| Basic Information | |
|---|---|
| Family ID | F012632 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 279 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VRRLLLSATLLALALPAPAFARGEFDPTTEFEQHEWIPIHL |
| Number of Associated Samples | 226 |
| Number of Associated Scaffolds | 279 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 93.86 % |
| % of genes near scaffold ends (potentially truncated) | 98.57 % |
| % of genes from short scaffolds (< 2000 bps) | 93.19 % |
| Associated GOLD sequencing projects | 211 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.548 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (12.545 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.258 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.595 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 28.99% β-sheet: 0.00% Coil/Unstructured: 71.01% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 279 Family Scaffolds |
|---|---|---|
| PF12697 | Abhydrolase_6 | 9.68 |
| PF00953 | Glycos_transf_4 | 2.15 |
| PF13670 | PepSY_2 | 1.43 |
| PF09527 | ATPase_gene1 | 1.08 |
| PF12833 | HTH_18 | 1.08 |
| PF00561 | Abhydrolase_1 | 1.08 |
| PF14681 | UPRTase | 0.72 |
| PF00119 | ATP-synt_A | 0.36 |
| PF01047 | MarR | 0.36 |
| PF13544 | Obsolete Pfam Family | 0.36 |
| PF08122 | NDUF_B12 | 0.36 |
| PF00753 | Lactamase_B | 0.36 |
| PF12840 | HTH_20 | 0.36 |
| PF10282 | Lactonase | 0.36 |
| PF13450 | NAD_binding_8 | 0.36 |
| PF03169 | OPT | 0.36 |
| PF00464 | SHMT | 0.36 |
| PF00005 | ABC_tran | 0.36 |
| PF01300 | Sua5_yciO_yrdC | 0.36 |
| PF12796 | Ank_2 | 0.36 |
| PF00353 | HemolysinCabind | 0.36 |
| PF04007 | DUF354 | 0.36 |
| PF14340 | DUF4395 | 0.36 |
| COG ID | Name | Functional Category | % Frequency in 279 Family Scaffolds |
|---|---|---|---|
| COG0472 | UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferase | Cell wall/membrane/envelope biogenesis [M] | 2.15 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.36 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.36 |
| COG0356 | FoF1-type ATP synthase, membrane subunit a | Energy production and conversion [C] | 0.36 |
| COG0381 | UDP-N-acetylglucosamine 2-epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.36 |
| COG1297 | Predicted oligopeptide transporter, OPT family | General function prediction only [R] | 0.36 |
| COG1817 | Predicted glycosyltransferase | General function prediction only [R] | 0.36 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.55 % |
| Unclassified | root | N/A | 6.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918006|ConsensusfromContig59862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 630 | Open in IMG/M |
| 2170459019|G14TP7Y01D0BFU | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 572 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100631975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1077 | Open in IMG/M |
| 3300000955|JGI1027J12803_100002771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 558 | Open in IMG/M |
| 3300000956|JGI10216J12902_100784652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 945 | Open in IMG/M |
| 3300000956|JGI10216J12902_104737824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 622 | Open in IMG/M |
| 3300000956|JGI10216J12902_107156393 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300000956|JGI10216J12902_108496435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 617 | Open in IMG/M |
| 3300000956|JGI10216J12902_111285827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
| 3300000956|JGI10216J12902_112278258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
| 3300000956|JGI10216J12902_115464087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
| 3300000956|JGI10216J12902_116980283 | Not Available | 632 | Open in IMG/M |
| 3300001431|F14TB_101987887 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300001526|A105W1_1102657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 706 | Open in IMG/M |
| 3300002568|C688J35102_119830158 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300004081|Ga0063454_101471801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 581 | Open in IMG/M |
| 3300004081|Ga0063454_101674728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
| 3300004114|Ga0062593_100694914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 991 | Open in IMG/M |
| 3300004114|Ga0062593_102685654 | Not Available | 567 | Open in IMG/M |
| 3300004153|Ga0063455_100309653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 873 | Open in IMG/M |
| 3300004156|Ga0062589_100034078 | All Organisms → cellular organisms → Bacteria | 2641 | Open in IMG/M |
| 3300004156|Ga0062589_100828479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 842 | Open in IMG/M |
| 3300004156|Ga0062589_101832707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 610 | Open in IMG/M |
| 3300004157|Ga0062590_101553282 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300004463|Ga0063356_103225323 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300004479|Ga0062595_100795684 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300004479|Ga0062595_100841962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 763 | Open in IMG/M |
| 3300005093|Ga0062594_101503124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 691 | Open in IMG/M |
| 3300005093|Ga0062594_102618289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
| 3300005165|Ga0066869_10022807 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300005166|Ga0066674_10217143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 910 | Open in IMG/M |
| 3300005166|Ga0066674_10565806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
| 3300005174|Ga0066680_10175536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1349 | Open in IMG/M |
| 3300005175|Ga0066673_10601297 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300005180|Ga0066685_10685830 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300005187|Ga0066675_10731167 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300005328|Ga0070676_10686040 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300005329|Ga0070683_100719441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 956 | Open in IMG/M |
| 3300005334|Ga0068869_100855333 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300005335|Ga0070666_11397722 | Not Available | 523 | Open in IMG/M |
| 3300005336|Ga0070680_100200217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1684 | Open in IMG/M |
| 3300005337|Ga0070682_101432341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
| 3300005339|Ga0070660_100220130 | All Organisms → cellular organisms → Bacteria | 1543 | Open in IMG/M |
| 3300005341|Ga0070691_10296182 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300005343|Ga0070687_100655705 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300005343|Ga0070687_101514710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300005345|Ga0070692_11137413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 553 | Open in IMG/M |
| 3300005354|Ga0070675_100459555 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300005356|Ga0070674_101377832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 631 | Open in IMG/M |
| 3300005434|Ga0070709_11237409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
| 3300005435|Ga0070714_100677993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 994 | Open in IMG/M |
| 3300005438|Ga0070701_11337663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
| 3300005440|Ga0070705_100397279 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300005441|Ga0070700_101863511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
| 3300005451|Ga0066681_10478208 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300005457|Ga0070662_101389532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 605 | Open in IMG/M |
| 3300005458|Ga0070681_11698343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
| 3300005459|Ga0068867_100553710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 997 | Open in IMG/M |
| 3300005459|Ga0068867_100611095 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300005468|Ga0070707_101747640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 589 | Open in IMG/M |
| 3300005526|Ga0073909_10082096 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300005526|Ga0073909_10655286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
| 3300005529|Ga0070741_10186295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2037 | Open in IMG/M |
| 3300005530|Ga0070679_100508982 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300005530|Ga0070679_100851854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 855 | Open in IMG/M |
| 3300005530|Ga0070679_101253319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 687 | Open in IMG/M |
| 3300005535|Ga0070684_100037282 | All Organisms → cellular organisms → Bacteria | 4169 | Open in IMG/M |
| 3300005546|Ga0070696_100171634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1603 | Open in IMG/M |
| 3300005549|Ga0070704_100218754 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
| 3300005549|Ga0070704_101388859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 644 | Open in IMG/M |
| 3300005552|Ga0066701_10456585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 793 | Open in IMG/M |
| 3300005556|Ga0066707_10050941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2400 | Open in IMG/M |
| 3300005556|Ga0066707_10501800 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300005558|Ga0066698_10232226 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300005558|Ga0066698_10653266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 701 | Open in IMG/M |
| 3300005560|Ga0066670_10278703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1016 | Open in IMG/M |
| 3300005560|Ga0066670_10728096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 601 | Open in IMG/M |
| 3300005561|Ga0066699_10193497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1413 | Open in IMG/M |
| 3300005563|Ga0068855_100778280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1018 | Open in IMG/M |
| 3300005569|Ga0066705_10265662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1088 | Open in IMG/M |
| 3300005569|Ga0066705_10282340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1053 | Open in IMG/M |
| 3300005569|Ga0066705_10846983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 544 | Open in IMG/M |
| 3300005578|Ga0068854_101065153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 719 | Open in IMG/M |
| 3300005615|Ga0070702_100845214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 712 | Open in IMG/M |
| 3300005616|Ga0068852_102133924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 582 | Open in IMG/M |
| 3300005764|Ga0066903_101523198 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300005764|Ga0066903_108763989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
| 3300005764|Ga0066903_109021817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 505 | Open in IMG/M |
| 3300005844|Ga0068862_100336061 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
| 3300006046|Ga0066652_100066710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2784 | Open in IMG/M |
| 3300006046|Ga0066652_100416915 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300006046|Ga0066652_102021664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
| 3300006058|Ga0075432_10499787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 541 | Open in IMG/M |
| 3300006163|Ga0070715_10407190 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300006175|Ga0070712_100527170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 993 | Open in IMG/M |
| 3300006196|Ga0075422_10146959 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300006237|Ga0097621_100751535 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300006358|Ga0068871_102197120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 526 | Open in IMG/M |
| 3300006580|Ga0074049_10317515 | Not Available | 560 | Open in IMG/M |
| 3300006580|Ga0074049_13171399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 665 | Open in IMG/M |
| 3300006791|Ga0066653_10095294 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300006791|Ga0066653_10736484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
| 3300006796|Ga0066665_10872349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 700 | Open in IMG/M |
| 3300006804|Ga0079221_10658567 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300006806|Ga0079220_10284628 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300006806|Ga0079220_11223264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 622 | Open in IMG/M |
| 3300006844|Ga0075428_101420660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 728 | Open in IMG/M |
| 3300006846|Ga0075430_101015514 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300006871|Ga0075434_100718754 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300006881|Ga0068865_100884584 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300006903|Ga0075426_10734831 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300006904|Ga0075424_100922049 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300006953|Ga0074063_13612879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 586 | Open in IMG/M |
| 3300006954|Ga0079219_12284565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
| 3300009012|Ga0066710_102842787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 682 | Open in IMG/M |
| 3300009098|Ga0105245_13159455 | Not Available | 510 | Open in IMG/M |
| 3300009101|Ga0105247_10319941 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300009101|Ga0105247_10854000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 699 | Open in IMG/M |
| 3300009137|Ga0066709_100944734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1259 | Open in IMG/M |
| 3300009148|Ga0105243_10096399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2447 | Open in IMG/M |
| 3300009162|Ga0075423_10232201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1933 | Open in IMG/M |
| 3300009162|Ga0075423_10323094 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300009176|Ga0105242_11634903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 679 | Open in IMG/M |
| 3300009551|Ga0105238_12978685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
| 3300009836|Ga0105068_1100195 | Not Available | 564 | Open in IMG/M |
| 3300010039|Ga0126309_10168758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1190 | Open in IMG/M |
| 3300010039|Ga0126309_11172582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 526 | Open in IMG/M |
| 3300010042|Ga0126314_10855525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 671 | Open in IMG/M |
| 3300010042|Ga0126314_11192659 | Not Available | 569 | Open in IMG/M |
| 3300010301|Ga0134070_10157001 | Not Available | 818 | Open in IMG/M |
| 3300010337|Ga0134062_10446218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 641 | Open in IMG/M |
| 3300010366|Ga0126379_12393633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 628 | Open in IMG/M |
| 3300010371|Ga0134125_11441094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 750 | Open in IMG/M |
| 3300010399|Ga0134127_13188393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 536 | Open in IMG/M |
| 3300010401|Ga0134121_11110053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 784 | Open in IMG/M |
| 3300011003|Ga0138514_100127708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 561 | Open in IMG/M |
| 3300011107|Ga0151490_1061647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 757 | Open in IMG/M |
| 3300011271|Ga0137393_11151594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 659 | Open in IMG/M |
| 3300011999|Ga0120148_1063902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 731 | Open in IMG/M |
| 3300012001|Ga0120167_1050810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 912 | Open in IMG/M |
| 3300012010|Ga0120118_1042154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1170 | Open in IMG/M |
| 3300012198|Ga0137364_10989429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 636 | Open in IMG/M |
| 3300012204|Ga0137374_11252457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
| 3300012211|Ga0137377_11013806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 761 | Open in IMG/M |
| 3300012212|Ga0150985_116588095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 536 | Open in IMG/M |
| 3300012212|Ga0150985_119898053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 624 | Open in IMG/M |
| 3300012354|Ga0137366_10403264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 995 | Open in IMG/M |
| 3300012357|Ga0137384_10619423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 882 | Open in IMG/M |
| 3300012383|Ga0134033_1259547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 700 | Open in IMG/M |
| 3300012403|Ga0134049_1213476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 568 | Open in IMG/M |
| 3300012469|Ga0150984_120305678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 686 | Open in IMG/M |
| 3300012484|Ga0157333_1012497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
| 3300012582|Ga0137358_11070477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300012905|Ga0157296_10402364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
| 3300012917|Ga0137395_11003335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 598 | Open in IMG/M |
| 3300012923|Ga0137359_10900556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 763 | Open in IMG/M |
| 3300012925|Ga0137419_11616578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 551 | Open in IMG/M |
| 3300012925|Ga0137419_11876581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
| 3300012930|Ga0137407_12337652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 511 | Open in IMG/M |
| 3300012955|Ga0164298_10089003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1605 | Open in IMG/M |
| 3300012957|Ga0164303_10649402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 703 | Open in IMG/M |
| 3300012957|Ga0164303_11024059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
| 3300012977|Ga0134087_10236597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 832 | Open in IMG/M |
| 3300012984|Ga0164309_10030773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2942 | Open in IMG/M |
| 3300012984|Ga0164309_11290219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 617 | Open in IMG/M |
| 3300012985|Ga0164308_11027971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 734 | Open in IMG/M |
| 3300012987|Ga0164307_11793723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
| 3300012988|Ga0164306_10255015 | Not Available | 1259 | Open in IMG/M |
| 3300012988|Ga0164306_10331156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1122 | Open in IMG/M |
| 3300012989|Ga0164305_10159759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1540 | Open in IMG/M |
| 3300012989|Ga0164305_10354722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1106 | Open in IMG/M |
| 3300012989|Ga0164305_10774154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 793 | Open in IMG/M |
| 3300013307|Ga0157372_10486875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1438 | Open in IMG/M |
| 3300013308|Ga0157375_11456436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 807 | Open in IMG/M |
| 3300013308|Ga0157375_12502968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 616 | Open in IMG/M |
| 3300013770|Ga0120123_1020507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1330 | Open in IMG/M |
| 3300013772|Ga0120158_10032302 | All Organisms → cellular organisms → Bacteria | 3967 | Open in IMG/M |
| 3300013831|Ga0120126_1020943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 644 | Open in IMG/M |
| 3300014150|Ga0134081_10290597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
| 3300014497|Ga0182008_10919425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300014827|Ga0120171_1002685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10727 | Open in IMG/M |
| 3300014829|Ga0120104_1015206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1360 | Open in IMG/M |
| 3300015053|Ga0137405_1262075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1144 | Open in IMG/M |
| 3300015077|Ga0173483_10009241 | All Organisms → cellular organisms → Bacteria | 3339 | Open in IMG/M |
| 3300015262|Ga0182007_10426148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
| 3300015371|Ga0132258_10026897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12744 | Open in IMG/M |
| 3300015371|Ga0132258_13496746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1076 | Open in IMG/M |
| 3300015372|Ga0132256_103016373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 566 | Open in IMG/M |
| 3300015373|Ga0132257_102986531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 616 | Open in IMG/M |
| 3300015374|Ga0132255_100320845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2235 | Open in IMG/M |
| 3300015374|Ga0132255_104715077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 578 | Open in IMG/M |
| 3300017944|Ga0187786_10231053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 721 | Open in IMG/M |
| 3300017947|Ga0187785_10724157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
| 3300017973|Ga0187780_11073014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 588 | Open in IMG/M |
| 3300018027|Ga0184605_10514572 | Not Available | 520 | Open in IMG/M |
| 3300018061|Ga0184619_10131075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1138 | Open in IMG/M |
| 3300018061|Ga0184619_10232973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 847 | Open in IMG/M |
| 3300018066|Ga0184617_1078797 | Not Available | 890 | Open in IMG/M |
| 3300018074|Ga0184640_10139639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1075 | Open in IMG/M |
| 3300018433|Ga0066667_10994038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 724 | Open in IMG/M |
| 3300020076|Ga0206355_1588962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 722 | Open in IMG/M |
| 3300020610|Ga0154015_1159214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
| 3300021344|Ga0193719_10058350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1674 | Open in IMG/M |
| 3300021418|Ga0193695_1095144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 640 | Open in IMG/M |
| 3300022467|Ga0224712_10255465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 811 | Open in IMG/M |
| 3300022756|Ga0222622_10022203 | All Organisms → cellular organisms → Bacteria | 3250 | Open in IMG/M |
| 3300022898|Ga0247745_1031122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 796 | Open in IMG/M |
| 3300024284|Ga0247671_1061347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 605 | Open in IMG/M |
| 3300025604|Ga0207930_1146978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 508 | Open in IMG/M |
| 3300025911|Ga0207654_10752225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 702 | Open in IMG/M |
| 3300025913|Ga0207695_11733403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 506 | Open in IMG/M |
| 3300025915|Ga0207693_10186550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1632 | Open in IMG/M |
| 3300025915|Ga0207693_10934930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 664 | Open in IMG/M |
| 3300025919|Ga0207657_10416220 | Not Available | 1057 | Open in IMG/M |
| 3300025922|Ga0207646_11647469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
| 3300025923|Ga0207681_10650538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 874 | Open in IMG/M |
| 3300025924|Ga0207694_11676785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
| 3300025928|Ga0207700_12017014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
| 3300025933|Ga0207706_10019545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6094 | Open in IMG/M |
| 3300025934|Ga0207686_10780916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 764 | Open in IMG/M |
| 3300025939|Ga0207665_10027309 | All Organisms → cellular organisms → Bacteria | 3771 | Open in IMG/M |
| 3300025945|Ga0207679_10346420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1294 | Open in IMG/M |
| 3300025949|Ga0207667_10267319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1748 | Open in IMG/M |
| 3300025981|Ga0207640_10502047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1010 | Open in IMG/M |
| 3300026023|Ga0207677_10502482 | Not Available | 1049 | Open in IMG/M |
| 3300026023|Ga0207677_10705538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 896 | Open in IMG/M |
| 3300026041|Ga0207639_11878314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 560 | Open in IMG/M |
| 3300026041|Ga0207639_12226781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
| 3300026078|Ga0207702_11402801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 692 | Open in IMG/M |
| 3300026095|Ga0207676_12428958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 521 | Open in IMG/M |
| 3300026116|Ga0207674_11170519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 738 | Open in IMG/M |
| 3300026118|Ga0207675_101135544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 801 | Open in IMG/M |
| 3300026121|Ga0207683_10474844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1154 | Open in IMG/M |
| 3300026142|Ga0207698_11065058 | Not Available | 821 | Open in IMG/M |
| 3300026295|Ga0209234_1164943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 775 | Open in IMG/M |
| 3300026300|Ga0209027_1084372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1164 | Open in IMG/M |
| 3300026322|Ga0209687_1120639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 845 | Open in IMG/M |
| 3300026538|Ga0209056_10105932 | All Organisms → cellular organisms → Bacteria | 2277 | Open in IMG/M |
| 3300027821|Ga0209811_10315316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 603 | Open in IMG/M |
| 3300027826|Ga0209060_10354826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 668 | Open in IMG/M |
| 3300027882|Ga0209590_10354411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 946 | Open in IMG/M |
| 3300028710|Ga0307322_10058475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 950 | Open in IMG/M |
| 3300028721|Ga0307315_10078281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 952 | Open in IMG/M |
| 3300028754|Ga0307297_10104585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 934 | Open in IMG/M |
| 3300028787|Ga0307323_10326868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 550 | Open in IMG/M |
| 3300028807|Ga0307305_10413838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 609 | Open in IMG/M |
| 3300028814|Ga0307302_10001874 | All Organisms → cellular organisms → Bacteria | 9242 | Open in IMG/M |
| 3300028819|Ga0307296_10419072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 732 | Open in IMG/M |
| 3300028824|Ga0307310_10277454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 811 | Open in IMG/M |
| 3300028828|Ga0307312_10370390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 938 | Open in IMG/M |
| 3300028828|Ga0307312_11095286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
| 3300028884|Ga0307308_10652541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
| 3300028885|Ga0307304_10370989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 642 | Open in IMG/M |
| 3300030336|Ga0247826_10810541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 734 | Open in IMG/M |
| 3300030902|Ga0308202_1073005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 669 | Open in IMG/M |
| 3300031058|Ga0308189_10265241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 655 | Open in IMG/M |
| 3300031170|Ga0307498_10286304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 611 | Open in IMG/M |
| 3300031572|Ga0318515_10343347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 801 | Open in IMG/M |
| 3300031748|Ga0318492_10443022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 686 | Open in IMG/M |
| 3300031782|Ga0318552_10606952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 558 | Open in IMG/M |
| 3300031799|Ga0318565_10646715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
| 3300031820|Ga0307473_11523152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
| 3300031893|Ga0318536_10116010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1350 | Open in IMG/M |
| 3300031938|Ga0308175_101093104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 884 | Open in IMG/M |
| 3300031939|Ga0308174_11622156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| 3300031939|Ga0308174_11631355 | Not Available | 554 | Open in IMG/M |
| 3300032074|Ga0308173_10697126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 928 | Open in IMG/M |
| 3300032075|Ga0310890_10679334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 805 | Open in IMG/M |
| 3300032075|Ga0310890_11103525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 642 | Open in IMG/M |
| 3300032126|Ga0307415_102053215 | Not Available | 557 | Open in IMG/M |
| 3300032782|Ga0335082_11143259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 645 | Open in IMG/M |
| 3300032828|Ga0335080_10828989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 954 | Open in IMG/M |
| 3300032829|Ga0335070_11970533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 526 | Open in IMG/M |
| 3300032893|Ga0335069_10489463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1428 | Open in IMG/M |
| 3300033158|Ga0335077_11629840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 613 | Open in IMG/M |
| 3300034669|Ga0314794_096880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
| 3300034817|Ga0373948_0020231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1266 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.47% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.45% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.58% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.23% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.87% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.87% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.15% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.15% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.15% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.15% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.79% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.79% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.79% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.43% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.43% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.08% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.08% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.08% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.08% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.08% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.72% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.36% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.36% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.36% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.36% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.36% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.36% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.36% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.36% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.36% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.36% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.36% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.36% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.36% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.36% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.36% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.36% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918006 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1 | Environmental | Open in IMG/M |
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300001526 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-5cm-1A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005899 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011999 | Permafrost microbial communities from Nunavut, Canada - A28_65cm_6M | Environmental | Open in IMG/M |
| 3300012001 | Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M | Environmental | Open in IMG/M |
| 3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012383 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012484 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.old.190510 | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300013831 | Permafrost microbial communities from Nunavut, Canada - A21_5cm_6M | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014827 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_18M | Environmental | Open in IMG/M |
| 3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
| 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5 | Environmental | Open in IMG/M |
| 3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
| 3300025604 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034669 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| P1_C_01793500 | 2140918006 | Soil | MRRPLLALTTLALVAPANAFARGTFDPTVEFEQHEW |
| 4MG_00932860 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | MRRALFTISLLALALPGQALARGEFDPTHEFEQHEW |
| INPhiseqgaiiFebDRAFT_1006319751 | 3300000364 | Soil | MKRAIAIATLLALSIPAPAFARGTFDPTTEFEQHDWIPIHLSPLNLS |
| JGI1027J12803_1000027712 | 3300000955 | Soil | MKRAIAIATLLALSIPAPAFARGTFDPTTEFEQHDWIPIHLGPLNLS |
| JGI10216J12902_1007846524 | 3300000956 | Soil | VKRIFVSVTLLALALPAPAFARGTFDPTTEFEQHEWIPIHLGP |
| JGI10216J12902_1047378241 | 3300000956 | Soil | MMRRALFLSATAVLLFPAAAFARGEFDPTTEFEQHEW |
| JGI10216J12902_1071563934 | 3300000956 | Soil | VKRLIGLFTTLVVLAVPAPAMAKGEFHPEEEFELHDWIPIHIGPLNLSIN |
| JGI10216J12902_1084964353 | 3300000956 | Soil | VRLRGALLTALGLALTLPAPAFARGEFDPTTEFEQHEWIPIHIGPL |
| JGI10216J12902_1112858272 | 3300000956 | Soil | VKRLLFLAATFALAFPGAAFARGKFDPTTEFEQHEWVSIH |
| JGI10216J12902_1122782582 | 3300000956 | Soil | MFVAATAALVFPTAAFARGEFDPTTEFEQHEWVSIHLGGLDLSI |
| JGI10216J12902_1154640871 | 3300000956 | Soil | MMRRALLLATTAAMIFPAAAFARGDFDPTTEFEQHEWVSIH |
| JGI10216J12902_1169802833 | 3300000956 | Soil | MKRALFVISLAALALPGSALARGDFDPTTEFEQHEW |
| F14TB_1019878874 | 3300001431 | Soil | MRRALVAIALLALALPGQALARGEFDPTEEFEQHEWVPIHI |
| A105W1_11026573 | 3300001526 | Permafrost | MKRLGILVLLALATPPTAFARGKFDPTTEFEQHEWIPIH |
| C688J35102_1198301581 | 3300002568 | Soil | MMRRALVLATTFALIGPSSAFARGEFDPTKEFEQHEWVPIHLGPLN |
| Ga0063454_1014718012 | 3300004081 | Soil | VRRALLTLSTLALLVPANAFARGEFDPTTEFEQHEWIPIHLG |
| Ga0063454_1016747282 | 3300004081 | Soil | VRLRRTLVGLSALALTLPAPAFARGEFDPTTEFEQHEWIPIHLGPLN |
| Ga0062593_1006949144 | 3300004114 | Soil | VKRALFLAATACLLFPAAGFARGKFDPTTEFEQHEWVSIHLG |
| Ga0062593_1026856541 | 3300004114 | Soil | MRRALFILATLALTVPSQAFARGEFDPTHEFELDPWVSIHIGP |
| Ga0063455_1003096531 | 3300004153 | Soil | MRRAVAIVTLAALALPSTAFARGEFDPTKEFEQHEWIPIHLGPL |
| Ga0062589_1000340784 | 3300004156 | Soil | MKRWLFVATTVALAFPTAAFARGKFDPTTEFEQHEWISIHIGGLDLSI |
| Ga0062589_1008284791 | 3300004156 | Soil | VRRLFVALAVLALATPANAFARGEFDPSEEFVQHEWIPIHLGP |
| Ga0062589_1018327072 | 3300004156 | Soil | VRRALFAVALLALTLPGQALARGDFDPTTEFEQHEWVPIHLG |
| Ga0062590_1015532821 | 3300004157 | Soil | MMRRWIFFAATAALLFPAAAFARGEFDPTTEFEQHEWIPIHL |
| Ga0063356_1032253231 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKRWLLLVATVALTFPAAAWARGEFDPTTEFEQHEWVSIHLGGLDL |
| Ga0062595_1007956841 | 3300004479 | Soil | MKRALLAASVFALALPTQAFARGEFDPTTEFEQHEWVSIHLGP |
| Ga0062595_1008419621 | 3300004479 | Soil | MKRALLTLSTLALLLPANAFARGEFDPTTEFEQHEWIPIH |
| Ga0062594_1015031243 | 3300005093 | Soil | MKRWLFVATTVALAFPTAAFARGKFDPTTEFEQHEWISIHIGGL |
| Ga0062594_1026182892 | 3300005093 | Soil | VRRLVLLLATLALVAPANAFARGDFDPTTEFEQHEWIPIHLG |
| Ga0066869_100228074 | 3300005165 | Soil | MRRALLAATMLFLALPAPAFARGEFDPTTEFEQHEWVSIHLGPL |
| Ga0066674_102171434 | 3300005166 | Soil | VRRFVLALTLAALALPSPAFARGHFDPTTEFEQHKWIPIHLGPLD |
| Ga0066674_105658061 | 3300005166 | Soil | VRARRVLVALVALSLAAPADAFARGEFDPSTEFEQHEWIPIHI |
| Ga0066680_101755364 | 3300005174 | Soil | VKRALLALTLLALAAPANAFARGSFDPTKEFELHDWVPIHIG |
| Ga0066673_106012971 | 3300005175 | Soil | VKRLLASATLLALALPAPALARGTFDPTTEFEQHEWVSIH |
| Ga0066685_106858301 | 3300005180 | Soil | MRRALAIATLLALSIPAPAFARGTFDPTTEFEQHEWIPIHL |
| Ga0066675_107311671 | 3300005187 | Soil | MRLRLFLTGALVALLAPQSALARGKFDPTTEFEQHNWIPIH |
| Ga0070676_106860401 | 3300005328 | Miscanthus Rhizosphere | MTRALLAASVFALALPTQAFARGEFDPTTEFEQHEWVSIHL |
| Ga0070683_1007194411 | 3300005329 | Corn Rhizosphere | MRLRYLFVVATLALAAPPAALARGKFDPTTEFEQHEWISIHI |
| Ga0068869_1008553331 | 3300005334 | Miscanthus Rhizosphere | MMRRVLFLSATAVLLFPAAAWARGDFDPTTEFEQHEWVSIH |
| Ga0070666_113977221 | 3300005335 | Switchgrass Rhizosphere | MMRRVLFLSATAVLLFPAAAWARGDFDPTTEFEQHEWVPIHL |
| Ga0070680_1002002174 | 3300005336 | Corn Rhizosphere | MRRLLVALSTIALLLPANAFARGEFDPTTEFEQHEWIPIHL |
| Ga0070682_1014323411 | 3300005337 | Corn Rhizosphere | MRRALVSLTMIALALPAPAFARGDFDPTTEFEQHEWVSIHLGGLNLS |
| Ga0070660_1002201301 | 3300005339 | Corn Rhizosphere | VRRVLVTLSTLALLLPANAFARGSFDPTVEFEQHEWIPIHLGPLN |
| Ga0070691_102961823 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | VRRALFLVATLALLAPSSAFARGEFDPTEEFEQHEWVPIHLG |
| Ga0070687_1006557051 | 3300005343 | Switchgrass Rhizosphere | VRRAFFLVATLALLAPSSAFARGEFDPTKEFEQHEWVPIHLG |
| Ga0070687_1015147101 | 3300005343 | Switchgrass Rhizosphere | VKRLFVGLTLLALALPSPAFARGEFDPTTEFEQHEWVSIHLGPLN |
| Ga0070692_111374131 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRALVAITTFALLAPSSAFARGDFDPTKEFEQHEWIPIHLG |
| Ga0070675_1004595551 | 3300005354 | Miscanthus Rhizosphere | MKRWLFLAATAALVFPTAAFARGKFDPTTEFEQHEWISIHIGGL |
| Ga0070674_1013778321 | 3300005356 | Miscanthus Rhizosphere | MRRAIAIATLLALSIPAPAFARGTFDPTTEFEQHDWIPIHLGPLNLSI |
| Ga0070659_1012920431 | 3300005366 | Corn Rhizosphere | VRYRLLTVALLALALPSAASARGEFDPSIEFEQHEWIPIHLG |
| Ga0070709_112374091 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VRRALVTLSTLALLLPANAFARGEFDPTTEFEQHEWIPIHLGP |
| Ga0070714_1006779934 | 3300005435 | Agricultural Soil | MRRLLVALTTLALVVPANAFARGEFDPTKEFEQHEWIPIHL |
| Ga0070701_113376632 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRWLFVATTVALAFPTAAFARGKFDPTTEFEQHEWISIHIGGLDL* |
| Ga0070705_1003972791 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MMRRVLFLSTTAVLLFPAAAWARGDFDPTTEFEQHEWVPIHLG |
| Ga0070700_1018635112 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRVLLALTTLALLAPADALARGEFDPSEEFEQHEWISIH |
| Ga0066681_104782081 | 3300005451 | Soil | MKRALAVVTLAVLSLPAPALARGKFDPTTEFEQHEWIPIH |
| Ga0070662_1013895322 | 3300005457 | Corn Rhizosphere | MKRALISVTTLALLAPASAFARGEFDPTTEFEQHDWIPIHLG |
| Ga0070681_116983432 | 3300005458 | Corn Rhizosphere | MKRALIAVTTFALLAPASAFARGDFDPTTEFEQHDWIPIH |
| Ga0068867_1005537103 | 3300005459 | Miscanthus Rhizosphere | MKRAIAIATLLALSIPAPAFARGTFDPTTEFEQHDWIPIHLGPLNLSITK |
| Ga0068867_1006110951 | 3300005459 | Miscanthus Rhizosphere | VRRLVLLLATLALVAPANAFARGDFDPTTEFEQHEWIPIHLGP |
| Ga0070707_1017476402 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VRRALVTISLLALALPGQALALGDFDPTDEFEQHEWVPIHLG |
| Ga0073909_100820961 | 3300005526 | Surface Soil | MRRALLAASLFALVLPAQAFARGSFDPTTEFEQHEWVSIH |
| Ga0073909_106552862 | 3300005526 | Surface Soil | MKRWLLIATTAALAFPTAAFARGKFDPTTEFEQHEWI |
| Ga0070741_101862956 | 3300005529 | Surface Soil | VKRAFVTSVALALLFPTAAFARGKFDPTTEFEQHEW |
| Ga0070679_1005089821 | 3300005530 | Corn Rhizosphere | MMRRALLAATMLFLTLPAPAFARGEFDPTTEFEQHEWVSIHLG |
| Ga0070679_1008518543 | 3300005530 | Corn Rhizosphere | MRLRYLFVVATLALAAPSTALARGKFDPTTEFEQHEWIPIHL |
| Ga0070679_1012533191 | 3300005530 | Corn Rhizosphere | MRRALVSLTMLALALPAPAFARGDFDPTTEFEQHEWVSIHLG |
| Ga0070684_1000372828 | 3300005535 | Corn Rhizosphere | MRRALLAISIAALALPGSALARGDFDPTTEFEQHEWVPIH |
| Ga0070696_1001716341 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRLLVSATLLALALPAPAFARGHFDPTTEFEQHEWVPIHLG |
| Ga0070704_1002187544 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRAIAIATLLALSIPAPAFARGTFDPTTEFEQHDWIPIHLGPLNLS |
| Ga0070704_1013888593 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VRRVFAVLVALALAAPANAFARGEFDPTTEFEQHEWIPIH |
| Ga0066701_104565851 | 3300005552 | Soil | MRLRPLVIALTAFALLVPANAFARGEFDPTKEFEQH |
| Ga0066707_100509411 | 3300005556 | Soil | VRRLLVALALTALALPSPAFARGHFDPTTEFEQHKWIPIHLGPL |
| Ga0066707_105018001 | 3300005556 | Soil | MKRVLLALGTLALFAPGNAFARGQFDPTTEFEQHKW |
| Ga0066698_102322261 | 3300005558 | Soil | VRRLFVSLTLLALALPSPAFARGHFDPTTEFEQHEWVSIHIGG |
| Ga0066698_106532661 | 3300005558 | Soil | MIRRLLVGVLVALAFPATAFARGEFDPTTEFEQHEWVPI |
| Ga0066670_102787034 | 3300005560 | Soil | MRLRRLVIALTTFALIAPASAFARGEFDPTKEFEQH |
| Ga0066670_107280963 | 3300005560 | Soil | MRRAVAIATLVALSLPTPALARGEFDPTKEFEQHEWIPIHLG |
| Ga0066699_101934974 | 3300005561 | Soil | MRRALIAMGTIALLLPANAFARGVFDPTTEFEQHEWIPIHLGP |
| Ga0068855_1007782801 | 3300005563 | Corn Rhizosphere | MKRWLFLASTAALVFPTAAFARGKFDPTTEFEQHEWI |
| Ga0066705_102656621 | 3300005569 | Soil | MRRALAIATLLALSIPAPAFARGTFDPTTEFEQHEWIPIHLGPL |
| Ga0066705_102823404 | 3300005569 | Soil | VRLRYLFVVATLALAVPPAAFARGKFDPTTEFEQHEW |
| Ga0066705_108469831 | 3300005569 | Soil | VRRLLTTLLLLALALPSPAFARGHFDPTTEFEQHEWVPIHLGPL |
| Ga0068854_1010651533 | 3300005578 | Corn Rhizosphere | VRRALVTLSTLALLLPANAFARGEFDPTTEFEQHEW |
| Ga0070702_1008452143 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | VKRLIVTLSTLALLLPANAFARGEFDPTTEFEQHEWIPIHLGP |
| Ga0068852_1021339241 | 3300005616 | Corn Rhizosphere | MRRLLVTLTMLALVAPANAFARGEFDPTTEFEQHEWIPIHLGPLN |
| Ga0066903_1015231981 | 3300005764 | Tropical Forest Soil | MKRWLFLAATFALAFPAAAWARGEFDPTTEFEQHEWISIHIG |
| Ga0066903_1087639892 | 3300005764 | Tropical Forest Soil | VKRLLVALTTLALVAPPAAFARGTFDPTTEFEQHEWIPIHLG |
| Ga0066903_1090218171 | 3300005764 | Tropical Forest Soil | MRLRTLLTTGALALAAPSTAFARGEFDPTTEFEQHEWVSIHLGPLNLSI |
| Ga0068862_1003360611 | 3300005844 | Switchgrass Rhizosphere | MMRRALLAATMLFLTLPAPAFARGEFDPTTEFEQHEW |
| Ga0075271_101049902 | 3300005899 | Rice Paddy Soil | VRARLVLAAVLALTFPSAALARGKFDPTTEFEQHEWVPIHLGPLN |
| Ga0066652_1000667106 | 3300006046 | Soil | VRRLLLSATLLALALPAPAFARGEFDPTTEFEQHEWIPIHL |
| Ga0066652_1004169151 | 3300006046 | Soil | MRRALFLTAAMALLFPAAAFARGEFDPTTEFEQHEWVSIHLG |
| Ga0066652_1020216642 | 3300006046 | Soil | MRVRRLLVALTTLALIAPASAFARGDFDPTTEFEQHEWVPIHL |
| Ga0075432_104997872 | 3300006058 | Populus Rhizosphere | MTRALLAASVFALALPTQAFARGEFDPTTEFEQHEWVSI |
| Ga0070715_104071901 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRALLAGSLFALTLPAQAFARGTFDPTTEFEQHEWVSIHIG |
| Ga0070712_1005271701 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLRNALLPLVGLALVVPAPAFARGEFDPTTEFEQHEWIPIHL |
| Ga0075422_101469591 | 3300006196 | Populus Rhizosphere | MKRWLFVATTVALAFPTAAFARGKFDPTTEFEQHEW |
| Ga0097621_1007515351 | 3300006237 | Miscanthus Rhizosphere | VKRLIVLVSTLALLLPANAFARGEFDPTKEFEQHEW |
| Ga0068871_1021971202 | 3300006358 | Miscanthus Rhizosphere | MRRALLGATMLFLALPAPAFARGEFDPTTEFEQHEW |
| Ga0074049_103175151 | 3300006580 | Soil | MRRALFLAATLALMAPSQAFARGEFDPTHEFELDAAF |
| Ga0074049_131713992 | 3300006580 | Soil | MKRLLFAACLFALALPAPAFARGEFDPTTEFEQHEWVPIH |
| Ga0066653_100952944 | 3300006791 | Soil | VRRLFVSLTLLALALPSPAFARGHFDPTTEFEQHEWVSIHIGGLNLSIT |
| Ga0066653_107364841 | 3300006791 | Soil | MKRALAVVTLAVLSLPAPALARGKFDPTTEFEQHE |
| Ga0066665_108723491 | 3300006796 | Soil | VRRLLVALALTALALPSPAFARGHFDPTTEFEQQK |
| Ga0079221_106585671 | 3300006804 | Agricultural Soil | MKRALIVATTFALLAPASAFARGDFDPTTEFEQHEW |
| Ga0079220_102846284 | 3300006806 | Agricultural Soil | MRRALLAATMLFLTLPAPAFARGEFDPTTEFEQHEWVSIHLGPLNLSI |
| Ga0079220_112232641 | 3300006806 | Agricultural Soil | VKRVFVSATLLALALPAPAFARGHFDPTTEFEQHEWIPIHIGGLNLS |
| Ga0075428_1014206601 | 3300006844 | Populus Rhizosphere | VKRLFVSLTLLALALPSPAFARGEFDPTTEFEQHE |
| Ga0075430_1010155143 | 3300006846 | Populus Rhizosphere | MRRALLAASVFALALPTQAFARGEFDPTTEFEQHEW |
| Ga0075434_1007187544 | 3300006871 | Populus Rhizosphere | MKRALLAASLFALVLPAQAFARGSFDPTTEFEQHEWV |
| Ga0068865_1008845841 | 3300006881 | Miscanthus Rhizosphere | MMRRVLFLSATAVLLFPAAAWARGDFDPTTEFEQHEWVPIHIGPLD |
| Ga0075426_107348311 | 3300006903 | Populus Rhizosphere | MKRLFVLVVLALAAPQAALARGKFDPSTEFEQHEWIPIHLG |
| Ga0075424_1009220491 | 3300006904 | Populus Rhizosphere | VKRALATLTLLALTLPADAFARGEFDPTDEFEQHEWIPIH |
| Ga0074063_136128793 | 3300006953 | Soil | VRRALFTISLLALALPGQALARGEFDPTKEFEQHEWVPIHLGPL |
| Ga0079219_122845651 | 3300006954 | Agricultural Soil | MRRALLGATMLFLALPAPAFARGDFDPTTEFEQHEWVSIHLGPLN |
| Ga0066710_1028427872 | 3300009012 | Grasslands Soil | VKRTLLALSVLALAAPANAFARGTFDPTTEFELKDWVPIHIGALNL |
| Ga0105245_131594551 | 3300009098 | Miscanthus Rhizosphere | VKRLLIVATLFLAFPSAALARGKFDPSTEFEQHPWISIPKIG |
| Ga0105247_103199411 | 3300009101 | Switchgrass Rhizosphere | MKRALLAASLFALVLPAQAFARGSFDPTTEFEQHEW |
| Ga0105247_108540001 | 3300009101 | Switchgrass Rhizosphere | MKRVLLAATMLFLALPAPAFARGEFDPTTEFEQHEWI |
| Ga0066709_1009447344 | 3300009137 | Grasslands Soil | MKRALAIVALAALSLPAPSFARGKFDPTTEFEQHEWIPIHLGPLN |
| Ga0105243_100963996 | 3300009148 | Miscanthus Rhizosphere | MKRAIAIATLLALSIPAPAFARGTFDPTTEFEQHDWIPIHLGPLNLSIT |
| Ga0075423_102322015 | 3300009162 | Populus Rhizosphere | MRRALLAASLFALVLPAQAFARGSFDPTTEFEQHEWIPIHIGPL |
| Ga0075423_103230944 | 3300009162 | Populus Rhizosphere | VKRWLVSLTLLALALPSPALARGHFDPTTEFEQHEWVPIHIG |
| Ga0105242_116349031 | 3300009176 | Miscanthus Rhizosphere | VRRLVLLLATLALVAPANAFARGDFDPTTEFEQHEWVSIHLGPLN |
| Ga0105238_129786852 | 3300009551 | Corn Rhizosphere | MKRALLAVTTLALIAPSAAFARGTFDPTKEFEQHDWIPI |
| Ga0105068_11001951 | 3300009836 | Groundwater Sand | VRRTLFLAATLALTAPSSAFARGEFDPTHEFEQKEWVPIHIGP |
| Ga0126309_101687581 | 3300010039 | Serpentine Soil | MKRSYVALTTLVLLFPASASAAEFDPSEEFEQHPWVPIHLGP |
| Ga0126309_111725821 | 3300010039 | Serpentine Soil | VRRALLAVTLLALALPAQALARGEFDPTDEFEQHEWVS |
| Ga0126314_108555251 | 3300010042 | Serpentine Soil | VRFRCLLIALTTVALTAPASAFARGDFDPTTEFEQHEWVPIHL |
| Ga0126314_111926591 | 3300010042 | Serpentine Soil | VRRALLALSLLALTLPSAAFARGEFDPTDEFVQHE |
| Ga0134070_101570011 | 3300010301 | Grasslands Soil | VKRLFVSLTLLALALPAPAFARGTFDPTKEFEQHE |
| Ga0134062_104462183 | 3300010337 | Grasslands Soil | MIRRVVVGLVIGLAFPTTAFARGEFDPTTEFEKHEWVPIHLGPLNLSST |
| Ga0126379_123936333 | 3300010366 | Tropical Forest Soil | VKRWLFIAATVALFFPAAAYARGEFDPTTEFEQHEWISIHL |
| Ga0134125_114410941 | 3300010371 | Terrestrial Soil | VKRLIVTFSTLALLLPANAFARGEFDPTTEFEQHEWIPIHLGPLNL |
| Ga0134127_131883932 | 3300010399 | Terrestrial Soil | MRLRYLLTIATLALLVPQAAFARGEFDPTTEFEQHEWVSIHLGPLNLSIT |
| Ga0134121_111100533 | 3300010401 | Terrestrial Soil | MRRALLGATMLFLALPAPAFARGEFDPTTEFEQHEWVSIH |
| Ga0138514_1001277081 | 3300011003 | Soil | MKRLTVLAATLALALPADAFARGEFDPSKEFEQHEWIPIHLGGLNLSVTK |
| Ga0151490_10616471 | 3300011107 | Soil | VRRALLAATMLFLALPAPAFARGEFDPTTEFEQHEW |
| Ga0137393_111515941 | 3300011271 | Vadose Zone Soil | MKRALVTLSTLALVGPANSFARGTFDPTAEFVQHEW |
| Ga0120148_10639021 | 3300011999 | Permafrost | MKRLFVSLTLVALALPAPAFARGTFDPTTEFEQKAWVSIHLGP |
| Ga0120167_10508102 | 3300012001 | Permafrost | VKRLVLTLSTVALMLPADAFARGVFDPTKEFEQHEWIPIHLGPLNLSITK |
| Ga0120118_10421544 | 3300012010 | Permafrost | MKRLFVSLTLVALALPAPAFARGTFDPTTEFEQHEWVPIH |
| Ga0137364_109894291 | 3300012198 | Vadose Zone Soil | MRRAIAIATLLALSIPAPAFARGKFDPTTEFEQHDWIPIHLGPLN |
| Ga0137374_112524572 | 3300012204 | Vadose Zone Soil | MKRLTLLLGALALATPGDALARGEFDPAREFEQHEWIPIHLGPLNLSI |
| Ga0137377_110138061 | 3300012211 | Vadose Zone Soil | MRLRYLLVVATLALAAPPAALARGKFDPTTEFEQHEWVPIHL |
| Ga0150985_1165880952 | 3300012212 | Avena Fatua Rhizosphere | MKRALTAATTLALLAPASAFARGDFDPTTEFEQHE |
| Ga0150985_1198980531 | 3300012212 | Avena Fatua Rhizosphere | VRRLIVLLSTFALLLPANAFARGEFDPTTEFEQHEWIPIHLGP |
| Ga0137366_104032644 | 3300012354 | Vadose Zone Soil | MRWRRVAVVAALALTAPPAALARGTFDPTTEFEQHEWIPIHLSPLNLSVTK |
| Ga0137384_106194233 | 3300012357 | Vadose Zone Soil | MKRVFIVAILALAAPPAALARGKFDPTTEFEQHEWIPIHLG |
| Ga0134033_12595473 | 3300012383 | Grasslands Soil | MRLRRLVIALTAFALLVPANAFARGEFDPTKEFEQ |
| Ga0134049_12134761 | 3300012403 | Grasslands Soil | MRRAIAIATLLALSIPAPAFARGKFDPTTEFEQHDWIPIH |
| Ga0150984_1203056781 | 3300012469 | Avena Fatua Rhizosphere | MRRALVSLTMLALAVPAPAFARGDFDPTTEFEQHEWVSIHLGGLN |
| Ga0157333_10124971 | 3300012484 | Soil | VRRALVTISLLALALPGQALARGEFDPTKEFEQHEWVPIHL |
| Ga0137358_110704772 | 3300012582 | Vadose Zone Soil | MRRLLIVAALALATPPAALARGKFDPTTEFEQHEWIPIHLG |
| Ga0157296_104023641 | 3300012905 | Soil | MRRLLVALTMLALAAPGNAFARGEFDPSEEFVQNEWI |
| Ga0137395_110033351 | 3300012917 | Vadose Zone Soil | MKRLMIVAILALATPPAALARGKFDPTTEFQQHEWIPIHLGP |
| Ga0137359_109005561 | 3300012923 | Vadose Zone Soil | MRRLLIVAALALATPPAALARGKFDPTTEFEQHEWIPIHL |
| Ga0137419_116165782 | 3300012925 | Vadose Zone Soil | MRLRYLLVVATLALAAPPAAFARGKFDPTTEFEQHEWV |
| Ga0137419_118765812 | 3300012925 | Vadose Zone Soil | VKRALTTLSFVTPCTLALLLPANAFARGAFDPTKEFEQHEWIPIHFGPLNMSIT |
| Ga0137407_123376521 | 3300012930 | Vadose Zone Soil | MRRFLIVATLALAAPPAALARGKFDPTTEFEQHEWVS |
| Ga0164298_100890035 | 3300012955 | Soil | MKRWLLIATTAALAFPTAAFARGKFDPTTEFEQHEWISIH |
| Ga0164303_106494023 | 3300012957 | Soil | MKRLLLVATLALVAPPAALARGTFDPTTEFEQHEWVPI |
| Ga0164303_110240591 | 3300012957 | Soil | MMRALAIVTLAALSLPSAAFARGEFDPTKEFEQHEWIPIHLG |
| Ga0134087_102365973 | 3300012977 | Grasslands Soil | MRRAVAIATLLALSIPAPAFARGKFDPTTEFEQHNWIP |
| Ga0164309_100307731 | 3300012984 | Soil | MRRALAIATLLALSIPAPAFARGTFDPTTEFEQHEWIPIHLGPLN |
| Ga0164309_112902193 | 3300012984 | Soil | MKRAIAIATLLALSIPAPAFARGTFDPTTEFEQHDWIPIHLGPL |
| Ga0164308_110279713 | 3300012985 | Soil | VKRVLLTLSTLALLLPANAFARGSFDPTTEFEQHEWIPIHLGPLN |
| Ga0164307_117937231 | 3300012987 | Soil | MKRALILLSTVALLLPAIAFARGEFDPTTEFEQHEWIPIHLG |
| Ga0164306_102550154 | 3300012988 | Soil | MMRRALFLSATAVLLFPAAAWARGDFDPTTEFEQHEWV |
| Ga0164306_103311561 | 3300012988 | Soil | MRRALLAATMLFLALPTPAFARGEFDPTTEFEQHEWVSIH |
| Ga0164305_101597591 | 3300012989 | Soil | MRLRYLFVVATLALAAPPAALARGKFDPTTEFEQHEWIP |
| Ga0164305_103547224 | 3300012989 | Soil | MRRALLAATMLFLTLPAPAFARGEFDPTTEFEQHEWIPIHLGPL |
| Ga0164305_107741541 | 3300012989 | Soil | MRRALLAATMLFLALPAPAFARGEFDPTTEFEQHEW |
| Ga0157372_104868754 | 3300013307 | Corn Rhizosphere | MRRALLAATMIFLTLPAPACARGEFDPTTEFEQHEWVSIHLGP |
| Ga0157375_114564363 | 3300013308 | Miscanthus Rhizosphere | MKRVLLAATMLFLALPAPAFARGEFDPTTEFEQHDWVSIHLG |
| Ga0157375_125029681 | 3300013308 | Miscanthus Rhizosphere | VRRFLLALVTLALVAPTNAFARGDFDPTTEFEQHEWI |
| Ga0120123_10205074 | 3300013770 | Permafrost | VKRALIFLSSAALLLPANAFARGEFDPTKEFEQHEWVPIHLG |
| Ga0120158_100323021 | 3300013772 | Permafrost | VKRWLIALSTVALLLPANAFARGTFDPTKEFEQHEWIPI |
| Ga0120126_10209433 | 3300013831 | Permafrost | MRRLLLLLGTLALVLPANAFARGEFDPAKEFEQHEWIPIHLGPL |
| Ga0134081_102905972 | 3300014150 | Grasslands Soil | MKRAHAIVALAALSLPAPSIARGKFDPTTEFEQHEWIPIHLGPLNMSIT |
| Ga0182008_109194251 | 3300014497 | Rhizosphere | MRRTLLLAFTLALLAPSSAFARGEFDPTKEFEQHEWIP |
| Ga0120171_10026851 | 3300014827 | Permafrost | VKRLFVSLTLVALALPAPAFARGTFDPTTEFEQKAW |
| Ga0120104_10152061 | 3300014829 | Permafrost | VRRALVFLSTVALLLPANAFARGVFDPTKEFEQHEWIPIHLG |
| Ga0137405_12620751 | 3300015053 | Vadose Zone Soil | MRRAIAIATLLALSIPAPAFARGKFDPTTEFEQHDWIPIHLGPL |
| Ga0173483_100092411 | 3300015077 | Soil | VRRALFAVALLALTLPGQALARGDFDPTTEFEQHEWVPIHLGP |
| Ga0182007_104261481 | 3300015262 | Rhizosphere | MRTRLTTIVLLALALPAPAYARGHFDPTTEFEQHEWIPIHLGP |
| Ga0132258_1002689721 | 3300015371 | Arabidopsis Rhizosphere | VKYRLLTVALLALVFPSTAFARGHFDPTTEFEQHEWVPIHLGPHNLSI |
| Ga0132258_134967461 | 3300015371 | Arabidopsis Rhizosphere | VRRLLLAVTTLALVAPANAFARGEFDPTTEFEQHEWIPI |
| Ga0132256_1030163732 | 3300015372 | Arabidopsis Rhizosphere | VKRLIVTLSTLALLLPANAFARGEFDPTTEFEQHEWI |
| Ga0132257_1029865311 | 3300015373 | Arabidopsis Rhizosphere | MRRWIFVAATIALVFPAAAFARGEFDPTTEFEQHEWISIHI |
| Ga0132255_1003208455 | 3300015374 | Arabidopsis Rhizosphere | MKRALLAASLFALTLPAQAFARGTFDPTTEFEQHE |
| Ga0132255_1047150771 | 3300015374 | Arabidopsis Rhizosphere | VRRLIPFLATLALVAPANAFARGDFDPTTEFEQHEWVPIHL |
| Ga0187786_102310533 | 3300017944 | Tropical Peatland | MRLRVLLTTLVLALVVPPGAFARGSFDPTTEFEQKEWVPI |
| Ga0187785_107241572 | 3300017947 | Tropical Peatland | MRLRILLTTLVLALVVPPGAFARGSFDPTTEFEQKEWVPIHL |
| Ga0187780_110730143 | 3300017973 | Tropical Peatland | VKRLLVVATLFLAAPQAAFARGTFDPTKEFEQHAWVPIHLGG |
| Ga0184605_105145722 | 3300018027 | Groundwater Sediment | MKRAIFLLATFALIAPGQAFARGEFDPTEEFELHEWIPIHI |
| Ga0184619_101310754 | 3300018061 | Groundwater Sediment | MRRLFTTAVLLALALPSAASARGKFDPTTEFEQHEWISIHLG |
| Ga0184619_102329731 | 3300018061 | Groundwater Sediment | VKRLLLLLTTVALAAPANAFARGEFDPTVEFEQHEWVPIHLGPLNL |
| Ga0184617_10787973 | 3300018066 | Groundwater Sediment | MKRLTVLAATLALALPADAFARGEFDPSKEFEQHE |
| Ga0184640_101396391 | 3300018074 | Groundwater Sediment | VRRVLFTISLLALALPGQAFARGDFDPTQEFEQHEWVP |
| Ga0066667_109940381 | 3300018433 | Grasslands Soil | MRRAFAIVTLLALSLPAPALARGKFDPTKEFEQHEWIPIHLGPLN |
| Ga0206355_15889621 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRLLLLGFTIALLAPSSAFARGSFDPTHEFEQREWIPIHLGP |
| Ga0154015_11592142 | 3300020610 | Corn, Switchgrass And Miscanthus Rhizosphere | VKRVIVMVSTLALLLPANAFARGEFDPTKEFEQHEWIPIHLGPINL |
| Ga0193719_100583501 | 3300021344 | Soil | MKRAIAIATLLALSIPTPAFARGTFDPTTEFEQHDWIPIHLGP |
| Ga0193695_10951441 | 3300021418 | Soil | MRMRRFLIVATLALAAPPAALARGKFDPTTEFEQHEWVS |
| Ga0224712_102554653 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRLLLLGFTIALLAPSSAFARGSFDPTHEFEQREWIPIHLG |
| Ga0222622_100222031 | 3300022756 | Groundwater Sediment | VRRALVSLTMLALALPAPAFARGDFDPTTEFEQHEWVSIHLAGLN |
| Ga0247745_10311223 | 3300022898 | Soil | MKRALLAASVFALALPTQAFARGEFDPTTEFEQHEWV |
| Ga0247671_10613472 | 3300024284 | Soil | MKRALLAASLFALVLPAQAFARGSFDPTTEFEQHEWVSIHVLGLNLSI |
| Ga0207930_11469781 | 3300025604 | Arctic Peat Soil | MKRLGILVLLALASPPAALARGKFDPTTEFEQHEWIPIHLGP |
| Ga0207654_107522253 | 3300025911 | Corn Rhizosphere | VRRAFVTLSTLALLLPANAFARGEFDPTTEFEQHE |
| Ga0207695_117334032 | 3300025913 | Corn Rhizosphere | VKRLLVALAALALLLPGNAFARGDFDPTDEFVQNDWIPIHLGP |
| Ga0207693_101865501 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTVAMKRLGILIVLALAVPQAASARGTFDPTTEFEQHEWIPIHLGPLNLS |
| Ga0207693_109349301 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRFLIVVTLALAAPPAALARGKFDPTTEFEQHEWIPIHLGPLNLSI |
| Ga0207657_104162201 | 3300025919 | Corn Rhizosphere | VKRALFAVALLALTLPSQALARGDFDPTDEFEQHEWV |
| Ga0207646_116474691 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VRRLLVALTTLALVAPPNAFARGEFDPTTEFEQHEWVPIHLG |
| Ga0207681_106505383 | 3300025923 | Switchgrass Rhizosphere | VKRALFAVALLALTLPSQALARGDFDPTDEFEQHEWVPIH |
| Ga0207694_116767851 | 3300025924 | Corn Rhizosphere | MKRALLAVTTLALIAPSAAFARGTFDPTKEFEQHEWVSIH |
| Ga0207700_120170142 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VTVRRALLALSVFALLLPANAFARGEFDPTKEFEQKEW |
| Ga0207706_100195459 | 3300025933 | Corn Rhizosphere | MRRALVSLTMLALALPAPAFARGDFDPTTEFEQHEWVSIHLGGLNLSI |
| Ga0207686_107809163 | 3300025934 | Miscanthus Rhizosphere | MRRALLAATMLFLALPAPAFARGEFDPTTEFEQHEWVSIHLG |
| Ga0207665_100273097 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VRRRLFPLALALTALALPSPAFARGHFDPTTEFEQHKWIPIH |
| Ga0207679_103464204 | 3300025945 | Corn Rhizosphere | VKRALFAVALLALTLPSQALARGDFDPTDEFEQHEWVPIHLG |
| Ga0207667_102673195 | 3300025949 | Corn Rhizosphere | MRLRYLLTIATLALLVPQAAFARGEFDPTTEFEQHEWVPIHLGPL |
| Ga0207640_105020471 | 3300025981 | Corn Rhizosphere | MRRALVSLTMLALALPAPAFARGDFDPTTEFEQHEWVSIH |
| Ga0207677_105024824 | 3300026023 | Miscanthus Rhizosphere | MMRRVLFLSATAVLLFPAAAWARGDFDPTTEFEQHEWVPIHLGSLNLSITK |
| Ga0207677_107055381 | 3300026023 | Miscanthus Rhizosphere | VKRLIVTLSTLALLLPANAFARGEFDPTTEFEQHEW |
| Ga0207639_118783141 | 3300026041 | Corn Rhizosphere | MRLRYLFVVATLALAAPSTALARGKFDPTTEFEQHEWI |
| Ga0207639_122267811 | 3300026041 | Corn Rhizosphere | VTRLRLVLLTALFALTVPSVAMARGEFDPTTEFEQHEWISI |
| Ga0207702_114028011 | 3300026078 | Corn Rhizosphere | VKRVIVMVSTLALLLPANAFARGEFDPTKEFEQHEWIPIHLG |
| Ga0207676_124289582 | 3300026095 | Switchgrass Rhizosphere | VKRVIVMVSTLALLLPANAFARGEFDPTKEFEQHEWIPIHLGP |
| Ga0207674_111705193 | 3300026116 | Corn Rhizosphere | MKRWLFLAATAALVFPTAAFARGKFDPTTEFEQHEWISI |
| Ga0207675_1011355441 | 3300026118 | Switchgrass Rhizosphere | MKRWLFVATTVALAFPTAAFARGKFDPTTEFEQHEWISIHIGGLDL |
| Ga0207683_104748441 | 3300026121 | Miscanthus Rhizosphere | MMRRVLFLSATAVLLFPAAAWARGDFDPTTEFEQHEWIPIHLGSLNLSI |
| Ga0207698_110650583 | 3300026142 | Corn Rhizosphere | MMRRVLFLSATAVLLFPAAAWARGDFDPTTEFEQH |
| Ga0209234_11649431 | 3300026295 | Grasslands Soil | VRRLFVSLTLLALALPSPAFARGHFDPTTEFEQHE |
| Ga0209027_10843721 | 3300026300 | Grasslands Soil | VKRVLVSATLIALALPSTAFARGKFDPTTEFEQHEWIPIHL |
| Ga0209687_11206393 | 3300026322 | Soil | VRLRYLFVVATLALAVPPAAFARGKFDPTTEFEQHEWVP |
| Ga0209056_101059321 | 3300026538 | Soil | VRRLLVALALTALALPSPAFARGHFDPTTEFEQHKWIPIHLGPLDL |
| Ga0209811_103153161 | 3300027821 | Surface Soil | MRRLLLALTTFALVAPAGAFARGDFDPTTEFEQHEWI |
| Ga0209060_103548263 | 3300027826 | Surface Soil | VRRALLALSVFALLLPANAFARGQFDPTKEFEQKEWVPIHL |
| Ga0209590_103544111 | 3300027882 | Vadose Zone Soil | VKRLLLLLTTLALVAPANAFARGEFDPTTEFEQHEWVPIHLGALNLS |
| Ga0307322_100584751 | 3300028710 | Soil | VKRLLVSLALFALALPSSAFARGTFDPTTEFEQHEWVSIHLGPL |
| Ga0307315_100782813 | 3300028721 | Soil | VRRLLLAVTTLALVAPANAFARGEFDPTKEFEQHEWIPIHLGVLNLSI |
| Ga0307297_101045854 | 3300028754 | Soil | MRRMLLAATMLFLALPAPAFARGDFDPTTEFEQHE |
| Ga0307323_103268681 | 3300028787 | Soil | MKRVLVTITTLALLAPANAFARGDFDPTTEFEQHKWVKIEL |
| Ga0307305_104138381 | 3300028807 | Soil | MKRWLFLASTAALVFPTAAFARGKFDPTTEFEQHEWISIHIGGLDLSI |
| Ga0307302_1000187414 | 3300028814 | Soil | VRRALCGVILGAVWLLALPAQALARGSFDPTTEFEQHEWIPIHIAGL |
| Ga0307296_104190723 | 3300028819 | Soil | VRRLLLAVTTLALVAPANAFARGEFDPTTEFEQHEW |
| Ga0307310_102774543 | 3300028824 | Soil | MRLRYLLVVATLALAAPPAALARGKFDPTTEFEQHEWVPIHLGPLNLS |
| Ga0307312_103703903 | 3300028828 | Soil | MKRAIAIATLLALSIPTPAFARGTFDPTTEFEQHDWIPIHLGPL |
| Ga0307312_110952861 | 3300028828 | Soil | MKRMLVALSTIALLLPANAFARGEFDPTTEFEQHEWIPIHLGPI |
| Ga0307308_106525411 | 3300028884 | Soil | MRMRRFLIVATLALAAPPAALARGKFDPTTEFEQHEWVSIH |
| Ga0307304_103709891 | 3300028885 | Soil | VKRLLAGAILFALTMPAPAFARGTFDPTTEFEQHEWIPI |
| Ga0247826_108105413 | 3300030336 | Soil | MRRWIFVAATIALVFPVAAFARGEFDPTTEFEQHE |
| Ga0308202_10730051 | 3300030902 | Soil | MKRAIAIATLLALSIPAPAFARGTFDPTTEFEQHDWIPIHL |
| Ga0308189_102652413 | 3300031058 | Soil | VKRLLVSLALFALALPSSAFARGTFDPTTEFEQHEWVSIHLGPLNLSI |
| Ga0307498_102863041 | 3300031170 | Soil | MRRALLALTMLFLALPAPAFARGEFDPTTEFEQHEWVSIHLGPLNLS |
| Ga0318515_103433471 | 3300031572 | Soil | VRRALLALTTVALLLPANAFARGSFDPTKEFEQKEWVPIHI |
| Ga0318492_104430221 | 3300031748 | Soil | VKRLVVAFATLALLAPANAFARGEFDPSKEFEQHTWIPIH |
| Ga0318552_106069522 | 3300031782 | Soil | VRRALLALTTVALLLPANAFARGSFDPTKEFEQKEWVPIH |
| Ga0318565_106467151 | 3300031799 | Soil | VKRLVVAFATLALLAPANAFARGEFDPSKEFEQHTWIP |
| Ga0307473_115231521 | 3300031820 | Hardwood Forest Soil | VKRLFVGLTLLALALPAPAFARGTFDPTTEFEQHEWIPIHLGPLNL |
| Ga0318536_101160104 | 3300031893 | Soil | VRRALLALTTVALLLPANAFARGSFDPTKEFEQKEWDPIHIGPLNLSI |
| Ga0308175_1010931041 | 3300031938 | Soil | VKTRLITVALLALTFPSAAFARGSFDPTVEFEQHEWIPI |
| Ga0308174_116221561 | 3300031939 | Soil | MRLRYLFVVATLALAAPSTALARGKFDPTTEFEQHEWIPIHLGP |
| Ga0308174_116313552 | 3300031939 | Soil | VKTRLTTALFLLLAFPSTAFARGDFDPTVEFEQHEWIPIHLGPLNLS |
| Ga0308173_106971261 | 3300032074 | Soil | MRRALLAATMLFLALPAPAFARGDFDPTTEFEQHEWV |
| Ga0310890_106793341 | 3300032075 | Soil | MKRALLAASLFALVLPAQAFARGSFDPTTEFEQHEWVSIHVLG |
| Ga0310890_111035251 | 3300032075 | Soil | MKRWLFVATTVALAFPTAAFARGKFDPTTEFEQHEWIS |
| Ga0307415_1020532151 | 3300032126 | Rhizosphere | VRKALFLVATLALLAPSSAFARGEFDPTHEFEQKEWVPIH |
| Ga0335082_111432591 | 3300032782 | Soil | VRRALAALGTLALLLPANAFARGEFDPTKEFEQKE |
| Ga0335080_108289891 | 3300032828 | Soil | LTLRRAFVLVSTFALLLPGSAFAGTSFDPTTEFEQHAWVPIHIFGLDL |
| Ga0335070_119705331 | 3300032829 | Soil | MRLRVLLTTLALALVVPPAAFARGSFDPTAEFEQKEWVPIHLGPLN |
| Ga0335069_104894631 | 3300032893 | Soil | LTLRRAFVLVSTFALLLPGSAFASTSFDPTTEFEQHAWVPIHIFGLDL |
| Ga0335077_116298403 | 3300033158 | Soil | MKRALAALATLALLVPANAFARGSFDPTKEFEQREWV |
| Ga0314794_096880_509_625 | 3300034669 | Soil | MRRALLAASVFALALPTQAFARGEFDPTTEFEQHEWIPI |
| Ga0373948_0020231_1126_1266 | 3300034817 | Rhizosphere Soil | MRRALLAASLFALVLPAQAFARGSFDPTTEFEQHEWVSIHVLGLNLS |
| ⦗Top⦘ |