| Basic Information | |
|---|---|
| Family ID | F012638 |
| Family Type | Metagenome |
| Number of Sequences | 279 |
| Average Sequence Length | 43 residues |
| Representative Sequence | TEPGVYRWREIKEGQLAQIELDALQPKPMTLHRLLLHRTS |
| Number of Associated Samples | 205 |
| Number of Associated Scaffolds | 279 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.44 % |
| % of genes near scaffold ends (potentially truncated) | 96.42 % |
| % of genes from short scaffolds (< 2000 bps) | 85.30 % |
| Associated GOLD sequencing projects | 186 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.982 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (26.523 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.240 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.462 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 36.76% Coil/Unstructured: 63.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 279 Family Scaffolds |
|---|---|---|
| PF01288 | HPPK | 63.08 |
| PF03023 | MurJ | 3.94 |
| PF05496 | RuvB_N | 2.87 |
| PF07519 | Tannase | 2.51 |
| PF13365 | Trypsin_2 | 2.15 |
| PF03795 | YCII | 1.43 |
| PF05491 | RuvB_C | 1.43 |
| PF00872 | Transposase_mut | 1.08 |
| PF03928 | HbpS-like | 1.08 |
| PF00383 | dCMP_cyt_deam_1 | 0.72 |
| PF00753 | Lactamase_B | 0.72 |
| PF01872 | RibD_C | 0.72 |
| PF14534 | DUF4440 | 0.72 |
| PF14520 | HHH_5 | 0.72 |
| PF08443 | RimK | 0.36 |
| PF05973 | Gp49 | 0.36 |
| PF03979 | Sigma70_r1_1 | 0.36 |
| PF00484 | Pro_CA | 0.36 |
| PF07687 | M20_dimer | 0.36 |
| PF07676 | PD40 | 0.36 |
| PF13701 | DDE_Tnp_1_4 | 0.36 |
| PF04226 | Transgly_assoc | 0.36 |
| PF15919 | HicB_lk_antitox | 0.36 |
| PF08281 | Sigma70_r4_2 | 0.36 |
| PF14437 | MafB19-deam | 0.36 |
| PF13637 | Ank_4 | 0.36 |
| PF13561 | adh_short_C2 | 0.36 |
| PF02627 | CMD | 0.36 |
| COG ID | Name | Functional Category | % Frequency in 279 Family Scaffolds |
|---|---|---|---|
| COG0801 | 7,8-dihydro-6-hydroxymethylpterin pyrophosphokinase (folate biosynthesis) | Coenzyme transport and metabolism [H] | 63.08 |
| COG2255 | Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvB | Replication, recombination and repair [L] | 4.30 |
| COG0534 | Na+-driven multidrug efflux pump, DinF/NorM/MATE family | Defense mechanisms [V] | 3.94 |
| COG0728 | Lipid II flippase MurJ/MviN (peptidoglycan biosynthesis) | Cell wall/membrane/envelope biogenesis [M] | 3.94 |
| COG2244 | Membrane protein involved in the export of O-antigen and teichoic acid | Cell wall/membrane/envelope biogenesis [M] | 3.94 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.43 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 1.08 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.72 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.72 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.36 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.36 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.36 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.36 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.36 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.36 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.36 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.98 % |
| Unclassified | root | N/A | 5.02 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10005820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 8621 | Open in IMG/M |
| 3300000729|JGI12371J11900_1012811 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300001593|JGI12635J15846_10476675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella tundricola | 740 | Open in IMG/M |
| 3300001593|JGI12635J15846_10847237 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100954035 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300002906|JGI25614J43888_10128082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300002914|JGI25617J43924_10141061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
| 3300003367|JGI26338J50219_1008335 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300003368|JGI26340J50214_10129597 | Not Available | 636 | Open in IMG/M |
| 3300004091|Ga0062387_100314453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1016 | Open in IMG/M |
| 3300004153|Ga0063455_101116869 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300005177|Ga0066690_10461542 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300005332|Ga0066388_101657483 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300005332|Ga0066388_108386978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300005434|Ga0070709_10551882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
| 3300005440|Ga0070705_100302928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1146 | Open in IMG/M |
| 3300005537|Ga0070730_10687770 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300005541|Ga0070733_10217534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1252 | Open in IMG/M |
| 3300005546|Ga0070696_101601946 | Not Available | 559 | Open in IMG/M |
| 3300005555|Ga0066692_10594123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300005558|Ga0066698_10024237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3602 | Open in IMG/M |
| 3300005559|Ga0066700_10818466 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300005561|Ga0066699_10118525 | All Organisms → cellular organisms → Bacteria | 1770 | Open in IMG/M |
| 3300005586|Ga0066691_10160177 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300005591|Ga0070761_11102617 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005841|Ga0068863_101930680 | Not Available | 600 | Open in IMG/M |
| 3300005944|Ga0066788_10037803 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300005950|Ga0066787_10041142 | Not Available | 864 | Open in IMG/M |
| 3300006046|Ga0066652_102003782 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300006163|Ga0070715_10052672 | All Organisms → cellular organisms → Bacteria | 1756 | Open in IMG/M |
| 3300006174|Ga0075014_100564648 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300006175|Ga0070712_100163084 | All Organisms → cellular organisms → Bacteria | 1723 | Open in IMG/M |
| 3300006176|Ga0070765_100376211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1323 | Open in IMG/M |
| 3300006642|Ga0075521_10255556 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300006800|Ga0066660_11069179 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300006804|Ga0079221_10073377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1606 | Open in IMG/M |
| 3300006854|Ga0075425_100149382 | All Organisms → cellular organisms → Bacteria | 2676 | Open in IMG/M |
| 3300007255|Ga0099791_10658801 | Not Available | 514 | Open in IMG/M |
| 3300007258|Ga0099793_10099227 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
| 3300007258|Ga0099793_10113958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1259 | Open in IMG/M |
| 3300007265|Ga0099794_10280865 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300007788|Ga0099795_10073193 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300009038|Ga0099829_10237971 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
| 3300009038|Ga0099829_11405685 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300009088|Ga0099830_11112640 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300009088|Ga0099830_11836491 | Not Available | 506 | Open in IMG/M |
| 3300009089|Ga0099828_11489700 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300009090|Ga0099827_10008087 | All Organisms → cellular organisms → Bacteria | 6577 | Open in IMG/M |
| 3300009090|Ga0099827_11108585 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300009101|Ga0105247_10664487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 780 | Open in IMG/M |
| 3300009137|Ga0066709_103799034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300009174|Ga0105241_11289985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300009792|Ga0126374_10492676 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300010047|Ga0126382_10414566 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300010047|Ga0126382_12405795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300010048|Ga0126373_10246627 | All Organisms → cellular organisms → Bacteria | 1755 | Open in IMG/M |
| 3300010048|Ga0126373_10651515 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300010048|Ga0126373_11146292 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300010329|Ga0134111_10196980 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300010337|Ga0134062_10595281 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300010343|Ga0074044_10124460 | All Organisms → cellular organisms → Bacteria | 1730 | Open in IMG/M |
| 3300010343|Ga0074044_10608278 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300010358|Ga0126370_10013769 | All Organisms → cellular organisms → Bacteria | 4442 | Open in IMG/M |
| 3300010359|Ga0126376_11548262 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300010359|Ga0126376_11692563 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300010360|Ga0126372_12128678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300010361|Ga0126378_11979124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300010376|Ga0126381_100121056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3387 | Open in IMG/M |
| 3300010398|Ga0126383_12612987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300010398|Ga0126383_13488733 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300011120|Ga0150983_13376473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300011120|Ga0150983_14160263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2237 | Open in IMG/M |
| 3300011269|Ga0137392_10104663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2235 | Open in IMG/M |
| 3300011269|Ga0137392_10118006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2112 | Open in IMG/M |
| 3300011269|Ga0137392_10216056 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
| 3300011269|Ga0137392_11148314 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300011270|Ga0137391_10185390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1812 | Open in IMG/M |
| 3300011270|Ga0137391_11132178 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300011270|Ga0137391_11325996 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300011271|Ga0137393_10077501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2666 | Open in IMG/M |
| 3300011271|Ga0137393_10424152 | Not Available | 1140 | Open in IMG/M |
| 3300011271|Ga0137393_10548310 | Not Available | 992 | Open in IMG/M |
| 3300011271|Ga0137393_11084568 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300011271|Ga0137393_11246892 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300012096|Ga0137389_10233828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1540 | Open in IMG/M |
| 3300012096|Ga0137389_10296204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1369 | Open in IMG/M |
| 3300012096|Ga0137389_10436903 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300012141|Ga0153958_1090605 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300012189|Ga0137388_10025029 | All Organisms → cellular organisms → Bacteria | 4558 | Open in IMG/M |
| 3300012189|Ga0137388_11504952 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300012199|Ga0137383_11121720 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300012200|Ga0137382_10314702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1094 | Open in IMG/M |
| 3300012200|Ga0137382_10711480 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300012202|Ga0137363_10194300 | All Organisms → cellular organisms → Bacteria | 1624 | Open in IMG/M |
| 3300012202|Ga0137363_11206200 | Not Available | 643 | Open in IMG/M |
| 3300012203|Ga0137399_10228501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1520 | Open in IMG/M |
| 3300012203|Ga0137399_10798234 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300012203|Ga0137399_10939219 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300012203|Ga0137399_11760433 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300012205|Ga0137362_10873874 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300012207|Ga0137381_10373750 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300012209|Ga0137379_10781559 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300012211|Ga0137377_10315792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1497 | Open in IMG/M |
| 3300012361|Ga0137360_10076211 | All Organisms → cellular organisms → Bacteria | 2500 | Open in IMG/M |
| 3300012361|Ga0137360_10158446 | All Organisms → cellular organisms → Bacteria | 1802 | Open in IMG/M |
| 3300012362|Ga0137361_10628076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 984 | Open in IMG/M |
| 3300012363|Ga0137390_11098130 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300012685|Ga0137397_10551562 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300012918|Ga0137396_10180479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1547 | Open in IMG/M |
| 3300012918|Ga0137396_10254865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1294 | Open in IMG/M |
| 3300012918|Ga0137396_10295556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1197 | Open in IMG/M |
| 3300012922|Ga0137394_10396702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1176 | Open in IMG/M |
| 3300012925|Ga0137419_10008622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5356 | Open in IMG/M |
| 3300012929|Ga0137404_10666219 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300012929|Ga0137404_11662438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300012929|Ga0137404_11923289 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300012930|Ga0137407_10924005 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300012930|Ga0137407_12418608 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300012971|Ga0126369_10683551 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300014166|Ga0134079_10496433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300014169|Ga0181531_10034202 | All Organisms → cellular organisms → Bacteria | 2938 | Open in IMG/M |
| 3300014201|Ga0181537_10038312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3280 | Open in IMG/M |
| 3300014201|Ga0181537_10256016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1202 | Open in IMG/M |
| 3300015051|Ga0137414_1183707 | All Organisms → cellular organisms → Bacteria | 2997 | Open in IMG/M |
| 3300015053|Ga0137405_1340989 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1462 | Open in IMG/M |
| 3300015053|Ga0137405_1347896 | All Organisms → cellular organisms → Bacteria | 4854 | Open in IMG/M |
| 3300015054|Ga0137420_1433369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5739 | Open in IMG/M |
| 3300015054|Ga0137420_1433797 | All Organisms → cellular organisms → Bacteria | 1817 | Open in IMG/M |
| 3300015241|Ga0137418_10106111 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2523 | Open in IMG/M |
| 3300015241|Ga0137418_10128937 | All Organisms → cellular organisms → Bacteria | 2249 | Open in IMG/M |
| 3300015245|Ga0137409_10280320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1471 | Open in IMG/M |
| 3300015245|Ga0137409_10350752 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
| 3300015358|Ga0134089_10038224 | All Organisms → cellular organisms → Bacteria | 1715 | Open in IMG/M |
| 3300015359|Ga0134085_10369535 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300015371|Ga0132258_11120475 | All Organisms → cellular organisms → Bacteria | 1989 | Open in IMG/M |
| 3300016319|Ga0182033_10125938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1936 | Open in IMG/M |
| 3300016319|Ga0182033_11044894 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300016357|Ga0182032_10655874 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300016371|Ga0182034_11905293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300016387|Ga0182040_10057491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2455 | Open in IMG/M |
| 3300016387|Ga0182040_10095061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2006 | Open in IMG/M |
| 3300016404|Ga0182037_11135053 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300016404|Ga0182037_11562820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300016445|Ga0182038_10354738 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300017822|Ga0187802_10380287 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300017823|Ga0187818_10030860 | All Organisms → cellular organisms → Bacteria | 2299 | Open in IMG/M |
| 3300017928|Ga0187806_1263195 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300017930|Ga0187825_10188747 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300017942|Ga0187808_10516758 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300017943|Ga0187819_10828193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300017947|Ga0187785_10006644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3843 | Open in IMG/M |
| 3300017959|Ga0187779_10533355 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300017975|Ga0187782_10697595 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300017995|Ga0187816_10270752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
| 3300018085|Ga0187772_10281992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1134 | Open in IMG/M |
| 3300018433|Ga0066667_12186795 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300020140|Ga0179590_1230083 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300020579|Ga0210407_10043840 | All Organisms → cellular organisms → Bacteria | 3331 | Open in IMG/M |
| 3300020579|Ga0210407_10163727 | All Organisms → cellular organisms → Bacteria | 1718 | Open in IMG/M |
| 3300020579|Ga0210407_10871884 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300020581|Ga0210399_10017242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5708 | Open in IMG/M |
| 3300020581|Ga0210399_10030505 | All Organisms → cellular organisms → Bacteria | 4304 | Open in IMG/M |
| 3300020582|Ga0210395_10553041 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300021086|Ga0179596_10259073 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300021168|Ga0210406_10181922 | All Organisms → cellular organisms → Bacteria | 1751 | Open in IMG/M |
| 3300021168|Ga0210406_11251567 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300021170|Ga0210400_11383396 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300021171|Ga0210405_10161839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1772 | Open in IMG/M |
| 3300021171|Ga0210405_10187396 | All Organisms → cellular organisms → Bacteria | 1640 | Open in IMG/M |
| 3300021401|Ga0210393_11391612 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300021402|Ga0210385_10482812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 938 | Open in IMG/M |
| 3300021403|Ga0210397_11063078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300021404|Ga0210389_11357560 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300021404|Ga0210389_11490754 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300021405|Ga0210387_10758421 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300021405|Ga0210387_10959717 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300021406|Ga0210386_10062156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2988 | Open in IMG/M |
| 3300021406|Ga0210386_11286984 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300021407|Ga0210383_10655260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
| 3300021407|Ga0210383_10913807 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300021420|Ga0210394_10604634 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300021420|Ga0210394_11827244 | Not Available | 506 | Open in IMG/M |
| 3300021432|Ga0210384_10047984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3891 | Open in IMG/M |
| 3300021439|Ga0213879_10231626 | Not Available | 555 | Open in IMG/M |
| 3300021478|Ga0210402_11510851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300021559|Ga0210409_10429147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1180 | Open in IMG/M |
| 3300022557|Ga0212123_10544603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
| 3300024246|Ga0247680_1061983 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300024287|Ga0247690_1010717 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300024288|Ga0179589_10609592 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300025474|Ga0208479_1048573 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300025906|Ga0207699_11256910 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300025915|Ga0207693_10171212 | All Organisms → cellular organisms → Bacteria | 1710 | Open in IMG/M |
| 3300026214|Ga0209838_1025583 | Not Available | 831 | Open in IMG/M |
| 3300026317|Ga0209154_1250846 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300026320|Ga0209131_1026054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3463 | Open in IMG/M |
| 3300026320|Ga0209131_1355922 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300026515|Ga0257158_1080592 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300026530|Ga0209807_1316861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300026538|Ga0209056_10460443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
| 3300026551|Ga0209648_10471392 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300026552|Ga0209577_10191536 | All Organisms → cellular organisms → Bacteria | 1577 | Open in IMG/M |
| 3300026552|Ga0209577_10449868 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300026555|Ga0179593_1024597 | All Organisms → cellular organisms → Bacteria | 2556 | Open in IMG/M |
| 3300026839|Ga0207764_122683 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300026866|Ga0207786_113101 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300026890|Ga0207781_1014391 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300026910|Ga0207840_1008134 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300027023|Ga0207736_103198 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300027117|Ga0209732_1053035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300027432|Ga0209421_1023277 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300027667|Ga0209009_1103260 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300027692|Ga0209530_1176553 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300027698|Ga0209446_1024154 | All Organisms → cellular organisms → Bacteria | 1516 | Open in IMG/M |
| 3300027773|Ga0209810_1066229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1779 | Open in IMG/M |
| 3300027812|Ga0209656_10008827 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6399 | Open in IMG/M |
| 3300027846|Ga0209180_10192158 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300027854|Ga0209517_10314552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 909 | Open in IMG/M |
| 3300027882|Ga0209590_10841726 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300027889|Ga0209380_10704849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300027889|Ga0209380_10869499 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300028536|Ga0137415_10068324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3418 | Open in IMG/M |
| 3300028536|Ga0137415_10123952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2429 | Open in IMG/M |
| 3300028906|Ga0308309_10280161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1404 | Open in IMG/M |
| 3300030743|Ga0265461_11247918 | Not Available | 773 | Open in IMG/M |
| 3300031544|Ga0318534_10069378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1994 | Open in IMG/M |
| 3300031564|Ga0318573_10398901 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300031573|Ga0310915_10252991 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300031640|Ga0318555_10509768 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300031715|Ga0307476_10331402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1119 | Open in IMG/M |
| 3300031718|Ga0307474_10867540 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300031719|Ga0306917_11042306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300031719|Ga0306917_11437100 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300031720|Ga0307469_12305031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300031747|Ga0318502_10513876 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300031771|Ga0318546_10661264 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300031779|Ga0318566_10308392 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300031781|Ga0318547_11046180 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300031819|Ga0318568_10225073 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300031820|Ga0307473_10544007 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300031821|Ga0318567_10830254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300031833|Ga0310917_10036528 | All Organisms → cellular organisms → Bacteria | 2942 | Open in IMG/M |
| 3300031879|Ga0306919_11244835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300031879|Ga0306919_11390740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300031880|Ga0318544_10018860 | All Organisms → cellular organisms → Bacteria | 2292 | Open in IMG/M |
| 3300031890|Ga0306925_10110289 | All Organisms → cellular organisms → Bacteria | 2936 | Open in IMG/M |
| 3300031890|Ga0306925_10246154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1927 | Open in IMG/M |
| 3300031910|Ga0306923_10884703 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300031945|Ga0310913_10558886 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300031945|Ga0310913_11020477 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300031947|Ga0310909_10342466 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300031962|Ga0307479_10681109 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300031962|Ga0307479_10815240 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300031962|Ga0307479_11150686 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300032001|Ga0306922_10260930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1862 | Open in IMG/M |
| 3300032001|Ga0306922_11016618 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300032035|Ga0310911_10040912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2372 | Open in IMG/M |
| 3300032039|Ga0318559_10031294 | All Organisms → cellular organisms → Bacteria | 2128 | Open in IMG/M |
| 3300032059|Ga0318533_10399042 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300032059|Ga0318533_11072900 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300032076|Ga0306924_10194270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2330 | Open in IMG/M |
| 3300032094|Ga0318540_10274160 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300032180|Ga0307471_100298888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1696 | Open in IMG/M |
| 3300032180|Ga0307471_101679383 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300032180|Ga0307471_103088843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300032205|Ga0307472_100567907 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300032205|Ga0307472_101343864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300032205|Ga0307472_102415975 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300032205|Ga0307472_102703419 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300032261|Ga0306920_100819032 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
| 3300032261|Ga0306920_102477301 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300032261|Ga0306920_102912744 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300032261|Ga0306920_103658634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300032783|Ga0335079_12165774 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300032805|Ga0335078_12707832 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300032897|Ga0335071_12029059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300032954|Ga0335083_11133166 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300033402|Ga0326728_10648372 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.24% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.38% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.66% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.23% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.87% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.51% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.51% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.43% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.43% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.08% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.08% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.08% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.72% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.72% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.72% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.36% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.36% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.36% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.36% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.36% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.36% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.36% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.36% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.36% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.36% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.36% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300000729 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300003367 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012141 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL042 MetaG | Host-Associated | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
| 3300024287 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK31 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025474 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026839 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 52 (SPAdes) | Environmental | Open in IMG/M |
| 3300026866 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 76 (SPAdes) | Environmental | Open in IMG/M |
| 3300026890 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 51 (SPAdes) | Environmental | Open in IMG/M |
| 3300026910 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 65 (SPAdes) | Environmental | Open in IMG/M |
| 3300027023 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027117 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_1000582010 | 3300000567 | Peatlands Soil | RRLDGHEETESEPGVYRWRETNEGGLSQIELDALQPKLMTLHRLVVRRTS* |
| JGI12371J11900_10128111 | 3300000729 | Tropical Forest Soil | EGREQTESEPGVYRWREISQGGLSQIELDALSPKVMTLHRLTLRRTS* |
| JGI12635J15846_104766751 | 3300001593 | Forest Soil | LNGREQTESEPGVYRWREINEGGLSQIELDALEPKMMTVHRLVLRRTG* |
| JGI12635J15846_108472371 | 3300001593 | Forest Soil | QEIEPGVYRWREISDGRFAQIELDSLGPKPMTLHRLFLHRSI* |
| JGIcombinedJ26739_1009540351 | 3300002245 | Forest Soil | TESEPGVYRWREINEDGLSQIELDALEPKIFTLHRLVLRRTS* |
| JGI25614J43888_101280821 | 3300002906 | Grasslands Soil | IHEETEPGVYRWREINEGRLSQIELDALGPKPAMLHRLLIHRTS* |
| JGI25617J43924_101410611 | 3300002914 | Grasslands Soil | EFLRPVQGQERTESVPGVYRWREITSGRYAEIELEALEPAQLTLHRLMIHRTS* |
| JGI26338J50219_10083352 | 3300003367 | Bog Forest Soil | NGREVVESEPGVYRWREITEGRLSLIELESVQPKAMTLHRLLLHRTS* |
| JGI26340J50214_101295972 | 3300003368 | Bog Forest Soil | EQTESEPGVYRWREIKEDGLSQIELEALEPKVITVHRLMVRRTS* |
| Ga0062387_1003144532 | 3300004091 | Bog Forest Soil | RRLNGRERQETDPNVYVWREITEGRLTQIELDALEPKQFTLHRLLLRRT* |
| Ga0063455_1011168692 | 3300004153 | Soil | VQETEAGVYRWRETTEGKLALIELDALQPRGMTLHRLLLHRTS* |
| Ga0066690_104615423 | 3300005177 | Soil | GRETQETEPGVYRWREIKEGQLAQIELDALQPKPITLHRLLLHRTS* |
| Ga0066388_1016574831 | 3300005332 | Tropical Forest Soil | EPGVYRWSEITEGRLAEIELEALQPKQMKLHRLLLHRTS* |
| Ga0066388_1083869782 | 3300005332 | Tropical Forest Soil | QEETEPGVYRWRQINQGRLSLIELDALDPKVLTLHRLMIHRTS* |
| Ga0070709_105518822 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | NGKQVEESEPNAYRWREITEGRLALIELDALTPKVMTIHRLLVLRTS* |
| Ga0070705_1003029283 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | QEETEPGVYRWRQINQGRLSLIELDALDPKILTLHRLLIHRTT* |
| Ga0070730_106877701 | 3300005537 | Surface Soil | VQETEAGVYRWREITEGKLALIELEALQPKPMTLHRLLLHQTS* |
| Ga0070733_102175343 | 3300005541 | Surface Soil | GVYRWREINEGRLAQIEIDALQPVPLTLHRLLLRRTS* |
| Ga0070696_1016019461 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | SEPGVYRWREVTEGKLSLIELEALQPKPMTVHRLLLHRTS* |
| Ga0066692_105941232 | 3300005555 | Soil | GVYRWREITSGRYAEIELEALEPAQLTLHRLMIHRTS* |
| Ga0066698_100242376 | 3300005558 | Soil | QETEPGVYRWREIKEGPLAQIELDALQPKAMTLHRLLLHRTS* |
| Ga0066700_108184661 | 3300005559 | Soil | GVYRWREIKEGQLAQIELDALQPKPMTLHRLLLRRTS* |
| Ga0066699_101185251 | 3300005561 | Soil | ETEPGVYRWREINEGRLSQIELDAMEPKLVTLHRLLIHRTN* |
| Ga0066691_101601771 | 3300005586 | Soil | EETEPGVYRWREINHGRLSQIELDALEPKAITLHRLLLRRTN* |
| Ga0070761_111026172 | 3300005591 | Soil | VYRWREITEGRLSLIELESVTPRAMTLHRLLLHRTS* |
| Ga0068863_1019306802 | 3300005841 | Switchgrass Rhizosphere | RRLNGRETQESEPGVYRWREVTEGKLSLIELEALQPKPMTVHRLLLHRTS* |
| Ga0066788_100378031 | 3300005944 | Soil | PNVYRWREITQGKLAQIELESLEPKTITLHRLLLHRTT* |
| Ga0066787_100411421 | 3300005950 | Soil | LTGTEKIESEPNVYRWREITQGKLAQIELESLEPKTITLHRLLLHRTT* |
| Ga0066652_1020037821 | 3300006046 | Soil | EPGVYRWSEITEGRLAEIELEALQPKPMKLHRLVLHRTT* |
| Ga0070715_100526721 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | PGVYRWREINEGGLSQIELDALTPKTFTLHRLVLRRTS* |
| Ga0075014_1005646481 | 3300006174 | Watersheds | EVQETEPGVYRWREIKEGRLAQIELDALQPKPMTLHRLLLHRTN* |
| Ga0070712_1001630844 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | YRWRQTSEGKLSLIELDALQPKPLTIHRLLVHRTS* |
| Ga0070765_1003762111 | 3300006176 | Soil | RWREITEGRLALIELDALTPKPVTIHRLFVLRTS* |
| Ga0075521_102555563 | 3300006642 | Arctic Peat Soil | TESEPGVYRWRETKVGSLSQIELDALEPKMMTIHRLMVRRSS* |
| Ga0066660_110691792 | 3300006800 | Soil | RLNGRETTETEPGVYRWSEITEGRLAEIELEALQPKPMKLHRLVLHRTT* |
| Ga0079221_100733774 | 3300006804 | Agricultural Soil | GREIVESEPGVYRWSETTQGHLSMIELESIQPKPMMLHRLLLHRTS* |
| Ga0075425_1001493821 | 3300006854 | Populus Rhizosphere | GRETTESEPGVYRWLEISEGSLSQIELDTLQPKTITLHRLVLRRTS* |
| Ga0099791_106588012 | 3300007255 | Vadose Zone Soil | ETEETEPGVYRWREINEGRLAEIELDALQPKHMTLHRLLLHRTS* |
| Ga0099793_100992272 | 3300007258 | Vadose Zone Soil | GREVQETEAGVYRWREITEGSLALIELDALQPKIMTLHRLLLHRTS* |
| Ga0099793_101139581 | 3300007258 | Vadose Zone Soil | NGRETEETEPGVYRWREINEGRLAQIELDALQPKHMTLHRLLLHRTS* |
| Ga0099794_102808652 | 3300007265 | Vadose Zone Soil | GVYRWREIKEGQLAQIELDALQPKPITLHRLLLRRTS* |
| Ga0099795_100731933 | 3300007788 | Vadose Zone Soil | YRWREITEGPLALIELDALQPKTMTLHRLLLHRTS* |
| Ga0099829_102379711 | 3300009038 | Vadose Zone Soil | NGRETQETEPGVYRWREIKEGQFAQIELDALQPKLMTLHRLLLHRTS* |
| Ga0099829_114056851 | 3300009038 | Vadose Zone Soil | EPGVYRWREIKEGQLAQIELDALQPKPITLHRLLLHRTS* |
| Ga0099830_111126401 | 3300009088 | Vadose Zone Soil | NGREVQESEPGVYRWLEITEGKLTQIELDALQPKPMTLHRLLLHRTS* |
| Ga0099830_118364911 | 3300009088 | Vadose Zone Soil | YRWREINEGQLSQIELDALGPKVMTLHRLLIHRTN* |
| Ga0099828_114897002 | 3300009089 | Vadose Zone Soil | QETEAGVYRWQEITEGKLALIELEALQPKPMTLHRLLLHRTS* |
| Ga0099827_100080871 | 3300009090 | Vadose Zone Soil | TEPGVYRWREIKEGQLAQIELDALQPKSITLHRLLLHRTS* |
| Ga0099827_111085852 | 3300009090 | Vadose Zone Soil | GRETQETEPGVYRWREIKEGHLAQIELDALQPKPMTLHRLLLHRTS* |
| Ga0105247_106644872 | 3300009101 | Switchgrass Rhizosphere | EPGVYRWRQVNQGRLSLIELDALDPKVLTLHRLLIHRTT* |
| Ga0066709_1037990342 | 3300009137 | Grasslands Soil | VYRWREINEGRLSQIELDAMEPKLVTLHRLLIHRTS* |
| Ga0105241_112899851 | 3300009174 | Corn Rhizosphere | EPGVYRWRQINQGRLSLIELDALDPKILTLHRLLIHRTT* |
| Ga0126374_104926761 | 3300009792 | Tropical Forest Soil | PGVYRWREISQGGLSQIELDALSPKVMTLHRLMLRRTS* |
| Ga0126382_104145663 | 3300010047 | Tropical Forest Soil | GRETMETEPGVYRWREITEGHLAELELEALSPKPMKLHRLLLHRTS* |
| Ga0126382_124057952 | 3300010047 | Tropical Forest Soil | YRWREINEGRLSQIELDALEPRVVTLHRLLIQRTS* |
| Ga0126373_102466271 | 3300010048 | Tropical Forest Soil | RVLEDTEPGVYRWRQTNEGRLSLIELDALDPKILTLHRLLIRRTN* |
| Ga0126373_106515153 | 3300010048 | Tropical Forest Soil | MEFLKSLEGREETESEPGVYRWRAINQGGVSQIELEALSPKVMTLHRLMLRRTS* |
| Ga0126373_111462923 | 3300010048 | Tropical Forest Soil | YRWREINEHGLSQIELDALEPKVMTLHRLVVRKTN* |
| Ga0134111_101969802 | 3300010329 | Grasslands Soil | ETEPGVYRWSEITEGRLAEIELEALQPKPMKLHRLVLHRTT* |
| Ga0134062_105952811 | 3300010337 | Grasslands Soil | GVYRWSEITEGHLAEIELEALQPKQIKLHRLFLHRTS* |
| Ga0074044_101244601 | 3300010343 | Bog Forest Soil | PGVYRWREINEGRFSQIELDALQPKPITLHRLFLHRTT* |
| Ga0074044_106082782 | 3300010343 | Bog Forest Soil | ETESEPGVYRWRQTNEGGLSQIELDALQPKLMTLHRLVVRRTS* |
| Ga0126370_100137695 | 3300010358 | Tropical Forest Soil | GRIQEETEPGVYRWRQINQGRLSLIELDALDPKVLTLHRLLIRRTG* |
| Ga0126376_115482622 | 3300010359 | Tropical Forest Soil | GVYCWSEIIEGRLAEIELEALQPKPMKLHRLLLHRTS* |
| Ga0126376_116925632 | 3300010359 | Tropical Forest Soil | ETEPGVYRWSEITEGRLAEIELEALQPKPIRLHRLLLHRTS* |
| Ga0126372_121286781 | 3300010360 | Tropical Forest Soil | QEFLGRLEGKEQTESEPGVYRWREISQGGLSQIELDALSPKVMTLHRLTLRRTS* |
| Ga0126378_119791242 | 3300010361 | Tropical Forest Soil | EVVESEPGVYRWREVREGRLALIELEALQPKTITLHRLLLHRTSS* |
| Ga0126381_1001210561 | 3300010376 | Tropical Forest Soil | EAEPGVYRWREINEDGLSQIELDALEPKVMTLHRLMVRKTN* |
| Ga0136847_121835241 | 3300010391 | Freshwater Sediment | LDDAREFMQPLAGRENIEMEPGVYRWREISQGRYAQIELDALPKGFTLHRVKIHRTS* |
| Ga0126383_126129871 | 3300010398 | Tropical Forest Soil | EPGVYRWREISEGRLSQIELDALEPKPLTLHRLLLRRTS* |
| Ga0126383_134887331 | 3300010398 | Tropical Forest Soil | IQEDTEPGVYRWREIVQGPLSLIELDALDPKVPILHRLLIHRTS* |
| Ga0150983_133764731 | 3300011120 | Forest Soil | TEPGVYRWREIREGQLAQIELDALQPKPMTLHRLLLHRTS* |
| Ga0150983_141602633 | 3300011120 | Forest Soil | SGVYRWREIREGQLAQIELDALQPKPMTLHRLLLHRTS* |
| Ga0137392_101046633 | 3300011269 | Vadose Zone Soil | QETEPGVYRWREIKEGQLAQIELDSLQPKPVTLHRLLLRRTA* |
| Ga0137392_101180061 | 3300011269 | Vadose Zone Soil | NGRETQETEPGVYRWREIKEGQLAQIELDALQPKPMTLHRLLLHRTG* |
| Ga0137392_102160561 | 3300011269 | Vadose Zone Soil | YRWREIKEGQLAQIELDALQPKPMTLHRLLLHRTS* |
| Ga0137392_111483142 | 3300011269 | Vadose Zone Soil | GVYRWREIKEGHLAQIELDALQPKPMTLHRLLLHRTS* |
| Ga0137391_101853901 | 3300011270 | Vadose Zone Soil | GVYRWREINEGRLSQIELDALEPKVMTLHRLLIHRTN* |
| Ga0137391_111321782 | 3300011270 | Vadose Zone Soil | RETQETEPGVYRWREIKEGQLAQIELDALQPKAITLHRLLLHRTS* |
| Ga0137391_113259962 | 3300011270 | Vadose Zone Soil | ETQETEPGVYRWREIKEGQLAQIELDALQPKSITLHRLLLHRTS* |
| Ga0137393_100775011 | 3300011271 | Vadose Zone Soil | RETQETEPGVYRWREIKEGQLAQIELDALQPKSITLHRLLLHRTS* |
| Ga0137393_104241522 | 3300011271 | Vadose Zone Soil | ETEPGVYRWREINEGLLSQIELDSLEPKLVMLHRLLIHRTS* |
| Ga0137393_105483103 | 3300011271 | Vadose Zone Soil | PLNGRIHEETEPGVYRWREINEGQLSQIELDALGPKVMTLHRLLIHRTN* |
| Ga0137393_110845682 | 3300011271 | Vadose Zone Soil | TEPGVYRWREIKEGHLAQIELDALQPKPMTLHRLLLHRTS* |
| Ga0137393_112468922 | 3300011271 | Vadose Zone Soil | EPGVYRWREIKEGHLAQIELDALQPKPMTLHRLLLHRTS* |
| Ga0137389_102338281 | 3300012096 | Vadose Zone Soil | TEAGVYRWREITEGSLALIELDALQPKTMTLHRLLLHRTS* |
| Ga0137389_102962041 | 3300012096 | Vadose Zone Soil | PGVYRWREIKEGQLAQIELDALQPKPMTLHRLLLHRTS* |
| Ga0137389_104369033 | 3300012096 | Vadose Zone Soil | LNGRETQETEPGVYRWREIKEGHLAQIELDVLQPKPMTLHRLLLHRTS* |
| Ga0153958_10906052 | 3300012141 | Attine Ant Fungus Gardens | YRWREVTQGPLALIELDALQPKTMTLHRLLLHRTS* |
| Ga0137388_100250295 | 3300012189 | Vadose Zone Soil | GREVQETEAGVYRWREITEGSLALIELDALQPKTMTLHRLLLHRTS* |
| Ga0137388_115049522 | 3300012189 | Vadose Zone Soil | ESEPGVYRWREINEGGLSQIELDALQPKMFTLHRLVLRRTS* |
| Ga0137383_111217202 | 3300012199 | Vadose Zone Soil | NGRETQETEPGVYRWREIKEGHLAQIELDALQPKPMTLHRLLLHRTS* |
| Ga0137382_103147021 | 3300012200 | Vadose Zone Soil | PGVYRWREIQEGQLAQIELDALQPKPMTLHRLLLRRTR* |
| Ga0137382_107114801 | 3300012200 | Vadose Zone Soil | TEAGVYRWREITEGPLALIELDALQLKTVTLHRLLMHRTS* |
| Ga0137363_101943001 | 3300012202 | Vadose Zone Soil | TQETEPGVYRWREIKEGHLAQIELDVLQPKPMTLHRLLLHRTS* |
| Ga0137363_112062002 | 3300012202 | Vadose Zone Soil | RLNGRIHEETEPGVYRWREINEGRLSQIELDALEPKVMTLHRLLIHRAN* |
| Ga0137399_102285013 | 3300012203 | Vadose Zone Soil | AGVYRWREITEGSLALIELDALQPKIMTLHRLLLHRTS* |
| Ga0137399_107982341 | 3300012203 | Vadose Zone Soil | PGVYRWREINEGRLAQIELDALQPKHMTLHRLLLHRTS* |
| Ga0137399_109392192 | 3300012203 | Vadose Zone Soil | NGREQTESEPGVYRWREINEGGLSQIELDALQPKMFTLHRLVLRRTS* |
| Ga0137399_117604331 | 3300012203 | Vadose Zone Soil | ETEPGVYRWREIKEGQLAQIELDALQPKSITLHRLLLHRTS* |
| Ga0137362_108738742 | 3300012205 | Vadose Zone Soil | YRWREINEGQLAQIELDALQPKHMTLHRLLLHRTS* |
| Ga0137381_103737501 | 3300012207 | Vadose Zone Soil | ETMETEPGVYRWSEIIEGRLAEIELEALQPKPMKLHRLLLHRTS* |
| Ga0137379_107815593 | 3300012209 | Vadose Zone Soil | HRLNGRETQETEPGVYRWREIKEGHLAQIELDVLQPKPMTLHRLLLHRTS* |
| Ga0137377_103157921 | 3300012211 | Vadose Zone Soil | TQETEPGVYRWREIREGQLAQIELDALQPKAMTLHRLLLHRTS* |
| Ga0137360_100762111 | 3300012361 | Vadose Zone Soil | TEPGVYRWREIKEGQLAQIELDALQPKPMTLHRLLLHRTS* |
| Ga0137360_101584464 | 3300012361 | Vadose Zone Soil | LNGRETEETEPGVYRWREINEGQLAQIELDALQPKHMTLHRLLLHRTS* |
| Ga0137361_106280761 | 3300012362 | Vadose Zone Soil | RETEETEPGVYRWREINEGHLAQIELDALQPKHITLHRLLLRRTA* |
| Ga0137390_110981301 | 3300012363 | Vadose Zone Soil | RWREITEGPLALIELDALQPKTMTLHRLLLHRTS* |
| Ga0137397_105515622 | 3300012685 | Vadose Zone Soil | ETEETEPGVYRWREITEGKLAQIELDALQPKHMTLHRLLLHRTS* |
| Ga0137396_101804791 | 3300012918 | Vadose Zone Soil | GVYRWREIKEGQLAQIELDALQPKPMTLHRLLLHRTS* |
| Ga0137396_102548652 | 3300012918 | Vadose Zone Soil | ETEPGVYRWREIKEGKLAQIELDALQPKTMTLHRLLLRRTS* |
| Ga0137396_102955562 | 3300012918 | Vadose Zone Soil | VQETEAGVYRWREITEGSLALIELDALQPKTMTLHRLLLHRTS* |
| Ga0137394_103967021 | 3300012922 | Vadose Zone Soil | RRLNGRETEETEPGVYRWREINEGRLAQIELDALQPKHMTLHRLLLHRTS* |
| Ga0137419_100086221 | 3300012925 | Vadose Zone Soil | RLNGRETQETEPGVYRWREIKEGQLAQIELDALQPKPMTLHRLLLHRTS* |
| Ga0137404_106662193 | 3300012929 | Vadose Zone Soil | RWREITKGPQALIELDALQPKTMTLHRLLLHRTS* |
| Ga0137404_116624381 | 3300012929 | Vadose Zone Soil | EPGVYRWREINEGHLAQIELDALQPKHITLHRLLLRRTA* |
| Ga0137404_119232892 | 3300012929 | Vadose Zone Soil | ESEPGVYRWREINEGGLSQIELDALAPKLFTLHRLVLRRTS* |
| Ga0137407_109240051 | 3300012930 | Vadose Zone Soil | ETEETEPGVYRWSEINEGRLAQIELDALQPKHMTLHRLLLHRTS* |
| Ga0137407_124186081 | 3300012930 | Vadose Zone Soil | RLNGRETQETEPGVYRWREIKEGQFAQIELDALQPKSITLHRLLLHRTS* |
| Ga0126369_106835513 | 3300012971 | Tropical Forest Soil | GVYVWREVHEGDISQIELDAFEPKVMTVHRLVVRRTS* |
| Ga0134079_104964332 | 3300014166 | Grasslands Soil | PGVYRWREINHGRLSQIELDALEPKAITLHRLLFRRTN* |
| Ga0181531_100342021 | 3300014169 | Bog | DPHVYVWREITEGRLTQIELDTLDPKQFTLHRLLLRRT* |
| Ga0181537_100383125 | 3300014201 | Bog | YVWREITEGRLTQIELDTLDPKQFTLHRLLLRRT* |
| Ga0181537_102560161 | 3300014201 | Bog | EPNVYRWREITEGRLALIELDALMPKPLTIHRLFVLRTS* |
| Ga0137414_11837073 | 3300015051 | Vadose Zone Soil | VQETEAGVYRWREITEGPLALIELDALQPKTMTLHRLLMHRTS* |
| Ga0137405_13409891 | 3300015053 | Vadose Zone Soil | VYRWREINEGRLAQIELDALQPKHMTLHRLLLHRTS* |
| Ga0137405_13478963 | 3300015053 | Vadose Zone Soil | VYRWREITEGPLALIELDALQPKTMTLHRLLLSSHS* |
| Ga0137420_143336912 | 3300015054 | Vadose Zone Soil | LNGRETQETEPGVYRWREIKEGQLAQIELDALQPKSITLHRLLLHRTS* |
| Ga0137420_14337973 | 3300015054 | Vadose Zone Soil | MNGRETEETEPRRLSLARIKEGQLAQIELDALQPNRDLHRLLLHRTS* |
| Ga0137418_101061115 | 3300015241 | Vadose Zone Soil | YRWREIKEGQLAQIELDALQPKSITMHRLLLHRTS* |
| Ga0137418_101289371 | 3300015241 | Vadose Zone Soil | YRWREINEGQLAQIELDALQPKQMTLHRLLLHRTS* |
| Ga0137409_102803203 | 3300015245 | Vadose Zone Soil | VYRWREINEGRLSQIELDALEPKVMTLHRLLIHRTN* |
| Ga0137409_103507521 | 3300015245 | Vadose Zone Soil | LNGRETEETEPGVYRWREINEGRLAQIELDALQPKHMTLHRLLLHRTS* |
| Ga0134089_100382244 | 3300015358 | Grasslands Soil | GVYRWREIKEGQLAQIELDALQPKPITLHRLLLHRTS* |
| Ga0134085_103695351 | 3300015359 | Grasslands Soil | VYRWREINHGRLSQIELDALEPKAITLHRLLLRRTN* |
| Ga0132258_111204752 | 3300015371 | Arabidopsis Rhizosphere | GVYCWRQINQGRLSLIELDALDPKMLSLHRLLIHRTT* |
| Ga0182033_101259383 | 3300016319 | Soil | RLEGREETESEPGVYRWRAIHQGGVSQIELEALSPKVMTLHRLMLRRTS |
| Ga0182033_110448941 | 3300016319 | Soil | ESEPGVYRWLEISEGSLSQIELDALQPKTITLHRLVLRRT |
| Ga0182032_106558741 | 3300016357 | Soil | EPGVYRWREINHDGLSQIELDALSPKVMTLHRLLLRRTN |
| Ga0182034_119052931 | 3300016371 | Soil | SEPGVYRWREINHDGLSQIELDALSPKVMTLHRLLLRRTS |
| Ga0182040_100574913 | 3300016387 | Soil | LEGREQTESEPGVYRWREISQGGLSQIELDALSPKVMTLHRLTLRRTS |
| Ga0182040_100950613 | 3300016387 | Soil | LEGREQTESEPGVYRWREINHDGLSQIELDALSPKVMTLHRLLLRRTN |
| Ga0182037_111350531 | 3300016404 | Soil | EQTESEPGVYRWREINHDGLSQIELDALSPKVMTLHRLLLRRTN |
| Ga0182037_115628202 | 3300016404 | Soil | GVYRWREINHDGLSQIELDALSPKVMTLHRLLLRRTS |
| Ga0182038_103547383 | 3300016445 | Soil | GKEQTESEPGVYRWREINHDGLSQIELDALSPKVMTLHRLLLRRTN |
| Ga0187802_103802871 | 3300017822 | Freshwater Sediment | FLRRLNGRERTESEPGVYRWREIEEDGLSQIELDALEPKVMTLHRLVVRKTS |
| Ga0187818_100308603 | 3300017823 | Freshwater Sediment | ESEPGVYRWREINQDGLSQIELDALQPKVITLHRLVVRRTS |
| Ga0187806_12631951 | 3300017928 | Freshwater Sediment | VYVWREIKEGRLSQIELDALQPKVMAVHRLVVRRTS |
| Ga0187825_101887471 | 3300017930 | Freshwater Sediment | TQETEPGVYRWREITEGHLAQIELDALQPKPMTLHRLMLHRTS |
| Ga0187808_105167582 | 3300017942 | Freshwater Sediment | YVWREIKGGRLSQIELDALQPKVMAVHRLVVRRTS |
| Ga0187819_108281931 | 3300017943 | Freshwater Sediment | GREQTETEPGVYVWREIKEGRLSQIELDALQPKVMAVHRLVVRRTS |
| Ga0187785_100066441 | 3300017947 | Tropical Peatland | KEKTESEPGVYRWREITQNGLSQIELDAFEPKVMTLHRLVVRKTN |
| Ga0187779_105333552 | 3300017959 | Tropical Peatland | LNGREKTESEPDVYRWREINEGRLSQIELDALEPKVMTLHRLMVRRTS |
| Ga0187782_106975952 | 3300017975 | Tropical Peatland | EPGVYRWRQINEGGLSQIELDALQPKLMTLHRLVVRRTS |
| Ga0187816_102707523 | 3300017995 | Freshwater Sediment | EPGVYVWREVKDGRLSQIELDALQPKVMTLHRLVVRRTN |
| Ga0187772_102819922 | 3300018085 | Tropical Peatland | QRLTGRERTESEPGVYVWREINEGNVSQIELDALQPKMMTLHRLVVRRTS |
| Ga0066667_121867951 | 3300018433 | Grasslands Soil | METEPGVYRWSEITEGRLAEIELEALQPKPMKLHRLLLHRTS |
| Ga0179590_12300832 | 3300020140 | Vadose Zone Soil | REVQETEAGVYRWREITEGPLALIELDALQPKTMMLHRLLLHRTS |
| Ga0210407_100438401 | 3300020579 | Soil | PGVYRWRETTQGNLALIELDALQPKPMTLHRLLLHRTS |
| Ga0210407_101637271 | 3300020579 | Soil | PGVYRWREIKEGQLAQIELDALQPKPITLHRLLLHRTS |
| Ga0210407_108718841 | 3300020579 | Soil | GREVQESEPGVYRWLEITEGKLTQIELDALQPRQLTLHRLLLRRTS |
| Ga0210399_100172421 | 3300020581 | Soil | ESEPGVYRWREITEGRLSLIELESVTPKAMTLHRLLLHRTS |
| Ga0210399_100305057 | 3300020581 | Soil | EPGVYRWREISEGGLSQIELDALAPKTFTLHRLVLRRTS |
| Ga0210395_105530411 | 3300020582 | Soil | GREQVESEPGVYRWSEITEGRLAQIELEALEPKPMTLHRLLLHRTS |
| Ga0179596_102590733 | 3300021086 | Vadose Zone Soil | ETQETEPGVYRWREIKEGQFAQIELDALQPKPMTLHRLLLHRSS |
| Ga0210406_101819224 | 3300021168 | Soil | GRETQETEAGVYRWRETSEGRLALIELEALQPKPMTLHRLLLQRTS |
| Ga0210406_112515671 | 3300021168 | Soil | HLNGHITEETDPGVYRWREITEGRLTQIELDALQPKTITLHRLLLHRTS |
| Ga0210400_113833962 | 3300021170 | Soil | ETEAGVYRWREITEGPLALIELDALQPKTMTLHRLLLHRTS |
| Ga0210405_101618393 | 3300021171 | Soil | EVQETEAGVYRWREITEGSLALIELDALQPKTMTLHRLLLHRTS |
| Ga0210405_101873961 | 3300021171 | Soil | RPSETQESEPGVYRWRETTQGNLALIELDALQPKPMTLHRLLLHRTS |
| Ga0210393_113916121 | 3300021401 | Soil | FLRRLNGREQTESEPGVYRWREINEGGLSQIELDALEPKMFTLHRLVLRRTS |
| Ga0210385_104828121 | 3300021402 | Soil | NGKTVEESEPNVYRWREITEGRLALIELDALMPKPVTIHRLFVLRTS |
| Ga0210397_110630781 | 3300021403 | Soil | VEESEPNVYRWREITEGRLALIELDALMPKPVTIHRLFVLRTS |
| Ga0210389_113575601 | 3300021404 | Soil | QAETEPDVYRWSETSNGKLAQIELEALQPKVMTLHRLVVRRTS |
| Ga0210389_114907542 | 3300021404 | Soil | LRRLRGREQVESEPGVYRWSEITEGRLAQIELEALEPKPMTLHRLLLHRTS |
| Ga0210387_107584213 | 3300021405 | Soil | LNGREQTESEPGVYRWREINEGGLSQIELDALAPKTFTLHRLVLRRTS |
| Ga0210387_109597171 | 3300021405 | Soil | VYRWREISEGELSQIELDALAPKTFTLHRLVLRRTS |
| Ga0210386_100621561 | 3300021406 | Soil | PNVYRWREITEGRLALIELDALTPKPVTIHRLFVLRTS |
| Ga0210386_112869841 | 3300021406 | Soil | GREVVESEPGVYRWREITEGRLSLIELDSIAPKAMTLHRLLLHRTS |
| Ga0210383_106552602 | 3300021407 | Soil | LNGKTVEESEPNVYRWREITEGRLALIELDALMPKPVTIHRLFVLRTS |
| Ga0210383_109138071 | 3300021407 | Soil | IQETEAGVYRWRETSEGRLALIELEALQPKPVTLHRLLLQRTT |
| Ga0210394_106046341 | 3300021420 | Soil | LRRLNGREQTESEPGVYRWREINEGGLSQIELDALQPKMFTLHRLVLRRTS |
| Ga0210394_118272441 | 3300021420 | Soil | IRVGGNEQTESEPGVYRWRETKRGRLSQIELEALEPKVITVHRLVLRRTS |
| Ga0210384_100479841 | 3300021432 | Soil | ESEPGVYRWREITEGRLSLIELESISPKAMTLHRLLLHRTS |
| Ga0213879_102316261 | 3300021439 | Bulk Soil | ESEPGVYRWREITQGPLSLIEIEALDPKPVTLHRLLLHRTS |
| Ga0210402_115108512 | 3300021478 | Soil | REHGVYRWREITEGRLSLIELESISPRAMTLHRLLLHRTS |
| Ga0210409_104291471 | 3300021559 | Soil | ESEPGVYRWLEISEGSLSQIELDALQPKTITLHRLVLRRTS |
| Ga0212123_105446031 | 3300022557 | Iron-Sulfur Acid Spring | GREVVESEPGVYRWREITEGTLSLIELESISPKAMTLHRLLLHRTS |
| Ga0247680_10619832 | 3300024246 | Soil | KEETEPGVYRWREINHGRLSEIELDALEPKAITLHRLLLRRTS |
| Ga0247690_10107172 | 3300024287 | Soil | VVESEPGVYRWRQITEGRLSLIELESISPKPMTLHRLLLHRTS |
| Ga0179589_106095922 | 3300024288 | Vadose Zone Soil | NGRETQETEPGVYRWREIKEGQLAQIELDALQPKPMTLHRLLLHRTS |
| Ga0208479_10485733 | 3300025474 | Arctic Peat Soil | VYRWRETSDGSLSQIELEAFEPKPMTIHRLVLRRSS |
| Ga0207699_112569102 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | TEAGVYRWREITEGHLALIELDALQPKPMTLHRLLLQRTS |
| Ga0207693_101712124 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | YRWRQTSEGKLSLIELDALQPKPLTIHRLLVHRTS |
| Ga0209838_10255832 | 3300026214 | Soil | VYRWREITQGKLAQIELESLEPKTITLHRLLLHRTT |
| Ga0209154_12508462 | 3300026317 | Soil | ETEPGVYRWSEITEGHLAEIELEALQPKQIKLHRLFLHRTS |
| Ga0209131_10260541 | 3300026320 | Grasslands Soil | GVYRWREIKEGQLAQIELDALQPKPVTVHRLLLHRTS |
| Ga0209131_13559221 | 3300026320 | Grasslands Soil | EQTESEPGVYRWREINEGGLSQIELDALQPKMFTLHRLVLRRTS |
| Ga0257158_10805922 | 3300026515 | Soil | PGVYRWREIKEGQLAQIELDALQPKPMTLHRLLLHRTS |
| Ga0209807_13168612 | 3300026530 | Soil | EPGVYRWREITEGKLSLIELDAVQPKPMTLHRLLLHRTS |
| Ga0209056_104604431 | 3300026538 | Soil | IKEETEPGVYRWREINHGRLSQIELDALEPKAITLHRLLLRRTS |
| Ga0209648_104713922 | 3300026551 | Grasslands Soil | YRWLEITEGKLTQIELDALQPKPMTLHRLLLHRTS |
| Ga0209577_101915361 | 3300026552 | Soil | RLNGRETMETEPGVYRWSEITEGPLAEIELEALQPKPMKLHRLLLHRTS |
| Ga0209577_104498683 | 3300026552 | Soil | RLNGRETTETEPGVYRWSEITEGRLAEIELEALQPKPMKLHRLVLHRTT |
| Ga0179593_10245976 | 3300026555 | Vadose Zone Soil | VKLRETEPGVYRWREIKEGQLAQIELDALQPKSITLHRLLLHRTS |
| Ga0207764_1226831 | 3300026839 | Tropical Forest Soil | EQTESEPGVYRWREISQGGLSQIELDALSPKVMTLHRLTLRRTS |
| Ga0207786_1131011 | 3300026866 | Tropical Forest Soil | EPGVYRWREISQGGLSQIELDALSPKVMTLHRLTLRRTS |
| Ga0207781_10143912 | 3300026890 | Tropical Forest Soil | RLNGREKTESEPGVYRWREISVGKLSQIELDALEPKVMTLHRLMVRRTS |
| Ga0207840_10081343 | 3300026910 | Tropical Forest Soil | GREQTESEPGVYRWREISQGGLSQIELDALSPKVMTLHRLTLRRTS |
| Ga0207736_1031983 | 3300027023 | Tropical Forest Soil | TESEPGVYRWREISQGGLSQIELDALSPKVMTLHRLTLRRTS |
| Ga0209732_10530352 | 3300027117 | Forest Soil | EPNVYRWRQITEGRLALIELDALTPKPVTIHRLFVLRTS |
| Ga0209421_10232771 | 3300027432 | Forest Soil | FLQRLNGREETESEPGVYRWREISPGSLSQIELDALEPKVMTLHRLVIRRTS |
| Ga0209009_11032601 | 3300027667 | Forest Soil | RRLRGREQVESEPGVYRWSEITEGRLAQIELEALEPKPMTLHRLLLHRTS |
| Ga0209530_11765532 | 3300027692 | Forest Soil | LRRLNGREVQETEAGVYRWREITEGRLALIELDALQPKPLTLHRLLLQRTS |
| Ga0209446_10241543 | 3300027698 | Bog Forest Soil | FLQKIIGRENTESEPGVYRWRETSSGALSEIELDALEPKVMTVHRLVLRRTS |
| Ga0209810_10662291 | 3300027773 | Surface Soil | LNGRIKEETEPGVYRRREINEGRLSLIELDALQPKPMKLHRLVLRRTS |
| Ga0209656_100088271 | 3300027812 | Bog Forest Soil | GREQTESEPGVYRWREIKEDGLSQIELEALEPKVITVHRLMVRRTS |
| Ga0209180_101921584 | 3300027846 | Vadose Zone Soil | LRRLNGRETQETEPGVYRWREIKEGQLAQIELDALQPKTITLHRLLLHRTS |
| Ga0209517_103145523 | 3300027854 | Peatlands Soil | TESEPGVYRWRQTGEGGLSQIELDALQPKLMTLHRLVVRRTS |
| Ga0209590_108417261 | 3300027882 | Vadose Zone Soil | PNGREVQETEAGVYRWREITEGKLALIELDALQPKPMTLHRLLLHRTS |
| Ga0209380_107048491 | 3300027889 | Soil | NPNGREVVESEPGVYRWREITEGRLSLIELESIAPKAMILHRLFLHRTS |
| Ga0209380_108694991 | 3300027889 | Soil | QTESEPGVYVWREINEGGLSQIELDALQPKTMTLHRLVVRRTS |
| Ga0137415_100683241 | 3300028536 | Vadose Zone Soil | REVQETEAGVYRWREITEGPLALIELDALQPKIMTLHRLLMHRTS |
| Ga0137415_101239521 | 3300028536 | Vadose Zone Soil | YRWREIKEGQLAQIELDALQPKPMTVHRLLLHRTS |
| Ga0308309_102801611 | 3300028906 | Soil | YRWREITEGRLALIELDALTPKPVTIHRLFVLRTS |
| Ga0265461_112479183 | 3300030743 | Soil | SEPGIYRWREITEGRLSLIELDSIAPKAMTLHRLLLHRTS |
| Ga0318534_100693781 | 3300031544 | Soil | EQTESEPGVYRWREINHGGLSQIELDALSPKVMTLHRLLLRRTS |
| Ga0318573_103989012 | 3300031564 | Soil | EGREETESEPGVYRWRAINQGGVSQIELEALSPKVMTLHRLMLRRTS |
| Ga0310915_102529911 | 3300031573 | Soil | NGREKTESEPGVYRWREITEKGLSQIELDALEPKVMALHRLVVRRTS |
| Ga0318555_105097682 | 3300031640 | Soil | TDSEPGVYLWREINEGRLSQIELEVVQPKPFTLHRLVVRRTS |
| Ga0307476_103314021 | 3300031715 | Hardwood Forest Soil | IEESEPGVYRWREITEGRLALIELDALTPKPVTIHRLFVLRTP |
| Ga0307474_108675401 | 3300031718 | Hardwood Forest Soil | REVQETEAGVYRWREITEGTLALIELDALQPKTITLHRLLLHRTS |
| Ga0306917_110423061 | 3300031719 | Soil | SEPGVYRWREMNHDGLSQIELDALSPKVMTLHRLMLRRTS |
| Ga0306917_114371001 | 3300031719 | Soil | EGREQTESEPGVYRWREISQGGLSQIELDALSPKVITLHRLTLRRTS |
| Ga0307469_123050311 | 3300031720 | Hardwood Forest Soil | ETEETEPGVYRWREINEGRLTQIELDALQPKHMTLHRLLLHRTS |
| Ga0318502_105138761 | 3300031747 | Soil | EFLQRLKGREKTESEPGVYVWREVHEGDISQIELDTFEPKVMTVHRLVVRRTS |
| Ga0318546_106612642 | 3300031771 | Soil | FLQRLNGREKTESEPGVYRWREIVENGLSQIELDALEPKVMTLHRLVVRKTS |
| Ga0318566_103083921 | 3300031779 | Soil | EGREQTESEPGVYRWREINRNGLSQIELDALSPKVMTLHRLLLRRTN |
| Ga0318547_110461802 | 3300031781 | Soil | TESEPGVYRWRAINQGGVSQIELEALSPKVMTLHRLMLRRTS |
| Ga0318568_102250731 | 3300031819 | Soil | FLERLNGREKTESEPGVYRWREISVGKLSQIELDALEPKVMTLHRLVIRRTS |
| Ga0307473_105440071 | 3300031820 | Hardwood Forest Soil | NQETEPGVYRWREIKEGQLAQIELDALQPKAMTLHRLLLHRTS |
| Ga0318567_108302542 | 3300031821 | Soil | REFLERLEGREQTESEPGVYRWREINRNGLSQIELDALSPKVMTLHRLLLRRTS |
| Ga0310917_100365281 | 3300031833 | Soil | YRWRQINQGRLSLIELDALDPKVLNLHRLLIHRTS |
| Ga0306919_112448351 | 3300031879 | Soil | ESEPGVYRWREINHDGLSQIELDALSPKVMTLHRLLLRRTS |
| Ga0306919_113907402 | 3300031879 | Soil | YRWRQINEGRLSLIELDALDPKILTLHRLFIRRTS |
| Ga0318544_100188603 | 3300031880 | Soil | LNGRETTETEPGVYRWSEIIEGHLAEIELEALQPKPMKLHRLLLHRTT |
| Ga0306925_101102894 | 3300031890 | Soil | LNGREKTESEPGVYRWREITENGLSQIELDSLEPKVNTLHRLVVRKTS |
| Ga0306925_102461543 | 3300031890 | Soil | ETEPGVYRWRQINEGRLSLIELDALDPKILTLHRLFIRRTS |
| Ga0306923_108847031 | 3300031910 | Soil | REQTESEPGVYRWREINHDGLSQIELDALSPKVMTLHRLLLRRTN |
| Ga0310913_105588863 | 3300031945 | Soil | EGREQTESEPGVYRWREISQGGLSQIELDALSPKVMTLHRLMLRRTS |
| Ga0310913_110204771 | 3300031945 | Soil | PGVYLWREINEGRLSQIELEVVQPKPFTLHRLVVRRTS |
| Ga0310909_103424661 | 3300031947 | Soil | REQTESEPGVYRWREINHGGLSQIELDALSPKVMTLHRLLLRRTS |
| Ga0307479_106811091 | 3300031962 | Hardwood Forest Soil | YRWREINGEGLSQIELDALAPKMFTLHRLVVRRTS |
| Ga0307479_108152401 | 3300031962 | Hardwood Forest Soil | EFLQRLEGREQTESEPGLYRWREINQDGLSQIELDALSPKVMTLHRLVLRRTS |
| Ga0307479_111506862 | 3300031962 | Hardwood Forest Soil | PNGREVQETEAGVYRWREITEGPLALIELDALQPKTMTLHRLLLHRTS |
| Ga0306922_102609303 | 3300032001 | Soil | EFLQRLEGREQTESEPGVYRWREISQGGLSQIELDALSPKVMTLHRLTLRRTS |
| Ga0306922_110166181 | 3300032001 | Soil | ERLEGREQTESEPGVYRWREINRNGLSQIELDALSPKVMTLHRLLLRRTS |
| Ga0310911_100409123 | 3300032035 | Soil | DAMEFLKRLEGREETESEPGVYRWRAINQGGVSQIELEALSPKVMTLHRLMLRRTS |
| Ga0318559_100312943 | 3300032039 | Soil | GVYRWSEIIEGHLAEIELEALQPKPMKLHRLLLHRTT |
| Ga0318533_103990421 | 3300032059 | Soil | VYVWREINDGALSQIELEALQPKSITLHRLVVRRTT |
| Ga0318533_110729001 | 3300032059 | Soil | LNGREKTESEPGVYRWREINEGKLSQIELDALEPKVMTLHRLVVRKTN |
| Ga0306924_101942701 | 3300032076 | Soil | LERLNGREKTESEPGVYRWREISVGKLSQIELDALEPKVMTLHRLVIRRTS |
| Ga0318540_102741601 | 3300032094 | Soil | EPGVYRWREINHDGLSQIELDALSPKVMTLHRLLLRRTS |
| Ga0307471_1002988881 | 3300032180 | Hardwood Forest Soil | VREETEPGVYRWREINEGRLSQIELDALEPKMMTLHRLLIHRTS |
| Ga0307471_1016793832 | 3300032180 | Hardwood Forest Soil | VQETEAGVYRWREITEGSLALIELDALQPKTMTLHRLLLHRTS |
| Ga0307471_1030888431 | 3300032180 | Hardwood Forest Soil | GVYVWREINEGKLSQIELDALQPKVMMLHRLVVRRTS |
| Ga0307472_1005679071 | 3300032205 | Hardwood Forest Soil | GVYRWREITDGRFALIELEAIEPKPMTVHRLFLHRT |
| Ga0307472_1013438642 | 3300032205 | Hardwood Forest Soil | RIHEETEPGVYRWREINEGRLSQIELDALEPKLVMLHRLLIHRTS |
| Ga0307472_1024159751 | 3300032205 | Hardwood Forest Soil | RPNGREVQETEAGVYRWREITQGSLALIELDALQPKTMTLHRLLLHRTS |
| Ga0307472_1027034192 | 3300032205 | Hardwood Forest Soil | REVQETEAGVYRWREITEGSLALIELDALQPKTMTLHRLLLHRTS |
| Ga0306920_1008190321 | 3300032261 | Soil | EGREQTESEPGVYRWREINHDGLSQIELDALSPKVMTLHRLLLRRTS |
| Ga0306920_1024773011 | 3300032261 | Soil | EPGVYRWREINEDGLSQIELDALEPKVMTLHRLVVRKTN |
| Ga0306920_1029127442 | 3300032261 | Soil | EGREQTESEPGVYRWREINHDGLSQIELDALSPKVMTLHRLLLRRTN |
| Ga0306920_1036586341 | 3300032261 | Soil | PNGRVLEETEPGVYRWRQVSEGRLSLIELDALDPKILTLHRVLIRRTN |
| Ga0335079_121657742 | 3300032783 | Soil | PGVYRWREITEGKLSLIELESIQPKAMTLHRLLLHRTS |
| Ga0335078_127078322 | 3300032805 | Soil | FLHRLQGREQTESEPGVYVWREINDGRLSQIELEALRPKMMTLHRLVVRRTS |
| Ga0335071_120290591 | 3300032897 | Soil | YRWRQTREGGLSQIELDALQPKLMTLHRLVVKRTS |
| Ga0335083_111331661 | 3300032954 | Soil | LNGREKTESEPGVYSWREISEGRLSQIELDALEPKVMTLHRLMVRRTS |
| Ga0326728_106483721 | 3300033402 | Peat Soil | EPGVYRWRETNEGGLSQIELDALQPKLMTLHRLVVRRTS |
| ⦗Top⦘ |