Basic Information | |
---|---|
Family ID | F012665 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 278 |
Average Sequence Length | 43 residues |
Representative Sequence | QTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAASSVSGAPGG |
Number of Associated Samples | 172 |
Number of Associated Scaffolds | 278 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.28 % |
% of genes from short scaffolds (< 2000 bps) | 93.53 % |
Associated GOLD sequencing projects | 155 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.53 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (87.770 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.827 % of family members) |
Environment Ontology (ENVO) | Unclassified (34.173 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (58.993 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.42% β-sheet: 0.00% Coil/Unstructured: 46.58% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 278 Family Scaffolds |
---|---|---|
PF07811 | TadE | 25.54 |
PF13400 | Tad | 5.40 |
PF04964 | Flp_Fap | 5.40 |
PF07837 | FTCD_N | 3.24 |
PF13581 | HATPase_c_2 | 1.80 |
PF07311 | Dodecin | 1.44 |
PF05345 | He_PIG | 1.08 |
PF00221 | Lyase_aromatic | 0.72 |
PF08448 | PAS_4 | 0.72 |
PF00109 | ketoacyl-synt | 0.72 |
PF02801 | Ketoacyl-synt_C | 0.72 |
PF14833 | NAD_binding_11 | 0.72 |
PF07040 | DUF1326 | 0.36 |
PF08241 | Methyltransf_11 | 0.36 |
PF08529 | NusA_N | 0.36 |
PF01551 | Peptidase_M23 | 0.36 |
PF00589 | Phage_integrase | 0.36 |
PF05762 | VWA_CoxE | 0.36 |
PF05199 | GMC_oxred_C | 0.36 |
PF01402 | RHH_1 | 0.36 |
PF14721 | AIF_C | 0.36 |
PF13474 | SnoaL_3 | 0.36 |
PF02812 | ELFV_dehydrog_N | 0.36 |
PF00072 | Response_reg | 0.36 |
COG ID | Name | Functional Category | % Frequency in 278 Family Scaffolds |
---|---|---|---|
COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 5.40 |
COG3643 | Glutamate formiminotransferase | Amino acid transport and metabolism [E] | 3.24 |
COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 1.44 |
COG2986 | Histidine ammonia-lyase | Amino acid transport and metabolism [E] | 0.72 |
COG0334 | Glutamate dehydrogenase/leucine dehydrogenase | Amino acid transport and metabolism [E] | 0.36 |
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.36 |
COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.36 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 88.13 % |
Unclassified | root | N/A | 11.87 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000881|JGI10215J12807_1169646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 910 | Open in IMG/M |
3300000956|JGI10216J12902_102268410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 605 | Open in IMG/M |
3300000956|JGI10216J12902_111608360 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300003998|Ga0055472_10289852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
3300004019|Ga0055439_10220612 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300004024|Ga0055436_10251772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Eggerthellales → Eggerthellaceae → Eggerthella → unclassified Eggerthella → Eggerthella sp. 1_3_56FAA | 564 | Open in IMG/M |
3300004156|Ga0062589_100773696 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300004156|Ga0062589_102198524 | Not Available | 565 | Open in IMG/M |
3300004157|Ga0062590_100484743 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
3300004479|Ga0062595_100261692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1132 | Open in IMG/M |
3300004643|Ga0062591_102738151 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300005213|Ga0068998_10139620 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300005328|Ga0070676_10276581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1130 | Open in IMG/M |
3300005328|Ga0070676_10424624 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
3300005328|Ga0070676_10990017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Robbsia → Robbsia andropogonis | 630 | Open in IMG/M |
3300005329|Ga0070683_100333393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1444 | Open in IMG/M |
3300005329|Ga0070683_101480704 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300005331|Ga0070670_102197371 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300005332|Ga0066388_100448282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1932 | Open in IMG/M |
3300005332|Ga0066388_100542644 | All Organisms → cellular organisms → Bacteria | 1793 | Open in IMG/M |
3300005332|Ga0066388_106428305 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300005332|Ga0066388_107269097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales | 556 | Open in IMG/M |
3300005335|Ga0070666_10380048 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
3300005345|Ga0070692_11129071 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300005347|Ga0070668_101083566 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300005355|Ga0070671_101240295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Eggerthellales → Eggerthellaceae → Eggerthella | 657 | Open in IMG/M |
3300005356|Ga0070674_100351566 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
3300005356|Ga0070674_100675352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 880 | Open in IMG/M |
3300005356|Ga0070674_101932341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 536 | Open in IMG/M |
3300005365|Ga0070688_100742234 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
3300005365|Ga0070688_101565340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Eggerthellales → Eggerthellaceae → Eggerthella → unclassified Eggerthella → Eggerthella sp. HGA1 | 537 | Open in IMG/M |
3300005441|Ga0070700_101726944 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300005445|Ga0070708_101008948 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300005445|Ga0070708_101490069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 630 | Open in IMG/M |
3300005456|Ga0070678_102384227 | Not Available | 502 | Open in IMG/M |
3300005459|Ga0068867_102269211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → Paenibacillus mucilaginosus | 515 | Open in IMG/M |
3300005466|Ga0070685_10076576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1995 | Open in IMG/M |
3300005535|Ga0070684_100157809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2057 | Open in IMG/M |
3300005535|Ga0070684_100520393 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
3300005535|Ga0070684_101546236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Atopobiaceae → Atopobium → unclassified Atopobium → Atopobium sp. oral taxon 810 | 625 | Open in IMG/M |
3300005543|Ga0070672_101459538 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300005543|Ga0070672_101633119 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300005543|Ga0070672_101833373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae | 545 | Open in IMG/M |
3300005577|Ga0068857_100486704 | Not Available | 1157 | Open in IMG/M |
3300005577|Ga0068857_100651077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 998 | Open in IMG/M |
3300005577|Ga0068857_102366699 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300005578|Ga0068854_101365575 | Not Available | 640 | Open in IMG/M |
3300005615|Ga0070702_100287837 | Not Available | 1131 | Open in IMG/M |
3300005615|Ga0070702_101346226 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300005764|Ga0066903_106404745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 614 | Open in IMG/M |
3300005840|Ga0068870_10072118 | Not Available | 1886 | Open in IMG/M |
3300005840|Ga0068870_10441996 | Not Available | 855 | Open in IMG/M |
3300005840|Ga0068870_10524269 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300005841|Ga0068863_100695110 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
3300006049|Ga0075417_10705245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia | 519 | Open in IMG/M |
3300006577|Ga0074050_12052609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1219 | Open in IMG/M |
3300006844|Ga0075428_102695674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales | 506 | Open in IMG/M |
3300006845|Ga0075421_101150771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Eggerthellales → Eggerthellaceae → Eggerthella → unclassified Eggerthella → Eggerthella sp. 1_3_56FAA | 868 | Open in IMG/M |
3300006845|Ga0075421_102520142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
3300006847|Ga0075431_101032048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae | 788 | Open in IMG/M |
3300006852|Ga0075433_10208628 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
3300006852|Ga0075433_11818114 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300006854|Ga0075425_101767418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 695 | Open in IMG/M |
3300006854|Ga0075425_101992128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 649 | Open in IMG/M |
3300006871|Ga0075434_100102524 | All Organisms → cellular organisms → Bacteria | 2869 | Open in IMG/M |
3300006880|Ga0075429_101936279 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300006881|Ga0068865_100544841 | Not Available | 973 | Open in IMG/M |
3300006894|Ga0079215_11107239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
3300006904|Ga0075424_100015190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 7770 | Open in IMG/M |
3300006904|Ga0075424_100161579 | All Organisms → cellular organisms → Bacteria | 2374 | Open in IMG/M |
3300006904|Ga0075424_102736010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
3300006918|Ga0079216_11446897 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300009094|Ga0111539_10062612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4403 | Open in IMG/M |
3300009094|Ga0111539_10645604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1232 | Open in IMG/M |
3300009094|Ga0111539_12790383 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300009098|Ga0105245_10486244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1248 | Open in IMG/M |
3300009098|Ga0105245_12990842 | Not Available | 524 | Open in IMG/M |
3300009147|Ga0114129_10953370 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
3300009147|Ga0114129_11115539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 987 | Open in IMG/M |
3300009148|Ga0105243_12166937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
3300009148|Ga0105243_13091977 | Not Available | 504 | Open in IMG/M |
3300009153|Ga0105094_10979228 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300009156|Ga0111538_10703736 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
3300009156|Ga0111538_11793428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 772 | Open in IMG/M |
3300009176|Ga0105242_10850529 | Not Available | 908 | Open in IMG/M |
3300009176|Ga0105242_10878634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 894 | Open in IMG/M |
3300009176|Ga0105242_11419253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 722 | Open in IMG/M |
3300009176|Ga0105242_12854289 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300009553|Ga0105249_11753849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
3300009821|Ga0105064_1149926 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300010362|Ga0126377_10771712 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
3300010366|Ga0126379_12430085 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300010373|Ga0134128_12840512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
3300010397|Ga0134124_10609682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1070 | Open in IMG/M |
3300010400|Ga0134122_13411174 | Not Available | 500 | Open in IMG/M |
3300010403|Ga0134123_10158151 | All Organisms → cellular organisms → Bacteria | 1884 | Open in IMG/M |
3300010403|Ga0134123_11824575 | Not Available | 662 | Open in IMG/M |
3300010403|Ga0134123_12093552 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300010403|Ga0134123_12361177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 596 | Open in IMG/M |
3300011107|Ga0151490_1407681 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300011119|Ga0105246_10318449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1263 | Open in IMG/M |
3300011119|Ga0105246_10423519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1112 | Open in IMG/M |
3300011440|Ga0137433_1064117 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
3300012022|Ga0120191_10106004 | Not Available | 588 | Open in IMG/M |
3300012892|Ga0157294_10134587 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300012900|Ga0157292_10134806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium RBG_16_68_12 | 772 | Open in IMG/M |
3300012904|Ga0157282_10141806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 723 | Open in IMG/M |
3300012905|Ga0157296_10280408 | Not Available | 574 | Open in IMG/M |
3300012907|Ga0157283_10155669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 678 | Open in IMG/M |
3300012907|Ga0157283_10169609 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300012911|Ga0157301_10377185 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300012912|Ga0157306_10231014 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300012915|Ga0157302_10048018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1196 | Open in IMG/M |
3300012916|Ga0157310_10063870 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
3300012948|Ga0126375_10977991 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300012951|Ga0164300_10246489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 904 | Open in IMG/M |
3300012958|Ga0164299_10217031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1118 | Open in IMG/M |
3300012958|Ga0164299_11288415 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300012958|Ga0164299_11310097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 554 | Open in IMG/M |
3300012986|Ga0164304_11569344 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300013096|Ga0157307_1029492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 947 | Open in IMG/M |
3300013306|Ga0163162_12998889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
3300013307|Ga0157372_13220874 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300013308|Ga0157375_11535070 | Not Available | 786 | Open in IMG/M |
3300013308|Ga0157375_12345615 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300013308|Ga0157375_12839921 | Not Available | 579 | Open in IMG/M |
3300014272|Ga0075327_1315713 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300014296|Ga0075344_1153217 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300014301|Ga0075323_1077465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 687 | Open in IMG/M |
3300014325|Ga0163163_10871279 | Not Available | 964 | Open in IMG/M |
3300014325|Ga0163163_11968580 | Not Available | 644 | Open in IMG/M |
3300014326|Ga0157380_12583588 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300014326|Ga0157380_13454828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
3300014745|Ga0157377_10002317 | All Organisms → cellular organisms → Bacteria | 8376 | Open in IMG/M |
3300014969|Ga0157376_11852653 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300015200|Ga0173480_10336190 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300015371|Ga0132258_10079270 | All Organisms → cellular organisms → Bacteria | 7654 | Open in IMG/M |
3300015371|Ga0132258_10274138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4136 | Open in IMG/M |
3300015371|Ga0132258_10490194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3071 | Open in IMG/M |
3300015371|Ga0132258_11006652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2106 | Open in IMG/M |
3300015371|Ga0132258_11367088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 1789 | Open in IMG/M |
3300015371|Ga0132258_12658523 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
3300015371|Ga0132258_13657538 | Not Available | 1050 | Open in IMG/M |
3300015371|Ga0132258_13684951 | Not Available | 1046 | Open in IMG/M |
3300015371|Ga0132258_13688370 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
3300015371|Ga0132258_13692505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1045 | Open in IMG/M |
3300015372|Ga0132256_100033593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4660 | Open in IMG/M |
3300015372|Ga0132256_100116851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2626 | Open in IMG/M |
3300015372|Ga0132256_101491305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 787 | Open in IMG/M |
3300015372|Ga0132256_103048268 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300015372|Ga0132256_103623648 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300015372|Ga0132256_103644746 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300015372|Ga0132256_103931515 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300015373|Ga0132257_100467093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1543 | Open in IMG/M |
3300015373|Ga0132257_100560288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1408 | Open in IMG/M |
3300015373|Ga0132257_100953983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1077 | Open in IMG/M |
3300015373|Ga0132257_101092992 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
3300015373|Ga0132257_102938516 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300015373|Ga0132257_103699922 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300015374|Ga0132255_101592350 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
3300015374|Ga0132255_102272114 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300015374|Ga0132255_102430871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 800 | Open in IMG/M |
3300015374|Ga0132255_103911845 | Not Available | 632 | Open in IMG/M |
3300015374|Ga0132255_104129156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 616 | Open in IMG/M |
3300015374|Ga0132255_104411429 | Not Available | 596 | Open in IMG/M |
3300015374|Ga0132255_106345449 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300016319|Ga0182033_11002736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 743 | Open in IMG/M |
3300017792|Ga0163161_11603661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 574 | Open in IMG/M |
3300017965|Ga0190266_10928071 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300017965|Ga0190266_11009063 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300018028|Ga0184608_10326698 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300018055|Ga0184616_10096382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1050 | Open in IMG/M |
3300018067|Ga0184611_1089246 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
3300018072|Ga0184635_10277602 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300018073|Ga0184624_10042640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1807 | Open in IMG/M |
3300018073|Ga0184624_10520852 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300018073|Ga0184624_10538848 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300018081|Ga0184625_10305810 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300018469|Ga0190270_10045366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3009 | Open in IMG/M |
3300018469|Ga0190270_10709512 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
3300018469|Ga0190270_10828002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 935 | Open in IMG/M |
3300018469|Ga0190270_10965831 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
3300018469|Ga0190270_11981124 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300018481|Ga0190271_10057845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3347 | Open in IMG/M |
3300018481|Ga0190271_10301248 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
3300018481|Ga0190271_10532484 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
3300018481|Ga0190271_10881475 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
3300018481|Ga0190271_11442734 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300018481|Ga0190271_12025467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 684 | Open in IMG/M |
3300018481|Ga0190271_13004891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
3300018481|Ga0190271_13168155 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300019356|Ga0173481_10441851 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300019361|Ga0173482_10621850 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300019362|Ga0173479_10626212 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300019377|Ga0190264_11190332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 632 | Open in IMG/M |
3300020005|Ga0193697_1094381 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300020020|Ga0193738_1180650 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300021082|Ga0210380_10513207 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300022756|Ga0222622_10852726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 667 | Open in IMG/M |
3300022756|Ga0222622_11156981 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300022883|Ga0247786_1051509 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
3300023066|Ga0247793_1069830 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300023266|Ga0247789_1135911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
3300025165|Ga0209108_10118336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1416 | Open in IMG/M |
3300025165|Ga0209108_10533417 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300025325|Ga0209341_10120814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2209 | Open in IMG/M |
3300025325|Ga0209341_10757009 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300025325|Ga0209341_11150826 | Not Available | 555 | Open in IMG/M |
3300025549|Ga0210094_1046287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 760 | Open in IMG/M |
3300025901|Ga0207688_10829731 | Not Available | 586 | Open in IMG/M |
3300025903|Ga0207680_10358761 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
3300025907|Ga0207645_10957669 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300025908|Ga0207643_10765478 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300025908|Ga0207643_10976267 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300025918|Ga0207662_10184453 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
3300025923|Ga0207681_11339143 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300025925|Ga0207650_10397514 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
3300025925|Ga0207650_10720609 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300025926|Ga0207659_10229931 | Not Available | 1495 | Open in IMG/M |
3300025926|Ga0207659_10590604 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
3300025926|Ga0207659_10809487 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300025926|Ga0207659_11540558 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300025934|Ga0207686_11167204 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300025934|Ga0207686_11200491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
3300025934|Ga0207686_11541178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 548 | Open in IMG/M |
3300025934|Ga0207686_11647287 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300025934|Ga0207686_11745608 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300025937|Ga0207669_10124426 | All Organisms → cellular organisms → Bacteria | 1758 | Open in IMG/M |
3300025937|Ga0207669_10525970 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
3300025938|Ga0207704_11257077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 632 | Open in IMG/M |
3300025940|Ga0207691_10612329 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
3300025940|Ga0207691_10635076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 903 | Open in IMG/M |
3300025940|Ga0207691_11538460 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300025942|Ga0207689_10247882 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
3300025944|Ga0207661_10564433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1043 | Open in IMG/M |
3300025944|Ga0207661_10971271 | Not Available | 782 | Open in IMG/M |
3300025972|Ga0207668_10289614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1347 | Open in IMG/M |
3300026089|Ga0207648_10783773 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
3300026095|Ga0207676_10195320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1784 | Open in IMG/M |
3300026116|Ga0207674_10502844 | Not Available | 1171 | Open in IMG/M |
3300026121|Ga0207683_10031291 | All Organisms → cellular organisms → Bacteria | 4618 | Open in IMG/M |
3300026121|Ga0207683_11380172 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300027163|Ga0209878_1042812 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300027332|Ga0209861_1037093 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
3300027523|Ga0208890_1024154 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
3300027561|Ga0209887_1107192 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300027907|Ga0207428_10269609 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium | 1266 | Open in IMG/M |
3300027907|Ga0207428_10632283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 769 | Open in IMG/M |
3300028379|Ga0268266_11168338 | Not Available | 744 | Open in IMG/M |
3300028592|Ga0247822_11688888 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300028814|Ga0307302_10202811 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
3300028819|Ga0307296_10482567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 678 | Open in IMG/M |
3300028881|Ga0307277_10487125 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300030619|Ga0268386_10527269 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300030831|Ga0308152_112727 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300031422|Ga0308186_1037262 | Not Available | 521 | Open in IMG/M |
3300031572|Ga0318515_10393663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 742 | Open in IMG/M |
3300031576|Ga0247727_11128935 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300031682|Ga0318560_10717706 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300031744|Ga0306918_11086789 | Not Available | 620 | Open in IMG/M |
3300031765|Ga0318554_10139871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1372 | Open in IMG/M |
3300031845|Ga0318511_10215636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 856 | Open in IMG/M |
3300031873|Ga0315297_11082115 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300031943|Ga0310885_10433724 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 706 | Open in IMG/M |
3300031997|Ga0315278_10872411 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
3300031999|Ga0315274_11572753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 620 | Open in IMG/M |
3300032013|Ga0310906_10271392 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1069 | Open in IMG/M |
3300032066|Ga0318514_10302974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 845 | Open in IMG/M |
3300032177|Ga0315276_11469090 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300032342|Ga0315286_11842943 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300032397|Ga0315287_10064842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 4059 | Open in IMG/M |
3300032516|Ga0315273_11370759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 878 | Open in IMG/M |
3300032516|Ga0315273_11605640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 793 | Open in IMG/M |
3300033407|Ga0214472_10817150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 838 | Open in IMG/M |
3300033551|Ga0247830_11139637 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300034176|Ga0364931_0112287 | Not Available | 867 | Open in IMG/M |
3300034662|Ga0314783_140248 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.83% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 8.27% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.27% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 6.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.40% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.60% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.60% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.88% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.88% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.16% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.52% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.52% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 2.52% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.80% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.80% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.80% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.80% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.44% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.44% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.44% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.08% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.08% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.08% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.08% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.08% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.72% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.72% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.72% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.72% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.72% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.36% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.36% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.36% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.36% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.36% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.36% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.36% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.36% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.36% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005213 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
3300014296 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1 | Environmental | Open in IMG/M |
3300014301 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 | Environmental | Open in IMG/M |
3300014317 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018055 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex | Environmental | Open in IMG/M |
3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
3300023066 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6 | Environmental | Open in IMG/M |
3300023266 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4 | Environmental | Open in IMG/M |
3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
3300025549 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027163 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes) | Environmental | Open in IMG/M |
3300027332 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
3300030831 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_141 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031422 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_181 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
3300034662 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10215J12807_11696461 | 3300000881 | Soil | ILLGFLAIAIIIALFFLRNVLRDLFSDAASSVSNAPG* |
JGI10216J12902_1022684101 | 3300000956 | Soil | TEYAILLGFLAIAIIIALFFLRNVLRQLFSSAASSVSNAPG* |
JGI10216J12902_1116083602 | 3300000956 | Soil | GFLAIAIIIALFFLRNVLRSLFSNAASSVSSAPDG* |
Ga0055472_102898522 | 3300003998 | Natural And Restored Wetlands | EDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAASSVSRAPG* |
Ga0055439_102206121 | 3300004019 | Natural And Restored Wetlands | EDGQTTTEYAILLGFLAIAIIIALFFLRNVLRQLFSDAANSVQSAPGP* |
Ga0055436_102517721 | 3300004024 | Natural And Restored Wetlands | REREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSDAASSVSGAGN* |
Ga0062589_1007736961 | 3300004156 | Soil | TTTEYAILLGFLAIAIIIALFFLRNVLRGLFSTAASSVSNAPG* |
Ga0062589_1021985242 | 3300004156 | Soil | EYAILLGFLAIAIIIALFFLRNVLRSLFSQAASSVSGAPNS* |
Ga0062590_1004847433 | 3300004157 | Soil | QTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSKAPGT* |
Ga0062595_1002616922 | 3300004479 | Soil | QTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSNAASSVSGAPDS* |
Ga0062591_1027381512 | 3300004643 | Soil | REREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRQLFSDAAKSVQSSPGSP* |
Ga0068998_101396201 | 3300005213 | Natural And Restored Wetlands | QTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSDAASSVSGAGN* |
Ga0070676_102765811 | 3300005328 | Miscanthus Rhizosphere | QTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNG* |
Ga0070676_104246243 | 3300005328 | Miscanthus Rhizosphere | GQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNG* |
Ga0070676_109900171 | 3300005328 | Miscanthus Rhizosphere | TTTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSRAPN* |
Ga0070683_1003333933 | 3300005329 | Corn Rhizosphere | TTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNG* |
Ga0070683_1014807042 | 3300005329 | Corn Rhizosphere | TTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPN* |
Ga0070670_1021973711 | 3300005331 | Switchgrass Rhizosphere | AILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSGAPNG* |
Ga0066388_1004482823 | 3300005332 | Tropical Forest Soil | VHELREREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSNAASSVSGAPDS* |
Ga0066388_1005426444 | 3300005332 | Tropical Forest Soil | EREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSNAASSVSGAPDS* |
Ga0066388_1064283051 | 3300005332 | Tropical Forest Soil | DGQTTTEYAILLGFLAIAIIVALFFLRTVLKNLFSDAAQSVSDAGGP* |
Ga0066388_1072690971 | 3300005332 | Tropical Forest Soil | EREDGQTTTEYAILLGFLAIAIIVALFFLRNVLRGLFSNAASSVSNAPNG* |
Ga0070666_103800481 | 3300005335 | Switchgrass Rhizosphere | EREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNG* |
Ga0070692_111290712 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | EDGQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSKAPGT* |
Ga0070668_1010835662 | 3300005347 | Switchgrass Rhizosphere | QTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSKGPGN* |
Ga0070671_1012402952 | 3300005355 | Switchgrass Rhizosphere | RNREEGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSKAASSVSGAPG* |
Ga0070674_1003515663 | 3300005356 | Miscanthus Rhizosphere | TTEYAILLGFLAIAIIVALFFLRNVLRSLFSSAASSVSGAPN* |
Ga0070674_1006753521 | 3300005356 | Miscanthus Rhizosphere | EDGQTTTEYAILLGFLAIAIIVALFFLRNVLRSLFSSAASSVSRAPG* |
Ga0070674_1019323411 | 3300005356 | Miscanthus Rhizosphere | DGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAAQSVSRAPG* |
Ga0070688_1007422342 | 3300005365 | Switchgrass Rhizosphere | LREREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSTAAQSVSRAPN* |
Ga0070688_1015653402 | 3300005365 | Switchgrass Rhizosphere | HQLREREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAAQSVSRAPN* |
Ga0070700_1017269442 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | TTEYAILLGFLAIAIIVALFFLRNVLRSLFSSAASSVSRAPG* |
Ga0070708_1010089482 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GQTTTEYAILLGFLAIAIIVALFFLRNVLRGLFSNAASSVSGAPG* |
Ga0070708_1014900691 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GQTTTEYAILLGFLAIAIIVALFFLRNVLRGLFSNAASSVSNAPG* |
Ga0070678_1023842272 | 3300005456 | Miscanthus Rhizosphere | TTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAAQSVSRAPG* |
Ga0068867_1022692111 | 3300005459 | Miscanthus Rhizosphere | QTTTEYAILLGFLAIAIIIALFFLRNVLRQLFSDAANSVQSAPTG* |
Ga0070685_100765764 | 3300005466 | Switchgrass Rhizosphere | EYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPN* |
Ga0070684_1001578093 | 3300005535 | Corn Rhizosphere | TEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNG* |
Ga0070684_1005203931 | 3300005535 | Corn Rhizosphere | QTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNG* |
Ga0070684_1015462361 | 3300005535 | Corn Rhizosphere | TTTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPN* |
Ga0070672_1014595382 | 3300005543 | Miscanthus Rhizosphere | QTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSDAAHSVSSAPSS* |
Ga0070672_1016331192 | 3300005543 | Miscanthus Rhizosphere | HQLREREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSTAAQSVSRAPN* |
Ga0070672_1018333733 | 3300005543 | Miscanthus Rhizosphere | EDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAAQSVSNAPG* |
Ga0068857_1004867042 | 3300005577 | Corn Rhizosphere | LGFLAIAIIIALFFLRGVLRSLFSSAASSVSRAPNG* |
Ga0068857_1006510773 | 3300005577 | Corn Rhizosphere | EYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNG* |
Ga0068857_1023666991 | 3300005577 | Corn Rhizosphere | EYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNN* |
Ga0068854_1013655752 | 3300005578 | Corn Rhizosphere | TTEYAILLGFLAIAIIIALFFLRNVLRSLFSDAAHSVSSAPSS* |
Ga0070702_1002878373 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | TTEYAILLGFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNG* |
Ga0070702_1013462261 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | EDGQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSRAPNG* |
Ga0066903_1064047452 | 3300005764 | Tropical Forest Soil | ILLGFLAVAIIVALFFLRHQIKGLFSKAASSISQAPAGS* |
Ga0068870_100721184 | 3300005840 | Miscanthus Rhizosphere | ILLGFLAIAIIIALFFLRNVLRSLFSTAAQSVSRAPN* |
Ga0068870_104419963 | 3300005840 | Miscanthus Rhizosphere | ILLGFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNG* |
Ga0068870_105242691 | 3300005840 | Miscanthus Rhizosphere | GFLAIAIIIALFFLRGVLRSLFSAAASSVSGAPNG* |
Ga0068863_1006951102 | 3300005841 | Switchgrass Rhizosphere | TEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSRAPNG* |
Ga0075417_107052451 | 3300006049 | Populus Rhizosphere | GQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNN* |
Ga0074050_120526093 | 3300006577 | Soil | QTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSTAASSVSGAPG* |
Ga0075428_1026956741 | 3300006844 | Populus Rhizosphere | TTEYAILLGFLAIAIIIALFFLRNVLRDLFSDAASSVSNAPNS* |
Ga0075421_1011507711 | 3300006845 | Populus Rhizosphere | REDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNS* |
Ga0075421_1025201421 | 3300006845 | Populus Rhizosphere | EYAILLGFLAIAIIIALFFLRNVLRDLFSDAASSVSNAPS* |
Ga0075431_1010320481 | 3300006847 | Populus Rhizosphere | REDGQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNN* |
Ga0075433_102086281 | 3300006852 | Populus Rhizosphere | EDGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSNAPG* |
Ga0075433_118181142 | 3300006852 | Populus Rhizosphere | EREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSNAPG* |
Ga0075425_1017674181 | 3300006854 | Populus Rhizosphere | EDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSNAASSVSGAPDS* |
Ga0075425_1019921282 | 3300006854 | Populus Rhizosphere | DGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSNAPG* |
Ga0075434_1001025244 | 3300006871 | Populus Rhizosphere | REREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSNAASSVSGAPDS* |
Ga0075429_1019362791 | 3300006880 | Populus Rhizosphere | TTTEYAILLGFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNS* |
Ga0068865_1005448413 | 3300006881 | Miscanthus Rhizosphere | LGFLAIAIIIALFFLRNVLRSLFSTAAQSVSRAPN* |
Ga0079215_111072391 | 3300006894 | Agricultural Soil | TTTEYAILLGFLAIAIIIALFFLRNVLRELFSDAARSVSNAPGN* |
Ga0075424_1000151901 | 3300006904 | Populus Rhizosphere | LLGFLAIAIIIALFFLRNVLRGLFSNAASSVSNAPDG* |
Ga0075424_1001615794 | 3300006904 | Populus Rhizosphere | DGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSNAASSVSGAPDS* |
Ga0075424_1027360101 | 3300006904 | Populus Rhizosphere | GFLAIAIIIALFFLRNVLRGLFSSAASSVSNAPG* |
Ga0079216_114468972 | 3300006918 | Agricultural Soil | EDGQTTTEYAILLGFLAIAIIIALFFLRNVLRQLFSSAPPGLPHPS* |
Ga0111539_100626121 | 3300009094 | Populus Rhizosphere | TTTEYAILLGFLAIAIIIALFFLRNVLRDLFSDAASSVSNAPG* |
Ga0111539_106456041 | 3300009094 | Populus Rhizosphere | VHRLREREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSDAASSVSGSTG* |
Ga0111539_127903831 | 3300009094 | Populus Rhizosphere | QTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSRGAS* |
Ga0105245_104862441 | 3300009098 | Miscanthus Rhizosphere | QLREREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSTAAQSVSRAPN* |
Ga0105245_129908422 | 3300009098 | Miscanthus Rhizosphere | EYAILLGFLAIAIIIALFFLRNVLRGLFSTAASSVSNAPG* |
Ga0114129_109533701 | 3300009147 | Populus Rhizosphere | QTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSRAPG* |
Ga0114129_111155391 | 3300009147 | Populus Rhizosphere | REDGQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNG* |
Ga0105243_121669371 | 3300009148 | Miscanthus Rhizosphere | EDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAAQSVSRAPG* |
Ga0105243_130919771 | 3300009148 | Miscanthus Rhizosphere | ILLGFLAIAIIVALFFLRDVLRGLFSNAASSVSRSTD* |
Ga0105094_109792282 | 3300009153 | Freshwater Sediment | GQTTTEYAILLGFLAIAIIIALFFLRNVLRQLFSDAASSVSNAPGP* |
Ga0111538_107037361 | 3300009156 | Populus Rhizosphere | EDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNS* |
Ga0111538_117934282 | 3300009156 | Populus Rhizosphere | LGFLAIAIIIALFFLRGVLRSLFSSAASSVSRAPG* |
Ga0105242_108505291 | 3300009176 | Miscanthus Rhizosphere | QTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSRAPNG* |
Ga0105242_108786341 | 3300009176 | Miscanthus Rhizosphere | GFLAIAIIIALFFLRNVLRDLFSKAASSVNNSPGP* |
Ga0105242_114192532 | 3300009176 | Miscanthus Rhizosphere | QTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAAQSVSRAPG* |
Ga0105242_128542891 | 3300009176 | Miscanthus Rhizosphere | REDGQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSAGPGN* |
Ga0105249_117538492 | 3300009553 | Switchgrass Rhizosphere | AILLGFLAIAIIVALFFLRNVLRQLFSDAASSVSNAPGP* |
Ga0105064_11499262 | 3300009821 | Groundwater Sand | GFLAIAIIVALFFLRNILRDLFSDAASSVSGAPTS* |
Ga0126377_107717123 | 3300010362 | Tropical Forest Soil | GQTTTEYAILLGFLAIAIIIALFFLRNVIRDLFSHAASSVSNSPDG* |
Ga0126379_124300852 | 3300010366 | Tropical Forest Soil | LGFLAIAIIIALFFLRGVLRSLFSSAASSVSAAPGG* |
Ga0134128_128405121 | 3300010373 | Terrestrial Soil | LGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNG* |
Ga0134124_106096823 | 3300010397 | Terrestrial Soil | FLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNG* |
Ga0134122_134111741 | 3300010400 | Terrestrial Soil | AILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSSAPGD* |
Ga0134123_101581511 | 3300010403 | Terrestrial Soil | DGQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSRAPNG* |
Ga0134123_118245751 | 3300010403 | Terrestrial Soil | FLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNG* |
Ga0134123_120935522 | 3300010403 | Terrestrial Soil | GQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSDAAHSVSSAPSS* |
Ga0134123_123611772 | 3300010403 | Terrestrial Soil | LLGFLAIAIIIALFFLRNVLRDLFSDAASSVSNAPG* |
Ga0151490_14076812 | 3300011107 | Soil | ILLGFLAIAIIIALFFLRNLLRSLFSKAASSVSGAPG* |
Ga0105246_103184491 | 3300011119 | Miscanthus Rhizosphere | DGQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSHAPNS* |
Ga0105246_104235191 | 3300011119 | Miscanthus Rhizosphere | TTTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNG* |
Ga0137433_10641171 | 3300011440 | Soil | LREREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRELFSDAAESVSLSDSP* |
Ga0120191_101060042 | 3300012022 | Terrestrial | YAILLGFLAIAIIIALFFLRNVLRSLFSSAASSVSRAPNTSRPPSTGHS* |
Ga0157294_101345871 | 3300012892 | Soil | YAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPN* |
Ga0157292_101348061 | 3300012900 | Soil | TTEYAILLGFLAIAIIIALFFLRNVLRGLFSDAASSVSNAPG* |
Ga0157282_101418061 | 3300012904 | Soil | DGQTTTEYAILLGFLAIAIIIALFFLRTVLRNLFSDAAQSVSNAPGGP* |
Ga0157296_102804081 | 3300012905 | Soil | GFLAIAIIIALYFLRNVLRDLFSDAASSVSNAPG* |
Ga0157283_101556692 | 3300012907 | Soil | EREDGQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNG* |
Ga0157283_101696092 | 3300012907 | Soil | GQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPN* |
Ga0157301_103771851 | 3300012911 | Soil | DGQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPN* |
Ga0157306_102310142 | 3300012912 | Soil | REDGQTTTEYAILLGFLAIAIIIALFFLRNVLRELFSDAASSVSAGPGSP* |
Ga0157302_100480181 | 3300012915 | Soil | ILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSIAPGS* |
Ga0157310_100638703 | 3300012916 | Soil | AILLGFLAIAIIIALFFLRNVLRGLFSDAASSVSNAPS* |
Ga0126375_109779912 | 3300012948 | Tropical Forest Soil | ILLGFLAIAIIVALFFLRNILRSLFSSAASSVSGAPGD* |
Ga0164300_102464891 | 3300012951 | Soil | TTTEYAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSNAPG* |
Ga0164299_102170311 | 3300012958 | Soil | YAILLGFLAIAIIIALFFLRNVLRGLFSNAASSVSNAPG* |
Ga0164299_112884151 | 3300012958 | Soil | ILLGFLAIAIIIALFFLRNVLRGLFSNAASSVSNAPG* |
Ga0164299_113100972 | 3300012958 | Soil | FLAIAIIIALFFLRNVLRGLFSNAASSVSGAPGS* |
Ga0164304_115693441 | 3300012986 | Soil | LLGFLAIAIIIALFFLRNVLRGLFSNAASSVSNAPG* |
Ga0157307_10294921 | 3300013096 | Soil | LGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPGG* |
Ga0163162_129988891 | 3300013306 | Switchgrass Rhizosphere | FLAIAIIIALFFLRGVLRSLFSSAASSVSRAPNG* |
Ga0157372_132208742 | 3300013307 | Corn Rhizosphere | QTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSNAASSVSNAPAN* |
Ga0157375_115350701 | 3300013308 | Miscanthus Rhizosphere | ILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSRAPNG* |
Ga0157375_123456152 | 3300013308 | Miscanthus Rhizosphere | EDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSTAAQSVSRAPN* |
Ga0157375_128399212 | 3300013308 | Miscanthus Rhizosphere | LLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPN* |
Ga0075327_13157131 | 3300014272 | Natural And Restored Wetlands | MIWPVAALAILVLGFLAIAIIIALFFLRNVLRSLFSDAASSVSNAPN* |
Ga0075344_11532171 | 3300014296 | Natural And Restored Wetlands | ILLGFLAIAIIIALYFLRGVLRSLFSEAASSVSNAPN* |
Ga0075323_10774652 | 3300014301 | Natural And Restored Wetlands | DGQTTTEYAILLGFLAIAIIVALFFLRNILRDLFSDAASSVSNAPG* |
Ga0075343_11503641 | 3300014317 | Natural And Restored Wetlands | LVVIAILVALFFLRSTSRYVPSDAAYSVSNAPGS* |
Ga0163163_108712792 | 3300014325 | Switchgrass Rhizosphere | VHQLREREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSTAAQSVSRAPN* |
Ga0163163_119685801 | 3300014325 | Switchgrass Rhizosphere | ILLGFLAIAIIIALFFLRNVLRSLFSDAAHSVSSAPSS* |
Ga0157380_125835882 | 3300014326 | Switchgrass Rhizosphere | DGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSTAASSVSNAPG* |
Ga0157380_134548282 | 3300014326 | Switchgrass Rhizosphere | LGFLAIAIIIALFFLRNVLRDLFSDAASSVSNAPG* |
Ga0157377_100023179 | 3300014745 | Miscanthus Rhizosphere | YAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSRAPNG* |
Ga0157376_118526532 | 3300014969 | Miscanthus Rhizosphere | EDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNG* |
Ga0173480_103361901 | 3300015200 | Soil | GFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPN* |
Ga0132258_100792701 | 3300015371 | Arabidopsis Rhizosphere | EREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSGAPGP* |
Ga0132258_102741384 | 3300015371 | Arabidopsis Rhizosphere | YAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSKAPGS* |
Ga0132258_104901948 | 3300015371 | Arabidopsis Rhizosphere | QTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSGAPA* |
Ga0132258_110066521 | 3300015371 | Arabidopsis Rhizosphere | TTTEYAILLGFLAIAIIIALFFLRNVLRQLFSDAANSVQSAPSG* |
Ga0132258_113670881 | 3300015371 | Arabidopsis Rhizosphere | TEYAILLGFLAIAIIIALFFLRNVLRGLFSNAASSVSNAPGG* |
Ga0132258_126585234 | 3300015371 | Arabidopsis Rhizosphere | LGFLAIAIIIALFFLRNVLRGLFSNAASSVSGAPDS* |
Ga0132258_136575381 | 3300015371 | Arabidopsis Rhizosphere | EYAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSSAPGG* |
Ga0132258_136849511 | 3300015371 | Arabidopsis Rhizosphere | AILLGFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNG* |
Ga0132258_136883701 | 3300015371 | Arabidopsis Rhizosphere | TTTEYAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSNAPGD* |
Ga0132258_136925053 | 3300015371 | Arabidopsis Rhizosphere | TTTEYAILLGFLAIAIIIALFFLRNVLRQLFSDAANSVQSAPGP* |
Ga0132256_1000335931 | 3300015372 | Arabidopsis Rhizosphere | TTTEYAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSGAPGP* |
Ga0132256_1001168511 | 3300015372 | Arabidopsis Rhizosphere | AILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSKAPGS* |
Ga0132256_1014913051 | 3300015372 | Arabidopsis Rhizosphere | REDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAARSVSNAPT* |
Ga0132256_1030482681 | 3300015372 | Arabidopsis Rhizosphere | REDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAAQSVSNAPS* |
Ga0132256_1036236481 | 3300015372 | Arabidopsis Rhizosphere | QTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSGAGGP* |
Ga0132256_1036447462 | 3300015372 | Arabidopsis Rhizosphere | GQTTTEYAILLGFLAIAIIIALFFLRNVLRQLFSDAANSVQSAPTG* |
Ga0132256_1039315152 | 3300015372 | Arabidopsis Rhizosphere | QTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAASSVSGAPGG* |
Ga0132257_1004670931 | 3300015373 | Arabidopsis Rhizosphere | GQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSNAASSVSNAPGG* |
Ga0132257_1005602883 | 3300015373 | Arabidopsis Rhizosphere | GFLAIAIIIALFFLRGVLRSLFSSAASSVSKAPGS* |
Ga0132257_1009539831 | 3300015373 | Arabidopsis Rhizosphere | LLGFLAIAIIIALFFLRNVLRGLFSSAASSVSGAPGP* |
Ga0132257_1010929921 | 3300015373 | Arabidopsis Rhizosphere | TEYAILLGFLAIAIIVALFFLRGVLRSLFSNAASSVSKAPG* |
Ga0132257_1029385161 | 3300015373 | Arabidopsis Rhizosphere | QTTTEYAILLGFLAIAIIIALFFLRNVLRQLFSDAANSVQSAPSG* |
Ga0132257_1036999221 | 3300015373 | Arabidopsis Rhizosphere | GQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSNAASSVSGAPGS* |
Ga0132255_1015923503 | 3300015374 | Arabidopsis Rhizosphere | REREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAASSVSGAPSG* |
Ga0132255_1022721141 | 3300015374 | Arabidopsis Rhizosphere | TTEYAILLGFLAIAIIIALFFLRNVLRGLFSNAASSVSGAPGS* |
Ga0132255_1024308711 | 3300015374 | Arabidopsis Rhizosphere | AILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNG* |
Ga0132255_1039118451 | 3300015374 | Arabidopsis Rhizosphere | EYAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSNAPGG* |
Ga0132255_1041291561 | 3300015374 | Arabidopsis Rhizosphere | EYAILLGFLAIAIIIALFFLRNVLRQLFSDAANSVQSAPGP* |
Ga0132255_1044114291 | 3300015374 | Arabidopsis Rhizosphere | EYAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSNAPGD* |
Ga0132255_1063454491 | 3300015374 | Arabidopsis Rhizosphere | EREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSDSPN* |
Ga0182033_110027361 | 3300016319 | Soil | GQTTTEYAILVGFLAVAIIIALFFLRNQIKGLFSKAGSSVQNAGS |
Ga0163161_116036611 | 3300017792 | Switchgrass Rhizosphere | EDGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSDAAQSVSNAPG |
Ga0190266_109280712 | 3300017965 | Soil | GQTTTEYAILLGFLAIAIIIALFFLRTVLRNLFSDAAASVSGAGGP |
Ga0190266_110090631 | 3300017965 | Soil | ILLGFLAIAIIIALFFLRNVLRDLFSDAASSVSGAPSG |
Ga0184608_103266982 | 3300018028 | Groundwater Sediment | ILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPSG |
Ga0184616_100963821 | 3300018055 | Groundwater Sediment | LLGFLAIAIIIALFFLRNVLRSLFSSAASSVSRAPGG |
Ga0184611_10892463 | 3300018067 | Groundwater Sediment | TTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSRAPNSG |
Ga0184635_102776022 | 3300018072 | Groundwater Sediment | LGFLAIAIIVALFFLRNILRDLFSDAASSVSGAPTS |
Ga0184624_100426404 | 3300018073 | Groundwater Sediment | REREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSNAASSVSRSTG |
Ga0184624_105208521 | 3300018073 | Groundwater Sediment | IAVVELRQRQEGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSKAASSVSGAPG |
Ga0184624_105388481 | 3300018073 | Groundwater Sediment | ILLGFLAIAIIIALFFLRNVLRSLFSNAASSVSGAPG |
Ga0184625_103058102 | 3300018081 | Groundwater Sediment | TEYAILLGFLAIAIIIALFFLRNVLRDLFSDAASSVSGAPSG |
Ga0190270_100453661 | 3300018469 | Soil | YAILLGFLAIAIIVALFFLRNVLRELFSDAAQSVSGAPVN |
Ga0190270_107095121 | 3300018469 | Soil | ILLGFLAIAIIVALFFLRNVLRQLFSDAAGSVSNAPG |
Ga0190270_108280022 | 3300018469 | Soil | EREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRQLFSSAASSVSNAPG |
Ga0190270_109658311 | 3300018469 | Soil | EDGQTTTEYAILLGFLAIAIIVALFFLRNVLRNLFSDAASSVSRAPA |
Ga0190270_119811241 | 3300018469 | Soil | EREDGQTTTEYAILLGFLAIAIIIALFFLRGVLRELFSDAAESVSGANNP |
Ga0190271_100578451 | 3300018481 | Soil | ILLGFLAIAIIVALFFLRNVLRELFSDAAQSVSGAPGP |
Ga0190271_103012483 | 3300018481 | Soil | TTTEYAILLGFLAIAIIVALFFLRNVLRELFSDAAQSVSGAPGG |
Ga0190271_105324843 | 3300018481 | Soil | TTTEYAILLGFLAIAIIVALFFLRNVLRELFSDAAQSVSGAPVN |
Ga0190271_108814752 | 3300018481 | Soil | TTTEYAILLGFLAIAIIVALFFLRNVLRELFSDAAQSVSGAPGP |
Ga0190271_114427342 | 3300018481 | Soil | TTTEYAILLGFLAIAIIIALFFLRNVLRDLFSDAASSVSGAPGQ |
Ga0190271_120254672 | 3300018481 | Soil | LGFLAIAIIIALYFLRAVLRDLFSDAASSVSNAPG |
Ga0190271_130048911 | 3300018481 | Soil | TEYAILLGFLAIAIIVALFFLRNVLRELFSDAAASVSGAPG |
Ga0190271_131681552 | 3300018481 | Soil | EDGQTTTEYAILLGFLAIAIIIALFFLRGVLRELFSDAAQSVSNAGN |
Ga0173481_104418512 | 3300019356 | Soil | EDGQTTTEYAILLGFLAIAIIIALFFLRNVLRDLFSDAASSVSNAPG |
Ga0173482_106218502 | 3300019361 | Soil | ILLGFLAIAIIIALFFLRNVLRQLFSDAANSVQSAPTG |
Ga0173479_106262121 | 3300019362 | Soil | QTTTEYAILLGFLAIAIIIALFFLRNVLRDLFSDAASSVSNAPG |
Ga0190264_111903322 | 3300019377 | Soil | YAILLGFLAIAIIIALFFLRNVLRDLFSDAASSVSNAPGP |
Ga0193697_10943811 | 3300020005 | Soil | GQTTTEYAILLGFLAIAIIIALYFLRNVLRDLFSDAASSVSNSPGG |
Ga0193738_11806502 | 3300020020 | Soil | IHDLREREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSGAPG |
Ga0210380_105132072 | 3300021082 | Groundwater Sediment | GFLAIAIIIALFFLRNVLRSLFSSAASSVSRAPGG |
Ga0222622_108527261 | 3300022756 | Groundwater Sediment | GQTTTEYAILLGFLAIAIIIALFFLRNVLRQLFSDAAKSVQSAPGGP |
Ga0222622_111569811 | 3300022756 | Groundwater Sediment | QTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAASSVSRAPAN |
Ga0247786_10515091 | 3300022883 | Soil | AILLGFLAIAIIIALFFLRNVLRDLFSDAASSVSNAPG |
Ga0247793_10698301 | 3300023066 | Soil | TTTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNN |
Ga0247789_11359112 | 3300023266 | Soil | ILLGFLAIAIIIALFFLRNVLRDLFSDAASSVSNAPG |
Ga0209108_101183361 | 3300025165 | Soil | LGFLAIAIIIALFFLRNVLRDLFSEAASSVNNAPS |
Ga0209108_105334171 | 3300025165 | Soil | QTTTEYAILLGFLAIAIIIALYFLRNVLRELFSDAASSVSGAPG |
Ga0209341_101208143 | 3300025325 | Soil | EYAILLGFLAIAIIIALYFLRNVLRELFSDAASSVSGAPG |
Ga0209341_107570092 | 3300025325 | Soil | TTTEYAILLGFLAIAIIIALFFLRNVLRDLFSDAASSVSNAPGP |
Ga0209341_111508261 | 3300025325 | Soil | AILLGFLAIAIIVALYFLRDVLRQLFSDAASSVSNAPS |
Ga0210094_10462872 | 3300025549 | Natural And Restored Wetlands | DGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSDAASSVSNAPGP |
Ga0207688_108297312 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | ILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPN |
Ga0207680_103587611 | 3300025903 | Switchgrass Rhizosphere | EREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNG |
Ga0207645_109576692 | 3300025907 | Miscanthus Rhizosphere | GQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNG |
Ga0207643_107654781 | 3300025908 | Miscanthus Rhizosphere | LGFLAIAIIIALFFLRNVLRDLFSDAASSVSNAPG |
Ga0207643_109762671 | 3300025908 | Miscanthus Rhizosphere | AILLGFLAIAIIIALFFLRNVLRQLFSDAANSVSGAGN |
Ga0207662_101844534 | 3300025918 | Switchgrass Rhizosphere | EDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNG |
Ga0207681_113391431 | 3300025923 | Switchgrass Rhizosphere | REDGQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSRGPNQ |
Ga0207650_103975141 | 3300025925 | Switchgrass Rhizosphere | TTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPN |
Ga0207650_107206093 | 3300025925 | Switchgrass Rhizosphere | YAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSGAPNG |
Ga0207659_102299311 | 3300025926 | Miscanthus Rhizosphere | LGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPN |
Ga0207659_105906041 | 3300025926 | Miscanthus Rhizosphere | TTTEYAILLGFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNG |
Ga0207659_108094871 | 3300025926 | Miscanthus Rhizosphere | EDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSTAAQSVSRAPN |
Ga0207659_115405581 | 3300025926 | Miscanthus Rhizosphere | REREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAAQSVSNAPG |
Ga0207686_111672041 | 3300025934 | Miscanthus Rhizosphere | EDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSDAAHSVSSAPSS |
Ga0207686_112004912 | 3300025934 | Miscanthus Rhizosphere | ILLGFLAIAIIIALFFLRNVLRSLFSSAAQSVSRAPG |
Ga0207686_115411781 | 3300025934 | Miscanthus Rhizosphere | GFLAIAIIIALFFLRNVLRDLFSKAASSVNNSPGP |
Ga0207686_116472872 | 3300025934 | Miscanthus Rhizosphere | EYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSTAPGS |
Ga0207686_117456082 | 3300025934 | Miscanthus Rhizosphere | REDGQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSAGPGN |
Ga0207669_101244261 | 3300025937 | Miscanthus Rhizosphere | GQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSTAAQSVSRAPN |
Ga0207669_105259701 | 3300025937 | Miscanthus Rhizosphere | EDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAAQSVSNAPG |
Ga0207704_112570771 | 3300025938 | Miscanthus Rhizosphere | TTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNG |
Ga0207691_106123291 | 3300025940 | Miscanthus Rhizosphere | DGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSTAAQSVSRAPN |
Ga0207691_106350761 | 3300025940 | Miscanthus Rhizosphere | EREDGQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNG |
Ga0207691_115384602 | 3300025940 | Miscanthus Rhizosphere | DGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAAQSVSNAPG |
Ga0207689_102478821 | 3300025942 | Miscanthus Rhizosphere | LLGFLAIAIIIALFFLRGVLRSLFSSAASSVSRAPNG |
Ga0207661_105644333 | 3300025944 | Corn Rhizosphere | ILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNG |
Ga0207661_109712712 | 3300025944 | Corn Rhizosphere | YAILLGFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNG |
Ga0207668_102896143 | 3300025972 | Switchgrass Rhizosphere | TEYAILLGFLAIAIIIALFFPRGVLRSLFSSAASSVSKAPGT |
Ga0207648_107837731 | 3300026089 | Miscanthus Rhizosphere | DGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSDAAHSVSSAPSS |
Ga0207676_101953201 | 3300026095 | Switchgrass Rhizosphere | LGFLAISIIIALFFLRGVLRSLFSAAASSVSRAPNG |
Ga0207674_105028442 | 3300026116 | Corn Rhizosphere | LGFLAIAIIIALFFLRGVLRSLFSSAASSVSRAPNG |
Ga0207683_100312917 | 3300026121 | Miscanthus Rhizosphere | TTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAAQSVSRAPN |
Ga0207683_113801722 | 3300026121 | Miscanthus Rhizosphere | EREDGQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPN |
Ga0209878_10428122 | 3300027163 | Groundwater Sand | QTTTEYAILLGFLAIAIIVALFFLRNILRDLFSDAASSVSGAPTS |
Ga0209861_10370931 | 3300027332 | Groundwater Sand | YAILLGFLAIAIIVALFFLRNILRDLFSDAASSVSGAPTS |
Ga0208890_10241542 | 3300027523 | Soil | AILLGFLAIAIIIALFFLRNVLRSLFSTAASSVSGAPG |
Ga0209887_11071921 | 3300027561 | Groundwater Sand | LLGFLAIAIIVALFFLRNILRDLFSDAASSVSGAPTS |
Ga0207428_102696093 | 3300027907 | Populus Rhizosphere | TTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSRAPG |
Ga0207428_106322831 | 3300027907 | Populus Rhizosphere | VHRLREREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSDAASSVSGSTG |
Ga0268266_111683382 | 3300028379 | Switchgrass Rhizosphere | AILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNG |
Ga0247822_116888882 | 3300028592 | Soil | TEYAILLGFLAIAIIIALFFLRTVLRNLFSDAANSVSNAGG |
Ga0307302_102028111 | 3300028814 | Soil | ILLGFLAIAIIIALFFLRNVLRSLFSTAASSVSNAPGG |
Ga0307296_104825672 | 3300028819 | Soil | REREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSTAASSVSRAPG |
Ga0307277_104871251 | 3300028881 | Soil | AILLGFLAIAIIIALFFLRNVLRGLFSNAASSVSNAPS |
Ga0268386_105272691 | 3300030619 | Soil | LLGFLAIAIIIALFFLRNVLRDLFSDAASSVSGAPDA |
Ga0308152_1127272 | 3300030831 | Soil | AILLGFLAIAIIIALFFLRNVLRSLFSTAASSVSNAPGG |
Ga0308186_10372621 | 3300031422 | Soil | LLGFLAIAIIIALFFLRNVLRSLFSSAASSVSRAPG |
Ga0318515_103936633 | 3300031572 | Soil | YAILVGFLAVAIIIALFFLRNQIKGLFSKAGSSVQNAGS |
Ga0247727_111289352 | 3300031576 | Biofilm | TEYAILLGFLAIAIIIALFFLRNVLRELFSEAASSVSNAPN |
Ga0318560_107177061 | 3300031682 | Soil | REEGQTTTEYAILVGFLAVAIIIALFFLRNQIKGLFSKAGSSIQKAPS |
Ga0306918_110867891 | 3300031744 | Soil | ILVGFLAVAIIIALFFLRNQIKGLFSKAGSSVQNAGS |
Ga0318554_101398713 | 3300031765 | Soil | TTTEYAILVGFLAVAIIIALFFLRNQIKGLFSKAGSSVQNAGS |
Ga0318511_102156361 | 3300031845 | Soil | REEGQTTTEYAILVGFLAVAIIIALFFLRNQIKGLFSKAGSSVQNAGS |
Ga0315297_110821151 | 3300031873 | Sediment | TTTEYAILLGFLAIAIIIALFFLRNVLRALFSSAASSVSGAPG |
Ga0310885_104337243 | 3300031943 | Soil | LGFLAIAIIVALFFLRNVLRGLFSDAASSVSNAPN |
Ga0315278_108724112 | 3300031997 | Sediment | TTTEYAILLGFLAIAIIIALFFLRNVLRALFSSAASSVSGAPNG |
Ga0315274_115727532 | 3300031999 | Sediment | LGFLAIAIIIALFFLRNVLRGLFSEAASSVSGAPG |
Ga0310906_102713921 | 3300032013 | Soil | EYAILLGFLAIAIIIALFFLRNVLRGLFSTAASSVSNAPG |
Ga0318514_103029741 | 3300032066 | Soil | AILVGFLAVAIIIALFFLRNQIKGLFSKAGSSVQNAPGS |
Ga0315276_114690902 | 3300032177 | Sediment | REREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRALFSSAASSVSGAPNG |
Ga0315286_118429431 | 3300032342 | Sediment | LREREDGQTTTEYAILLGFLAIAIIVALFFLRNVLRALFSSAASSVSGAPG |
Ga0315287_100648421 | 3300032397 | Sediment | REREDGQTTTEYAILLGFLAIAIIVALFFLRDVLRALFSSAASSVSGAPG |
Ga0315273_113707591 | 3300032516 | Sediment | TTEYAILLGFLAIAIIVAILLLKGALIDLFTAASNSVNNAPGNPAP |
Ga0315273_116056401 | 3300032516 | Sediment | REDGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSEAASSVSGAPG |
Ga0214472_108171502 | 3300033407 | Soil | GQTTTEYAILLGFLAIAIIIALYFLRDVLRGLFSDAAESVQSAPGGP |
Ga0247830_111396372 | 3300033551 | Soil | VHDLRKREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSRAPGS |
Ga0364931_0112287_746_865 | 3300034176 | Sediment | YAILLGFLAIAIIIALYFLRDVLRQLFSDAASSVSNAPN |
Ga0314783_140248_3_152 | 3300034662 | Soil | REDGQTTTEYAILLGFLAIAIIIALFFQRGVLRSLFSSAASSVSRAPGS |
⦗Top⦘ |