 | Tropical Peatland | GKRMRPEKLAAWQALRERYGNRDESRVDRGRLLAPAA |
| Ga0187782_115077961 | 3300017975 | Tropical Peatland | GQRMRPEKLEAWRALRERYGNRDESRVDRGTLLDPAA |
| Ga0187816_101457022 | 3300017995 | Freshwater Sediment | VLYCFVGELYDGQRMRPDKLAAWRALRERYGNRDESRVDRGTLVAPAA |
| Ga0187767_100409752 | 3300017999 | Tropical Peatland | LYCYLHDLYDGQQMRPEKLEAWQALRERYGNRGESRVDRGALLAPVS |
| Ga0187815_101178892 | 3300018001 | Freshwater Sediment | QRMRPEKLAAWHALRERYGNRDESRVDQGTLLAPAA |
| Ga0187766_103568272 | 3300018058 | Tropical Peatland | YIHDLYDGERMRPEKLEAWRALRERYGNRDESRVDRGTILDPAA |
| Ga0187766_110234242 | 3300018058 | Tropical Peatland | CYVHDLYDGQQMRPERLEAWRALRERYGNRDKSRVDGGALLAPAA |
| Ga0187766_111982781 | 3300018058 | Tropical Peatland | SGEDVLHCFVHDLYDGQQMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA |
| Ga0187770_117063361 | 3300018090 | Tropical Peatland | GDTALHCYIHDLYDGQWMRPEKLEAWRALRERYGNRDESRVDRGSLLDPAA |
| Ga0066655_113073541 | 3300018431 | Grasslands Soil | EGQRMRPEKLEAWRALREPYGDRDESRVDRGTLLAPAA |
| Ga0210399_101850181 | 3300020581 | Soil | GQRMRPEKLEAWQALRERYGNRDESRVDRGRLLPPAA |
| Ga0210396_108937871 | 3300021180 | Soil | DQLYDGQRMRPEKLAAWQTLRERYGNRDESTIDAGTLSAAAA |
| Ga0210385_105824941 | 3300021402 | Soil | LYCYVHELYDGQRMRPEKLAAWRALRGGYGNRDESRVDRGALLAPAA |
| Ga0210383_107287071 | 3300021407 | Soil | GQRRRPEKLEAWQALRERYGNRDESRVDRGRLLPPAA |
| Ga0210391_106609361 | 3300021433 | Soil | HCYVHDLYDGQRMRPEKLEAWRTLRERYGNRDESRVDRGTLLAPAA |
| Ga0126371_108283822 | 3300021560 | Tropical Forest Soil | YDGQRMRPEKLAAWQELRERYGNRAESRVDQGTLFAPAA |
| Ga0126371_109078581 | 3300021560 | Tropical Forest Soil | GDSVLHCFVHDLYDGQLMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA |
| Ga0126371_127333681 | 3300021560 | Tropical Forest Soil | MRPEKLEAWQALREGYGDRDELRVDRGTLLALPPEPL |
| Ga0126371_137317241 | 3300021560 | Tropical Forest Soil | SALSCYVHDLYKGHRLRQEKLAAWQALRERYGNRDESRVDRGRLLPPAA |
| Ga0126371_138023012 | 3300021560 | Tropical Forest Soil | YDGQRMRPEKLAAWQALRERYGNRDESRVDRGRLLPPAA |
| Ga0207692_110561531 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | GNKVLHCGVHDLYDGERMRPEKLAAWRALRERYGDRGESRVDQGALRAPAA |
| Ga0207710_104801591 | 3300025900 | Switchgrass Rhizosphere | DTVLNCYVHELYDGQRMRPEKLAAWRALRERYGNRDESRVVRGTLLASAA |
| Ga0207685_107528771 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | GQRMRPEKLAAWQTLRERYGNRDESRVDRGTLVAPAA |
| Ga0207660_114433942 | 3300025917 | Corn Rhizosphere | DLYDGQRMRPEKLRAWRALRERYGNRDESRVDRGRLLPPAT |
| Ga0207646_106186371 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | GEQMRPEKLEAWRALRERYGDRDESRVDRGALLAAAA |
| Ga0207700_102028133 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | CFVHDLYDGQRMRPEKLQAWRALRERYGNRDESRVDRGRLLRPAA |
| Ga0207700_107788571 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GDLYDGRRMRPEKLAAWQALRERYGNRDESRIDRGNLLAPTA |
| Ga0207700_110839641 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | SALGCFVHDLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA |
| Ga0207644_101454553 | 3300025931 | Switchgrass Rhizosphere | CGVHDLYEGEHMRPEKLAAWRALRERYGNRDESKVDQGILMAPAA |
| Ga0207704_114950742 | 3300025938 | Miscanthus Rhizosphere | FNCWVHDLYDGQRMRPEKLRAWRALRERYGNRDESRVDRGRLLPPAT |
| Ga0207704_119656601 | 3300025938 | Miscanthus Rhizosphere | CYVHELYDGQRMRPEKLAAWRTLRERYGNRDESKVARGTLLASAA |
| Ga0207679_103306363 | 3300025945 | Corn Rhizosphere | GQRMRPEKLRAWRALRERYGNRDESRVDRGRLLPPAT |
| Ga0207787_10062702 | 3300026908 | Tropical Forest Soil | MHELYDGQRMRPETLAAWQTLRERYGNRDESRVDRGTLLAPAA |
| Ga0208099_10120751 | 3300027096 | Forest Soil | VLHCYIHDLYDGQRMRPEKLAAWRALRERYGSRDESRVDQGTLIASAA |
| Ga0209522_10375022 | 3300027119 | Forest Soil | PDGESSFSCWVHDLYDGQRMRPERLAAWQALRERYGNRDESRVDQGRLLPPAA |
| Ga0208608_1098781 | 3300027165 | Forest Soil | CYVHDLYDGQQMRPEKLDAWRALRQRYGNRDESRVDRGVLLAPAA |
| Ga0209060_101314601 | 3300027826 | Surface Soil | VLSCYVDELYDGQRMRPEKLQVWQTLRERYGNRDQSRVDRGALLTAAA |
| Ga0268266_112587311 | 3300028379 | Switchgrass Rhizosphere | RMRPEKLRAWRALRERYGNRDESRVDRGRLLPPAT |
| Ga0308309_116553892 | 3300028906 | Soil | ETPLHCYVHDLYDGQRTRLEKLEAWRALRERYGNRDESRVDRGTLLTPAA |
| Ga0310037_102321311 | 3300030494 | Peatlands Soil | DQRMRPEKLEAWQALRERYGNRDESRVDRGTLLTPAA |
| Ga0210287_10608492 | 3300030598 | Soil | CYVHDLYDGQQMRPEKLDAWRALRERYGDRDESRVDRGALLAPAG |
| Ga0307482_12903171 | 3300030730 | Hardwood Forest Soil | YVHELYDGQRMRPEKLAAWRALRERYGNRDESRVNRGTLLASAA |
| Ga0318541_100469814 | 3300031545 | Soil | MDVYDGQRMRPEKLAAWQELRERYGNRDESRVDRGTLVAPAA |
| Ga0318538_102563201 | 3300031546 | Soil | DLYDGQRMRADKLETWQALRERYGNRDESRVDRGRLLPPAA |
| Ga0318538_105067222 | 3300031546 | Soil | FLHCYVGDLYDGRRMRPERLAAWQALRERYGNRDESRVDRGNLLAPTA |
| Ga0318528_100396301 | 3300031561 | Soil | CFVHDLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA |
| Ga0318528_103730171 | 3300031561 | Soil | HDLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGILVAPAA |
| Ga0318573_104488091 | 3300031564 | Soil | FVHDLYDGQRMRPERLAAWQALRERYGNRDESRIDGGTLVAPAA |
| Ga0318515_101476841 | 3300031572 | Soil | DMLHCFVHDLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA |
| Ga0318515_101661393 | 3300031572 | Soil | YVHELYRRQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA |
| Ga0318515_105881261 | 3300031572 | Soil | ESVLWCYVHELYRRQRMRPEKLAAWQALRERYGNRDESRIDRGTLVAPAA |
| Ga0318515_106922461 | 3300031572 | Soil | VLHCYVHDPYHGWRMRPEKLDAWQALRERYGSRDESSIDQGRLRPPAA |
| Ga0310915_102124853 | 3300031573 | Soil | DLYDGERMRPAKLEAWRALRERYGNRDESRVDQGALLAPAA |
| Ga0310915_104948312 | 3300031573 | Soil | YDGERMRPERLQAWQALRERYGNRDESRVDGGRLLPPAA |
| Ga0310915_106134311 | 3300031573 | Soil | KTPLHCYIHDLYDGQRMRPEKLEAWRALRERYGNRDESRVDRGSLLDPAA |
| Ga0310915_108602061 | 3300031573 | Soil | YHGRRMRPKKLAAWQALRERYGNRGESRVERGSLLPSAPVTR |
| Ga0318555_103617121 | 3300031640 | Soil | LYHGRRMRPKKLAAWQALRERYGNRGESRVERGSLLPSAPVTH |
| Ga0318561_101717944 | 3300031679 | Soil | GRRMRPEKLAAWQALRERYGNRDESRVDRGNLLAPAI |
| Ga0318574_103628102 | 3300031680 | Soil | CYVHELYRGQRMRPEKLAAWQALRERYGNRDESRIDRGTLVAPAA |
| Ga0318574_103939791 | 3300031680 | Soil | YEGQRMRPEKLAAWRALRERYGNRDESRVDRGTLMAPAA |
| Ga0318574_104168551 | 3300031680 | Soil | EDTFLHCYVGDLYDGRRMRPERLAAWQALRERYGNRDESRVDRGNLLAPTA |
| Ga0318574_105972711 | 3300031680 | Soil | CYIHDLYRGRRMRPEKLAAWQALRERYGNRDESRVDRGTLLPPPA |
| Ga0318574_106741741 | 3300031680 | Soil | HDLYDGERMRPEKLQAWQALREQYGNRDESRVDRGRLLPRAA |
| Ga0318572_102085001 | 3300031681 | Soil | VHDLYDGERMRPERLQAWQALRERYGNRDESRVDEGRLLPRAA |
| Ga0318560_108124461 | 3300031682 | Soil | FLHCYVGDLYDGRRMRPEKLAAWQALRERYGNRDESRVDRGNLLAPTA |
| Ga0310686_1023526292 | 3300031708 | Soil | SCWVHDLYDGERMRPERLQAWQALRERYGNRDESRVDRGRLLPPAA |
| Ga0310686_1186461591 | 3300031708 | Soil | LGCFVHDLYDGQRMRPEKLQAWQALRERYGNRDESRVDRGRLLPPAA |
| Ga0318496_100860831 | 3300031713 | Soil | LYDRRQRMRPEKLQAWRALRERYGNRDESRVDRGILLPLAA |
| Ga0318496_104060861 | 3300031713 | Soil | VLYCYVGDLYDGQRMRPEKLAAWRALRERYGNRDESGVDGGRLLPPAA |
| Ga0307476_109319231 | 3300031715 | Hardwood Forest Soil | DLYDGERMRPERLQAWQALRERYGNRDESRVDRGRLLPPAA |
| Ga0306917_111828481 | 3300031719 | Soil | RGRRMRPEKLAAWQALRERYGNRDESRVDRGRLLPPAA |
| Ga0318493_100153361 | 3300031723 | Soil | YDRRQRMRPEKLQAWRALRERYGNRDESRVDRGILLPLAA |
| Ga0318493_104279231 | 3300031723 | Soil | GCYVHDLYDRRQRMRPEKLEAWRALRERYGDRDESRVDQGTLRAPAA |
| Ga0318493_105463113 | 3300031723 | Soil | YDSKRMRPEKLQAWQALRERYGNRDESTVDRGSLLPLAV |
| Ga0318493_106955962 | 3300031723 | Soil | SCYVHELYDGEQMRPEKLAAWRALRERYGNRDESRVEQGALLAPAA |
| Ga0318500_107321742 | 3300031724 | Soil | YIHDLYDGQRMRPEKLEAWRALRERYGNRDESRVDRGSLLDPAA |
| Ga0318501_106224921 | 3300031736 | Soil | MVLHCYVGDLYDGQRMRPEKLAAWQALRERYGDRDESRVEQGTLLAPAA |
| Ga0306918_101805214 | 3300031744 | Soil | WLGCYVHDLYDSKRMRPEKLQAWQALRERYGNRDESTVDRGSLLPLAV |
| Ga0306918_107970422 | 3300031744 | Soil | GRRMRPEKLAAWQALRERYGNRDESRVDRGTLLPPPA |
| Ga0318502_100507816 | 3300031747 | Soil | RRQRMRPEKLQAWRALRERYGNRDESRVDRGILLPLAA |
| Ga0318502_102940193 | 3300031747 | Soil | LYHGQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA |
| Ga0318502_103611472 | 3300031747 | Soil | LHCYIHDLYDGERMRPEKLAAWRALRERYGNRDESRVDRGTLLDPAA |
| Ga0318502_108668861 | 3300031747 | Soil | LYDGQLMRPEKLAAWQALRERYGNGDESRVDRGNLVAPTA |
| Ga0318535_100956873 | 3300031764 | Soil | YVHDLYDRRQRMRPEKLQAWRALRERYGNRDESRVDRGILLPLAA |
| Ga0318509_105028422 | 3300031768 | Soil | LYDRRQRMRPEKLQAWRALRERYGNRDESRVDRGRLLAPAA |
| Ga0318521_104674272 | 3300031770 | Soil | LYDRRQRMRPEKLAAWQALRERYGNRDESRVERGILLAPAA |
| Ga0318521_107312911 | 3300031770 | Soil | VLYCYVGELYDGQRMRPEKLAAWRALRERYGNRDESRVDRGRFLPPAA |
| Ga0318546_100590811 | 3300031771 | Soil | QQMRPEKLQAWQALRERYGNRDESIVDRGRLLAPAA |
| Ga0318546_104199551 | 3300031771 | Soil | SLGCWVHDLYDRERMRPERRQAWQALRERYGSRDASRVDGGRLLPPAA |
| Ga0318546_112333882 | 3300031771 | Soil | YDGQRMRPEKLQAWQALRERYGNRDESRVDRGRLLPPAA |
| Ga0318543_105094451 | 3300031777 | Soil | FVDDLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGRLLAPAA |
| Ga0318498_103575721 | 3300031778 | Soil | DKVFGCGVPDLYRGRRMRPEKLAAWQALRERYGNRDESRVDRGRLLPPAA |
| Ga0318498_103663462 | 3300031778 | Soil | DSVLHCFVDDLYDGQRMRPEKLAVWQALRERYGNRDESRVDRGILLPPAA |
| Ga0318498_104030182 | 3300031778 | Soil | LYDGQRMRPEKLEAWRALRERYGNRDESSVDQGTLLAPAA |
| Ga0318552_106960471 | 3300031782 | Soil | HDLYRGRRMRPEKLAAWQALRERYGNRDESRVDRGTLLPPPA |
| Ga0318529_101648943 | 3300031792 | Soil | LYDGQRMRPEKLAAWQALRERYGNRDESRVDRGRLLAPAA |
| Ga0318548_104477323 | 3300031793 | Soil | LYCYVGELYDGQRMRPEKLAAWRALRERYGNRDESRVDRGRFLPPAA |
| Ga0318503_101242861 | 3300031794 | Soil | LYRGRRMRPEKLAAWQALRERYGNRDESRVDRGNLLAPAI |
| Ga0318557_101072211 | 3300031795 | Soil | PNLYHGQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA |
| Ga0318557_102598181 | 3300031795 | Soil | EKLQAWQALRERYGNRDESRVDRGRLLPRPPPDLL |
| Ga0318557_102818181 | 3300031795 | Soil | VLSCYVHELYDGQRMRPEKLAAWRALRERYGYRDESRVERGTLLAPAA |
| Ga0318576_102405493 | 3300031796 | Soil | YHGQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA |
| Ga0318550_100783033 | 3300031797 | Soil | HDLYKRQRMRPEKLAAWQALRERYGNRDESRVDRGRLLAPAA |
| Ga0318497_102135291 | 3300031805 | Soil | TVLYCYVHELYDGQRMRPEKLGTWRALRERYGNRDESRVDRGTLLAPAA |
| Ga0318568_102879462 | 3300031819 | Soil | VLSCYVHELYDGQRMRPEKLAAWRALRERYGNRDESRVERGTLLAPAA |
| Ga0318568_104879422 | 3300031819 | Soil | LYDGQRMRPEKLEAWRALRERYGNRDESRVDRGSLLEPAA |
| Ga0318567_101811842 | 3300031821 | Soil | VHELYDGQRMRPEKLAAWQALRERYGNRDESRVERGALLAPAA |
| Ga0318564_104428771 | 3300031831 | Soil | DVLHCFVHDLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA |
| Ga0318512_100942491 | 3300031846 | Soil | ELYDGQRMRPEKLAAWRALRERYGNRDESRVERGTLLAPAA |
| Ga0318495_100950712 | 3300031860 | Soil | LYCYMDVYDGQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA |
| Ga0318495_103128921 | 3300031860 | Soil | GEKTPLHCYIHDLYDGQRMRPEKLEAWRALRERYGNRDESRVDRGSLLEPAA |
| Ga0306919_101353101 | 3300031879 | Soil | YHGRRMRPEKLQAWQALRERYGNRDESRVDRGTLLPPVT |
| Ga0306919_114926391 | 3300031879 | Soil | SCYVHELYDGQRMRPEKLAAWRALRERYGNRDESRVERGTLLAPAA |
| Ga0306925_107195961 | 3300031890 | Soil | LHCYVHELYDGRRMRPEKLAAWQALRERYGNRDESRVERGALLAPAA |
| Ga0306925_109114761 | 3300031890 | Soil | GGENWLGCYVHDLYDGQRMRPEKLAAWQALRERYGDRDESRVDRGRLLPPAE |
| Ga0306925_116926512 | 3300031890 | Soil | HDLYKGRRMRPERLAAWQALRERYGSRDESRVDRGTLQAPAA |
| Ga0318536_101210241 | 3300031893 | Soil | EDKVFGCGVPNLYRGRRMRPEKLAAWQALRERYGNRDESRVERGILLAPAA |
| Ga0318522_103548022 | 3300031894 | Soil | YDGQRMRPDKPAAWYALRERYGNRDESRVDHGTLLALDA |
| Ga0318551_109292932 | 3300031896 | Soil | YCYVHELYDGQRMRPEKLEAWRALREDYGDRDESRVDRGTLFAPAA |
| Ga0318520_105757731 | 3300031897 | Soil | HDLYHGRRMRPEKLQAWQALRERYGNRDESRVDRGTLLPPVN |
| Ga0306923_111229042 | 3300031910 | Soil | DRRQRMRPEKLAAWQALRERYGNRDESRVERGILLAPAA |
| Ga0306921_108619541 | 3300031912 | Soil | HCFVHDLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA |
| Ga0306921_110559501 | 3300031912 | Soil | ADTALHCYIHDLYRGRRMRPEKLAAWQALRERYGNRDESRVERGILLAPAA |
| Ga0306921_114483651 | 3300031912 | Soil | FCYVHELYDGQRMRPEKLAAWQALRERYGNRDESRVDRGALSAPALVSPAQS |
| Ga0308174_104136721 | 3300031939 | Soil | RMRPEKLEAWRALRERYGNRDESSVDRGALLAPAA |
| Ga0310913_101725873 | 3300031945 | Soil | QRMRPEKLAAWRALRERYGNRDESRVEQGILLAPAA |
| Ga0310910_110728642 | 3300031946 | Soil | DLYDGRRMRPERLAAWQALRERYGNRDESRVDRGNLLAPTA |
| Ga0310910_111222331 | 3300031946 | Soil | ERMRPERLQAWQALRERYGNRDESRVDEGRLLPRAA |
| Ga0306926_104378103 | 3300031954 | Soil | GDAVLHCYVHELYDGRRMRPEKLAAWQALRERYGNRDESRVERGALLAPAA |
| Ga0318531_103860382 | 3300031981 | Soil | YDSERMRPERLAAWQALRERYGNRDESRVDRGRLLPPPA |
| Ga0306922_105765622 | 3300032001 | Soil | YIHDLYDGERMRPEKLAAWRALRERYGNRDESRVDRGTLLDPAA |
| Ga0306922_112687092 | 3300032001 | Soil | RMRPEKLAAWQALRERYGNRDESRVERGALLAPAA |
| Ga0306922_113107292 | 3300032001 | Soil | LHCFVEDLYDGQRMRPEKLQAWQALRERYGNRDESRVDRGRLLPPAA |
| Ga0306922_120904922 | 3300032001 | Soil | CGVHELYDGQLMRPEKLAAWQALRERYGNGDESRVDRGNLVAPTA |
| Ga0318562_102924671 | 3300032008 | Soil | CYVGELYDGQRMRPEKLAAWQALRERYGNRDESRVERGRLLPPAA |
| Ga0318562_107472601 | 3300032008 | Soil | VLHCFVHDLYDGQRMRPEKLTAWQALRERYGNRDESRVDRGTLVAPAA |
| Ga0318562_107557251 | 3300032008 | Soil | RRMRPEKLAAWQALRERYGNRDESRVDRGTLLPPPA |
| Ga0318562_108658731 | 3300032008 | Soil | YKGRRMRREKLAAWQALRERYGNRDESRVDRGNLFAPAI |
| Ga0318563_101474813 | 3300032009 | Soil | YDGQRMCPEKLAAWRALRERYGNRDESGVDGGRLLPPAA |
| Ga0310911_103514363 | 3300032035 | Soil | HDLYDGEQMRPEKLAAWQALRERYGNRDESRVDRGRLLPPAA |
| Ga0318559_101438561 | 3300032039 | Soil | HGLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA |
| Ga0318559_105722431 | 3300032039 | Soil | CYVHDLYDGQRMRPDKPAAWHALRERYGNRDESRVDHGTLLALDA |
| Ga0318545_101962352 | 3300032042 | Soil | LYDGQRMRPEKLAAWRALRERYGNRDESRVDRGTLLAPAA |
| Ga0318556_103025421 | 3300032043 | Soil | YDGQLMRPEKLAAWQALRERYGNGDESRVDRGNLVAPTA |
| Ga0318556_105508891 | 3300032043 | Soil | LYKGRRMRPERLAAWQALRERYGSRDESRVDRGTLQAPAA |
| Ga0318558_106041561 | 3300032044 | Soil | AVGCYVHDLYKGRRMRPERLAAWQALRERYGSRDESRVDRGTLQAPAA |
| Ga0318558_106582452 | 3300032044 | Soil | WVPDLYDGERIRLERLQAWQALRERYGNRDESRVDRGRLLPPAA |
| Ga0318506_102460153 | 3300032052 | Soil | QRMRPEELAAWQALRERYGNRDESRVDRGRLLPPAA |
| Ga0318506_103806102 | 3300032052 | Soil | GDSVLHCFVDDLYDGQRMRPEKLAVWQALRERYGNRDESRVDRGILLPPAA |
| Ga0318570_100220881 | 3300032054 | Soil | YVGDLYDGQRMRPEKLAAWRALRERYGNRDESRVDRGTLLAPAA |
| Ga0318575_103540742 | 3300032055 | Soil | PGGESAVGCYVHDLYKGRRMRPERLAAWQALRERYGSRDESRVDRGTLQAPAA |
| Ga0318575_103643082 | 3300032055 | Soil | YDGERMRPEKLQAWQALREQYGNRDESRVDRGRLLPRAA |
| Ga0318575_104632571 | 3300032055 | Soil | VLYCYVHELYDGQRMRPEKLAAWQALRERYGNRDESRVERGALLAPAA |
| Ga0318533_104213013 | 3300032059 | Soil | DLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGRLLAPAA |
| Ga0318504_102204471 | 3300032063 | Soil | LYHGRRMRPEKLAAWQALRERYGNRDESRVDRGTLLPPPA |
| Ga0318504_103217761 | 3300032063 | Soil | GGESWLGCYVHDLYDRRQRMRPEKLQAWRALRERYGNRDESRVDRGILLPLAA |
| Ga0318504_103317701 | 3300032063 | Soil | DLYDGQRMRPEKLEAWRALRERYGNRDESRVDRGTLLAPAA |
| Ga0318513_102483441 | 3300032065 | Soil | GEDSVLYCYMDVYDGQRMRPEKLAAWQALRERYGNRDESRVDRGTLVAPAA |
| Ga0318513_103193071 | 3300032065 | Soil | VHDLYHGRRMRPKKLAAWQALRERYGNRGESRVERGSLLPSAPVTR |
| Ga0318513_105708302 | 3300032065 | Soil | GKSLLHCFVDDLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGRLLAPAA |
| Ga0318514_105343661 | 3300032066 | Soil | YIHDLYRGRRMRPEKLAAWQALRERYGNRDESRVDRGTLLPPAA |
| Ga0318514_105347422 | 3300032066 | Soil | GCYVHDLYKGRRMRPERLAAWQALRERYGNRDESSVNRGTLQAPAA |
| Ga0318514_108011541 | 3300032066 | Soil | VLHCYLGGLYHGRRMRPEKLAAWQALRERYGNRDESRVEQGTLLAAAT |
| Ga0318524_103155121 | 3300032067 | Soil | LYDGQRMRPEKLAAWRALRERYGNRDESRVERGTLLAPAA |
| Ga0318524_106523161 | 3300032067 | Soil | LHCFVDDLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGRLLAPAA |
| Ga0318524_107213251 | 3300032067 | Soil | YVHDLYHGRRMRPEKLAAWRALRERYGDRDESRVDQGTLLAPAA |
| Ga0318553_101313923 | 3300032068 | Soil | VLHCFVDDLYDGQRMRPEKLAAWQALRERYGNRDESRVDRGRLLPPAA |
| Ga0318553_106180112 | 3300032068 | Soil | KVFGCGVPNLYKGRRMRREKLAAWQALRERYGNRDESRVDRGNLFAPAI |
| Ga0306924_102328803 | 3300032076 | Soil | HELYDGQRMRPEKLAAWRALRERYGNRDESRVERGTLLAPAA |
| Ga0306924_110170782 | 3300032076 | Soil | LGCWVHDLYDGERMRPERLQAWQALRERYGNRDESRVDRGTLAAPAA |
| Ga0306924_122062572 | 3300032076 | Soil | RMRPEKLAAWQALRERYGNRDESRVDRGRLLAPAA |
| Ga0318518_101689431 | 3300032090 | Soil | QRMRPEKLQAWQALRERYGNRDESRVDRGRLLPPAA |
| Ga0318540_105791471 | 3300032094 | Soil | YKGRRMRPERLAAWQALRERYGNRDESSVNRGTLQAPAA |
| Ga0306920_1006113233 | 3300032261 | Soil | LHCYIHDLYRGRRMRPEKLAAWQALRERYGNRDESRVDRGTLLPPAA |
| Ga0335085_100803301 | 3300032770 | Soil | ELYDGERMRPEKQQAWRSLRERYGNRDESRVDRGALLAPAA |
| Ga0335078_100308615 | 3300032805 | Soil | RMRPEKLAAWQALRERYGNRDESTVDRGTLLAPAA |
| Ga0335080_106395961 | 3300032828 | Soil | DGQRIRPEKLAAWQALRERYGNRDESRVDRGNLFAPAA |
| Ga0335071_104929401 | 3300032897 | Soil | VHDLYDGQRMRPEKLEAWRALRERYGNRDESRVDRSTLVTPAA |
| Ga0335083_107744211 | 3300032954 | Soil | DAVLHCYVHELYDGQRMRPEKLAAWRALRERYGDRDESRVDQGALLAPVP |
| Ga0335077_115289841 | 3300033158 | Soil | GCGVHDLYDGQRMRPEKLEAWRALRERYGNRDESRVDRGTLQAPAA |
| Ga0318519_105311391 | 3300033290 | Soil | GGDSVLYCFLDVYDGQRMRPEKLAAWQALRERYGNRDESRVEQGALLTPAA |
| Ga0318519_107931841 | 3300033290 | Soil | VHDPYHGWRMRPEKLDAWQALRERYGSRDESSIDQGRLRPPAA |
| ⦗Top⦘ |