| Basic Information | |
|---|---|
| Family ID | F012616 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 279 |
| Average Sequence Length | 44 residues |
| Representative Sequence | FGTGFPDWETGSVLAIFLLGVVAVLTIVFSRFLQPRQVAAD |
| Number of Associated Samples | 219 |
| Number of Associated Scaffolds | 279 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.73 % |
| % of genes near scaffold ends (potentially truncated) | 97.85 % |
| % of genes from short scaffolds (< 2000 bps) | 93.91 % |
| Associated GOLD sequencing projects | 200 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.566 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (14.695 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.448 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.971 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.68% β-sheet: 0.00% Coil/Unstructured: 62.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 279 Family Scaffolds |
|---|---|---|
| PF00528 | BPD_transp_1 | 48.39 |
| PF08402 | TOBE_2 | 5.38 |
| PF13594 | Obsolete Pfam Family | 0.72 |
| PF01329 | Pterin_4a | 0.72 |
| PF03928 | HbpS-like | 0.72 |
| PF03631 | Virul_fac_BrkB | 0.36 |
| PF02852 | Pyr_redox_dim | 0.36 |
| PF00348 | polyprenyl_synt | 0.36 |
| PF06011 | TRP | 0.36 |
| PF05977 | MFS_3 | 0.36 |
| PF07969 | Amidohydro_3 | 0.36 |
| COG ID | Name | Functional Category | % Frequency in 279 Family Scaffolds |
|---|---|---|---|
| COG2154 | Pterin-4a-carbinolamine dehydratase | Coenzyme transport and metabolism [H] | 0.72 |
| COG0142 | Geranylgeranyl pyrophosphate synthase | Coenzyme transport and metabolism [H] | 0.36 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.36 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.36 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.57 % |
| Unclassified | root | N/A | 1.43 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725003|GPWSG_F5G3JLY01EAR1B | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 2170459005|F1BAP7Q02H41OY | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101327635 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104788025 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300000881|JGI10215J12807_1083974 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300000891|JGI10214J12806_12348152 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300000956|JGI10216J12902_112424588 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300001205|C688J13580_1034554 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300001305|C688J14111_10249483 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300001686|C688J18823_10300995 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300001991|JGI24743J22301_10052623 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300002070|JGI24750J21931_1015701 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300002568|C688J35102_119493317 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300004081|Ga0063454_101967811 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300004153|Ga0063455_101221419 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300004479|Ga0062595_100528360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 896 | Open in IMG/M |
| 3300004479|Ga0062595_100978300 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300005164|Ga0066815_10098910 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300005174|Ga0066680_10505721 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300005177|Ga0066690_10822822 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300005178|Ga0066688_10498695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 784 | Open in IMG/M |
| 3300005178|Ga0066688_10856960 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300005178|Ga0066688_10941925 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005179|Ga0066684_10127777 | All Organisms → cellular organisms → Bacteria | 1590 | Open in IMG/M |
| 3300005179|Ga0066684_10153809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1461 | Open in IMG/M |
| 3300005179|Ga0066684_10391985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 932 | Open in IMG/M |
| 3300005181|Ga0066678_10631419 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300005181|Ga0066678_11100740 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300005184|Ga0066671_10817469 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300005332|Ga0066388_100906721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1459 | Open in IMG/M |
| 3300005332|Ga0066388_102241523 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300005355|Ga0070671_100964623 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300005434|Ga0070709_11162987 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005435|Ga0070714_100403991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1292 | Open in IMG/M |
| 3300005435|Ga0070714_100691457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 984 | Open in IMG/M |
| 3300005435|Ga0070714_101116509 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300005435|Ga0070714_102423659 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300005436|Ga0070713_100171321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1945 | Open in IMG/M |
| 3300005436|Ga0070713_101994512 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300005444|Ga0070694_100102533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2026 | Open in IMG/M |
| 3300005445|Ga0070708_101876901 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300005459|Ga0068867_100523384 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300005467|Ga0070706_100362315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1351 | Open in IMG/M |
| 3300005471|Ga0070698_100380535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1344 | Open in IMG/M |
| 3300005471|Ga0070698_100529556 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300005471|Ga0070698_101819017 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300005526|Ga0073909_10220493 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300005526|Ga0073909_10450310 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300005530|Ga0070679_101220628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 697 | Open in IMG/M |
| 3300005530|Ga0070679_102025284 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300005535|Ga0070684_102283412 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300005536|Ga0070697_101179849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 682 | Open in IMG/M |
| 3300005538|Ga0070731_10326773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 1019 | Open in IMG/M |
| 3300005540|Ga0066697_10168483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1298 | Open in IMG/M |
| 3300005549|Ga0070704_101372054 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300005549|Ga0070704_101489883 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300005552|Ga0066701_10592917 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300005553|Ga0066695_10491495 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300005558|Ga0066698_10742781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 642 | Open in IMG/M |
| 3300005559|Ga0066700_10950913 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300005560|Ga0066670_10977490 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300005566|Ga0066693_10196113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 781 | Open in IMG/M |
| 3300005566|Ga0066693_10314867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 627 | Open in IMG/M |
| 3300005568|Ga0066703_10769942 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300005569|Ga0066705_10002373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7234 | Open in IMG/M |
| 3300005569|Ga0066705_10490656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 769 | Open in IMG/M |
| 3300005569|Ga0066705_10565124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 703 | Open in IMG/M |
| 3300005575|Ga0066702_10508162 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300005587|Ga0066654_10381454 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300005587|Ga0066654_10866838 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300005614|Ga0068856_100762494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 987 | Open in IMG/M |
| 3300005718|Ga0068866_10596414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 745 | Open in IMG/M |
| 3300005718|Ga0068866_11098555 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300005764|Ga0066903_100516728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2031 | Open in IMG/M |
| 3300005764|Ga0066903_101891149 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300005764|Ga0066903_106068938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 632 | Open in IMG/M |
| 3300006032|Ga0066696_10069939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2030 | Open in IMG/M |
| 3300006032|Ga0066696_10748165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 626 | Open in IMG/M |
| 3300006034|Ga0066656_10414473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 873 | Open in IMG/M |
| 3300006046|Ga0066652_100989967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 799 | Open in IMG/M |
| 3300006049|Ga0075417_10183491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 985 | Open in IMG/M |
| 3300006172|Ga0075018_10663143 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300006173|Ga0070716_101194800 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300006175|Ga0070712_100436090 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300006237|Ga0097621_100804739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 871 | Open in IMG/M |
| 3300006358|Ga0068871_100571268 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300006576|Ga0074047_11797343 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300006604|Ga0074060_12064302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 910 | Open in IMG/M |
| 3300006797|Ga0066659_11705040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
| 3300006806|Ga0079220_11050011 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300006806|Ga0079220_11929856 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300006845|Ga0075421_100412101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1620 | Open in IMG/M |
| 3300006852|Ga0075433_10325114 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300006854|Ga0075425_101066136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 921 | Open in IMG/M |
| 3300006854|Ga0075425_102975336 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300006903|Ga0075426_11022686 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300006954|Ga0079219_11991814 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300009012|Ga0066710_102697566 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300009012|Ga0066710_102699737 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300009012|Ga0066710_104191178 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300009088|Ga0099830_10300226 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300009090|Ga0099827_10675273 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300009090|Ga0099827_11380083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 613 | Open in IMG/M |
| 3300009093|Ga0105240_10891564 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300009098|Ga0105245_10838840 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300009098|Ga0105245_12901303 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300009101|Ga0105247_10219221 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300009137|Ga0066709_101397561 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300009143|Ga0099792_10818080 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300009162|Ga0075423_11062390 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300009174|Ga0105241_11052243 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300009174|Ga0105241_11060773 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300009176|Ga0105242_11652997 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300009177|Ga0105248_10929003 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300009545|Ga0105237_12355293 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300009551|Ga0105238_12520563 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300010047|Ga0126382_10558712 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300010048|Ga0126373_12366947 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300010301|Ga0134070_10125424 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300010303|Ga0134082_10468031 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300010320|Ga0134109_10248389 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300010323|Ga0134086_10293831 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300010335|Ga0134063_10516278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 600 | Open in IMG/M |
| 3300010335|Ga0134063_10623944 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300010358|Ga0126370_11574224 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300010361|Ga0126378_11900440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 678 | Open in IMG/M |
| 3300010364|Ga0134066_10144613 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300010371|Ga0134125_10596372 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300010371|Ga0134125_13060803 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300010373|Ga0134128_10594300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1232 | Open in IMG/M |
| 3300010375|Ga0105239_10801869 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300010376|Ga0126381_101919384 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300010376|Ga0126381_105129437 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300010379|Ga0136449_101775406 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300010396|Ga0134126_11072190 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300010398|Ga0126383_11370848 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300010398|Ga0126383_13455506 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300010880|Ga0126350_10140763 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300010880|Ga0126350_10407459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 718 | Open in IMG/M |
| 3300011271|Ga0137393_11191171 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300012008|Ga0120174_1148680 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 550 | Open in IMG/M |
| 3300012014|Ga0120159_1056960 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300012019|Ga0120139_1066964 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300012199|Ga0137383_10467483 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300012199|Ga0137383_10850248 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300012202|Ga0137363_11627258 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300012203|Ga0137399_11437624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
| 3300012206|Ga0137380_10209280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1767 | Open in IMG/M |
| 3300012206|Ga0137380_10642159 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300012206|Ga0137380_11094628 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300012208|Ga0137376_11578942 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300012211|Ga0137377_10181812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2019 | Open in IMG/M |
| 3300012211|Ga0137377_11845652 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300012354|Ga0137366_10429240 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300012354|Ga0137366_11030178 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300012356|Ga0137371_10862451 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300012362|Ga0137361_10150310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2080 | Open in IMG/M |
| 3300012582|Ga0137358_10452768 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300012883|Ga0157281_1070116 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300012891|Ga0157305_10204405 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300012893|Ga0157284_10344891 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300012897|Ga0157285_10209109 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300012901|Ga0157288_10278300 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300012907|Ga0157283_10423914 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300012927|Ga0137416_11009848 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300012929|Ga0137404_10109342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2242 | Open in IMG/M |
| 3300012951|Ga0164300_10023076 | All Organisms → cellular organisms → Bacteria | 2184 | Open in IMG/M |
| 3300012955|Ga0164298_10365511 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300012957|Ga0164303_11002849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 594 | Open in IMG/M |
| 3300012958|Ga0164299_10622483 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300012960|Ga0164301_11256791 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300012971|Ga0126369_10394339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1420 | Open in IMG/M |
| 3300012986|Ga0164304_10163697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1415 | Open in IMG/M |
| 3300012986|Ga0164304_10567667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 841 | Open in IMG/M |
| 3300012989|Ga0164305_10372893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1083 | Open in IMG/M |
| 3300012989|Ga0164305_10660647 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300012989|Ga0164305_11871880 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300013100|Ga0157373_10099253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2049 | Open in IMG/M |
| 3300013102|Ga0157371_10173526 | All Organisms → cellular organisms → Bacteria | 1541 | Open in IMG/M |
| 3300013105|Ga0157369_11733315 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300013297|Ga0157378_10261765 | All Organisms → cellular organisms → Bacteria | 1660 | Open in IMG/M |
| 3300013765|Ga0120172_1040257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1246 | Open in IMG/M |
| 3300013770|Ga0120123_1056035 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300014056|Ga0120125_1131181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 602 | Open in IMG/M |
| 3300014058|Ga0120149_1176747 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300014324|Ga0075352_1263604 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300014969|Ga0157376_11734109 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300015078|Ga0167660_1026859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → unclassified Ramlibacter → Ramlibacter sp. Leaf400 | 635 | Open in IMG/M |
| 3300015358|Ga0134089_10265945 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300015372|Ga0132256_100736033 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300015372|Ga0132256_102573349 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300015373|Ga0132257_102499740 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300015374|Ga0132255_101565842 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300015374|Ga0132255_104557165 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300016294|Ga0182041_11808655 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300016357|Ga0182032_12068509 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300017656|Ga0134112_10400503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
| 3300017659|Ga0134083_10434549 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300017944|Ga0187786_10103157 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300017944|Ga0187786_10448396 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300017947|Ga0187785_10772704 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300017959|Ga0187779_10997889 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300017961|Ga0187778_10244048 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300017966|Ga0187776_10243849 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300018029|Ga0187787_10134391 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300018089|Ga0187774_11007064 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300018431|Ga0066655_11317977 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300018433|Ga0066667_12185696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
| 3300018468|Ga0066662_10608449 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300018468|Ga0066662_10700313 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300018482|Ga0066669_10156649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1684 | Open in IMG/M |
| 3300018482|Ga0066669_11811676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
| 3300021363|Ga0193699_10102504 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
| 3300022886|Ga0247746_1177281 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300024288|Ga0179589_10560657 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300024323|Ga0247666_1034854 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300025318|Ga0209519_10041479 | All Organisms → cellular organisms → Bacteria | 2581 | Open in IMG/M |
| 3300025906|Ga0207699_10171505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 1452 | Open in IMG/M |
| 3300025909|Ga0207705_11325288 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300025912|Ga0207707_11248177 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300025914|Ga0207671_10281467 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300025915|Ga0207693_10721152 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300025915|Ga0207693_11435173 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300025915|Ga0207693_11462443 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300025916|Ga0207663_11247559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 599 | Open in IMG/M |
| 3300025921|Ga0207652_10146581 | All Organisms → cellular organisms → Bacteria | 2113 | Open in IMG/M |
| 3300025925|Ga0207650_10319096 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
| 3300025927|Ga0207687_10560264 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300025928|Ga0207700_11581086 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300025928|Ga0207700_11959062 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300025929|Ga0207664_11775133 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300025938|Ga0207704_10350750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1149 | Open in IMG/M |
| 3300025939|Ga0207665_10795242 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300025939|Ga0207665_11132889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 624 | Open in IMG/M |
| 3300025940|Ga0207691_11330166 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300025949|Ga0207667_10875636 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300025981|Ga0207640_10266828 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
| 3300025981|Ga0207640_10378251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1146 | Open in IMG/M |
| 3300026075|Ga0207708_10519045 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300026121|Ga0207683_10699753 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300026305|Ga0209688_1080105 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300026326|Ga0209801_1044376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2045 | Open in IMG/M |
| 3300026330|Ga0209473_1201625 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300026552|Ga0209577_10502179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 806 | Open in IMG/M |
| 3300027857|Ga0209166_10644047 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300027869|Ga0209579_10093585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1592 | Open in IMG/M |
| (restricted) 3300027995|Ga0233418_10307352 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300030336|Ga0247826_11363250 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300030511|Ga0268241_10129573 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300031184|Ga0307499_10263706 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300031226|Ga0307497_10069092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1296 | Open in IMG/M |
| 3300031544|Ga0318534_10442030 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300031544|Ga0318534_10460816 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300031640|Ga0318555_10243952 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300031668|Ga0318542_10230086 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300031740|Ga0307468_100448920 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300031744|Ga0306918_11054860 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300031754|Ga0307475_10791805 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300031779|Ga0318566_10062212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1792 | Open in IMG/M |
| 3300031798|Ga0318523_10591822 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300031819|Ga0318568_10711196 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300031831|Ga0318564_10456944 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300031896|Ga0318551_10187389 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300031910|Ga0306923_10511605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1357 | Open in IMG/M |
| 3300031912|Ga0306921_11025484 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300031938|Ga0308175_100170248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2112 | Open in IMG/M |
| 3300031938|Ga0308175_102883420 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300031954|Ga0306926_12357899 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300032008|Ga0318562_10205587 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300032013|Ga0310906_10177261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1272 | Open in IMG/M |
| 3300032025|Ga0318507_10216492 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300032066|Ga0318514_10607514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 582 | Open in IMG/M |
| 3300032160|Ga0311301_11736536 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300032180|Ga0307471_101780086 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300032342|Ga0315286_11322448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 699 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 14.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.58% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.58% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.23% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.15% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.15% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.15% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.51% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.79% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.79% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.79% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.79% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.43% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.08% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.08% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.08% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.08% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.72% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.72% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.36% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.36% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.36% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.36% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.36% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.36% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.36% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.36% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725003 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001205 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
| 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Host-Associated | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012008 | Permafrost microbial communities from Nunavut, Canada - A39_80cm_12M | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 | Environmental | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
| 3300014058 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M | Environmental | Open in IMG/M |
| 3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015078 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11a, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027995 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_1_MG | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPWSG_03197620 | 2067725003 | Soil | GTGFPDWRTGSVLALFLLGVVGALTLVFARFLQPRQVAAD |
| E41_09752900 | 2170459005 | Grass Soil | VDLFGAGFPDWETGSVLALFLIGVVAILTAVFSRFLQPQRVATE |
| INPhiseqgaiiFebDRAFT_1013276352 | 3300000364 | Soil | GAGFPDWETGSVLALFLIAVVAVLTVVFSRFLQPRQVATD* |
| INPhiseqgaiiFebDRAFT_1047880251 | 3300000364 | Soil | GNQIVDLFQTGFPDWETGSVLAIFLLGVVALLTVVFSRFLQPSQVAAD* |
| AP72_2010_repI_A100DRAFT_10428021 | 3300000837 | Forest Soil | GYMYGNQIHDLFNGGFPDWQTGATLSLFLIGVIAALTLVCVRFLRLGEARVA* |
| JGI10215J12807_10839742 | 3300000881 | Soil | FPDWETGSVLSIFLLVVVAALTVVFSRFLRTGQVAAR* |
| JGI10214J12806_123481521 | 3300000891 | Soil | YMYGNQIVDLFGTGFPDWATGSVLAMFLLAVVTVLTLVFSRFLRAGEPASG* |
| JGI10216J12902_1124245881 | 3300000956 | Soil | GASGYMYGNQIVDLFGAGFPDWETGSVLALFLIGVVVVLTVAFSRFLQPQQVAAE* |
| C688J13580_10345542 | 3300001205 | Soil | LFGTGFPDWQTGSVLALFLLGVVAVLTIVFSRFLQTREVTAG* |
| C688J14111_102494832 | 3300001305 | Soil | NQIVDLFGAGFPDWETGSVLALFLIAVVLVLTVVFSRFLQPQQVAAD* |
| C688J18823_103009951 | 3300001686 | Soil | MYGNQIVDLFGAGFPDWETGSVLALFLIAVVLVLTVVFSRFLQPQQVAAD* |
| JGI24743J22301_100526231 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | FGAGFPDWRTGSVLALFLLGVVVALTLVFARFLQPRQVATD* |
| JGI24750J21931_10157013 | 3300002070 | Corn, Switchgrass And Miscanthus Rhizosphere | GFPDWRTGSVLALFLLGVVVALTLVFARFLQPRQVATD* |
| C688J35102_1194933171 | 3300002568 | Soil | LFGTGFPDWETGSVLAIFLLGVVGVLTIVFARFLQPRQVVADS* |
| Ga0063454_1019678111 | 3300004081 | Soil | GTGFPDWETGSELALFLIVVVAVLTLVFSRFLQPSQVTTD* |
| Ga0063455_1012214192 | 3300004153 | Soil | AGFPDWETGSVLALFLILVVGALTVVFSRFLQPAQVAAD* |
| Ga0062595_1005283601 | 3300004479 | Soil | GGTGGYMYGNQIVDLFETGFPDWETGAALALFLIGVISVLTVVFVRFLRVGEARAA* |
| Ga0062595_1009783001 | 3300004479 | Soil | DLFGAGFPDWETGSVLALFLIGVVVVLTVVFSRFLQPQTVAE* |
| Ga0066815_100989101 | 3300005164 | Soil | DLFGTGFPDWRTGSVLALFLLGVVGALSLVFARFLQPRQVATD* |
| Ga0066680_105057212 | 3300005174 | Soil | TGFPDWETGSVLAIFLFGVVTVLTVVFARFLQPRQVTAD* |
| Ga0066690_108228221 | 3300005177 | Soil | GYMYGNQIVDLFQNGFPDWETGAALALFLIGVISVLTVVFVRFLRVGEAQAA* |
| Ga0066688_104986951 | 3300005178 | Soil | YMYGNQIVDLFGTGFPDWETGSVLALFLLGVVAALTAIFARFIRAGQTAGS* |
| Ga0066688_108569601 | 3300005178 | Soil | YGNQIVDLFETGFPDWETGAALALFLIGVITVLTLVFVRFLRVGEARAA* |
| Ga0066688_109419251 | 3300005178 | Soil | SLVGGASGYMYGNQIVDLFGTGFPDWETGSVLAMFLFAVVTLLSLAFGRFLQPRQVAAG* |
| Ga0066684_101277771 | 3300005179 | Soil | YMYGNQIVDLFGTGFPDWETGSVLAIFLLGVVAALTLVFARFSQIRDVAAS* |
| Ga0066684_101538093 | 3300005179 | Soil | GYMYGNQIVDLFGTGFPDWETGSIPALFLIGVVAILTVVFSRFLQPGQVATD* |
| Ga0066684_103919852 | 3300005179 | Soil | DLFEAGFPDWETGSVLALFLLGVVAILTVVFARFLRAPRLETS* |
| Ga0066678_106314191 | 3300005181 | Soil | NQIVDLFGTGFPDWEAGSVLALFLLGVVAALAAIFARFIRAGQTAGG* |
| Ga0066678_111007401 | 3300005181 | Soil | GYMYGNQIVDLFGTGFPDWETGSVLAMFLFAVVTLLSLAFGRFLQPRQVAAG* |
| Ga0066671_108174692 | 3300005184 | Soil | LFGTGFPDWQTGSVLALFLLGVVALLTIVFSRFLQTREVTAG* |
| Ga0066388_1009067213 | 3300005332 | Tropical Forest Soil | QIVDLFGTGFPDWRTGSVLALFLLGVVGALTLVFARFLQPRQVVAD* |
| Ga0066388_1022415232 | 3300005332 | Tropical Forest Soil | TGFPDWETGSVLAIFLLIVVSVLTVVFARFLQPSQVAAD* |
| Ga0070671_1009646231 | 3300005355 | Switchgrass Rhizosphere | LFGTGFPDWRTGSVLALFLLGVVGALSLVFARFLQPRQVATD* |
| Ga0070709_111629872 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LVGGASGYMYGNQIVDLFGTGFPDWETGSVLALFLLIVVAVLTVFCSRFLQPQKVAAD* |
| Ga0070714_1004039911 | 3300005435 | Agricultural Soil | TGGYMYGNQIVDKFGAGFPDWETGSVLALFLIIVVAVLTALCSRFLQPQRVAAE* |
| Ga0070714_1006914571 | 3300005435 | Agricultural Soil | LFGTGFPDWETGSVLAIFLLGVVGALTIVFARFLQPGEVTVD* |
| Ga0070714_1011165091 | 3300005435 | Agricultural Soil | SLVGGASGYMYGNQIVDLFGTGFPDWETGSVLALFLLAVIAALTVVFARFIQQDVPA* |
| Ga0070714_1024236592 | 3300005435 | Agricultural Soil | LFGTGFPDWETGSVLAIFLLCVVAALTVVFSRFLQPKQVATE* |
| Ga0070713_1001713211 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | GTGFPDWQTGSVLALFLLIVVAALTVLFARFLQPGQVSAD* |
| Ga0070713_1019945121 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | YMYGNQIVDLFGTGFPDWESGSVLAIFLLGVVTVLTLVFGRFLRTDR* |
| Ga0070694_1001025333 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | GYMYGNQIVDLFETGFPDWETGAALALFLIGVIAVLTVVFVRFLRVGEARTA* |
| Ga0070708_1018769012 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GNQIVDLFGTGFPDWETGSVLAIFLFGVVTVLTVVFTRFLQPRRVAAD* |
| Ga0068867_1005233842 | 3300005459 | Miscanthus Rhizosphere | VDLFGTGFPDWRQGSVLALFLLAVVALLNAIFSRFLAPQKTVAL* |
| Ga0070706_1003623151 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | FGTGFPDWETGSVLAIFLLGVVTVLTVAFARFLQPRQVVAE* |
| Ga0070698_1003805353 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | TGFPDWETGSVLSMFLLGVVAILTVVFARFLQPGEVTVD* |
| Ga0070698_1005295563 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | FGTGFPDWETGSVLALFLIAVVAVLTVVFSRFLQPQQIATD* |
| Ga0070698_1018190172 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | FGTGFPDWQTGSVLALFLLGVVALLTIVFSRFLQTREVTAG* |
| Ga0073909_102204931 | 3300005526 | Surface Soil | YGNQIVDLFGTGFPDWRQGSVLALFLLAIVAVLAGVFSRFLQPQKLEAL* |
| Ga0073909_104503102 | 3300005526 | Surface Soil | FGTGFPDWETGSVLALFLIAVVAVLTLTFSRFLQPRQMVAE* |
| Ga0070679_1012206282 | 3300005530 | Corn Rhizosphere | NQIADLFSTGFPDWETGSVLALFLLCVVAVLTVVFSRFMRAEATA* |
| Ga0070679_1020252842 | 3300005530 | Corn Rhizosphere | MYGNQIVDLFGTGFPDWETGSVLALFLIAVVALLTVAFSRFLQPQQVVAE* |
| Ga0070684_1022834122 | 3300005535 | Corn Rhizosphere | ITDLFGTGFPDWRTGSVLALFLLAVVALLTAAFSRFLRPAEVHAD* |
| Ga0070697_1011798491 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | TGFPDWTTGSVLALFLLGVVAALTVVFARFLQARQFGSG* |
| Ga0070731_103267732 | 3300005538 | Surface Soil | EFVTPSIVGGSSGYMYGNQIQQVFNGGFPDWQTGATLSLFLLGVIAALTLVFVRVLRIGEAAGA* |
| Ga0066697_101684831 | 3300005540 | Soil | GYMYGNQIVDLFGTGFPDWETGSVLALFLLAVIAILTLVFVRFLRTGEAQTA* |
| Ga0070704_1013720542 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | TGFPDWETGSVLALFLLGVVAVLTLVFSRFLTPSQVATE* |
| Ga0070704_1014898832 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | TSGYMYGNQIADLFQTGFPDWETGSVLALFLLGVVTVLTLCFARFTQMREAA* |
| Ga0066701_105929171 | 3300005552 | Soil | ISDLFSTGFPDWQTGSVLALFLLGVVALLTAALTRFLQFRDVATG* |
| Ga0066695_104914951 | 3300005553 | Soil | FQTGFPDWQTGSVLAIFLLGVVVVLTVVFSRFLQPRQVAAG* |
| Ga0066698_107427812 | 3300005558 | Soil | SLVGGSSGYMYGNQIHDLFNGGFPDWQTGATLSLFLLGVVAALTLVFVRFLRVGEARAA* |
| Ga0066700_109509131 | 3300005559 | Soil | DWETGSVLAIFLLGVVAVLTVVFGRFLQPRQVVAD* |
| Ga0066670_109774901 | 3300005560 | Soil | NQIVDLFGTGFPDWETGSVLALFLLAVIAILTLVFVRFLRAGEAQTA* |
| Ga0066693_101961132 | 3300005566 | Soil | NQIVDLFGTGFPDWETGSVLAIFLLGVVAVLTVAFARFLQPGQVATE* |
| Ga0066693_103148672 | 3300005566 | Soil | WETGSVLAIFLLGVVAVLSVVFARFLRPRQVAAT* |
| Ga0066703_107699421 | 3300005568 | Soil | WETGSVLALFLIGVVALLTVLFSRFLQPQRVAAE* |
| Ga0066705_100023731 | 3300005569 | Soil | SGYMYGNQIVDLFGTGFPDWETGSVLALFLLAVIAALTVVFGRFIQTEAPA* |
| Ga0066705_104906561 | 3300005569 | Soil | NQIVDLFQNGFPDWETGAALALFLIGVISVLTVVFVRFLRVGEAQAA* |
| Ga0066705_105651242 | 3300005569 | Soil | GYMYGNQIVDLFGTGFPDWETGSVLALFLLAVIAILTLVFVRFLRAGEAQTA* |
| Ga0066702_105081621 | 3300005575 | Soil | DWETGSVLAIFLLGVVGVLSVVFARFLRPRGVAT* |
| Ga0066654_103814541 | 3300005587 | Soil | TGFPDWETGSVLAIFLLGVVAILTVVFARFLQPAEVTLD* |
| Ga0066654_108668382 | 3300005587 | Soil | WETGSVLSLFLLGVVAVLTVVFSRFLRSGQVAAN* |
| Ga0068856_1007624941 | 3300005614 | Corn Rhizosphere | GYMYGNQIVDKFGAGFPDWETGSVLALFLIIVVAILTALFSRFLQPQRVAAE* |
| Ga0068866_105964141 | 3300005718 | Miscanthus Rhizosphere | LYGNQIVDLFGAGFPDWETGSVLSIFLLVVVAALTVVFSRFLRTGQVAAR* |
| Ga0068866_110985552 | 3300005718 | Miscanthus Rhizosphere | DLFGTGFPDWQTGSVLALFLLGVVALLTIVFSRFLQTREVTAG* |
| Ga0066903_1005167281 | 3300005764 | Tropical Forest Soil | GGTGGYMYGNQIVDLFGAGGFPDWETGSVLALFLLAVIATLTVIFVRFLRAGEARIA* |
| Ga0066903_1018911491 | 3300005764 | Tropical Forest Soil | ASGYMYGNQIVDLFGSGFPDWETGSILALFLILVVAGLTVLFSRFLQPQQAGAS* |
| Ga0066903_1060689382 | 3300005764 | Tropical Forest Soil | QIVDLFGTGFPDWETGSVLALFLLAVIAILTLVLVRFLRAGEAQTA* |
| Ga0066903_1067031692 | 3300005764 | Tropical Forest Soil | VDLFGTGFPDWRTGSVLALFLLVVVAALTAVFSRFLRLDGAAAR* |
| Ga0066696_100699391 | 3300006032 | Soil | GFPDWETGSILALFLIGVVAILTVVFSRFLQPGQVATD* |
| Ga0066696_107481652 | 3300006032 | Soil | QIVDLFGTGFPDWETGSVLALLLLAVIAALTVVFARFVQAREAPT* |
| Ga0066656_104144731 | 3300006034 | Soil | GGYMYGNQIVDLFGTGFPDWETGSVLALFLLAVIAILTLVFVRFLRTGEAQTA* |
| Ga0066652_1009899671 | 3300006046 | Soil | YMYGNQIVDLFGTGFPDWETGSVLALFLLGVVAALTAIFARFMRAGQTAGS* |
| Ga0075417_101834912 | 3300006049 | Populus Rhizosphere | MYGNQIVDLFGTGFPDWETGSVLALFLLGVVAALTVVFSRFLRSGQAAVG* |
| Ga0075018_106631431 | 3300006172 | Watersheds | DWETGSVLAMFLFVVVTVLTIGFARFLQPRQVVAD* |
| Ga0070716_1011948002 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GFPDWETGSVLAIFLLGIVGALTIVFARFLQPRQVATD* |
| Ga0070716_1015764871 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GFPDWETGSVLALFLLAVIAALTVLFARFVQAREAPA* |
| Ga0070712_1004360901 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GYMYGNQIVDLFQTGFPDWETGAVLALFLLAVILALTLVFVRFLRAGEARTA* |
| Ga0097621_1008047392 | 3300006237 | Miscanthus Rhizosphere | GNQIVLLFQTGFPDWETGSALALFLIGVITLLTLVFVRFLRVGEAQAT* |
| Ga0068871_1005712682 | 3300006358 | Miscanthus Rhizosphere | TSGYMYGNQIADLFSTGFPDWETGSVLALFLLGVVTVLTLFFARFTRVQEAA* |
| Ga0074047_117973431 | 3300006576 | Soil | GYMYGNQIVDLFGTGFPDWRTGAVLALFLLVVVGLLTIVFSRFLQARQVATD* |
| Ga0074060_120643021 | 3300006604 | Soil | MYGQQIVTLFQTGFPDWETGSALALFLIGVVAVLTLVFVRFLRVGEARAA* |
| Ga0066659_117050402 | 3300006797 | Soil | GTGFPDWETGSVLALFLIGVVTVLTVVFSRFLQPQQVIAE* |
| Ga0079220_110500112 | 3300006806 | Agricultural Soil | NQIVDKFGAGFPDWETGSVLALFLIIVVAVLTALCSRFLQPQRVAAE* |
| Ga0079220_119298562 | 3300006806 | Agricultural Soil | DLFNTGFPDWETGSVLALFLILVVGALTVVFSRFLQPQQVTAE* |
| Ga0075421_1004121011 | 3300006845 | Populus Rhizosphere | GTGFPDWQTGSVLAIFLLLVVAVLTVVFGRFLQPRQVTAD* |
| Ga0075433_103251141 | 3300006852 | Populus Rhizosphere | YMYGNQIADLFSTGFPDWETGSVLALFLLGVVAVLTLVFSRFTQMREAP* |
| Ga0075425_1010661361 | 3300006854 | Populus Rhizosphere | WETGSVLAIFLLGVVAALTLLFARFTQTRSVAAS* |
| Ga0075425_1029753361 | 3300006854 | Populus Rhizosphere | TGFPDWQTGSVLAIFLLLVVAVLTVVFARFLQPSQVTAD* |
| Ga0075426_110226861 | 3300006903 | Populus Rhizosphere | GGASGYMYGNQIVDLFGTGFPDWETGSVLALFLLAVIAALTVVFARFIQQDVPA* |
| Ga0079219_119918142 | 3300006954 | Agricultural Soil | YMYGNQIVDLFGTGFPDWETGSVLALFLLGVVAALTVVFSRFLRSGQAAVG* |
| Ga0066710_1026975661 | 3300009012 | Grasslands Soil | SRDGNPIVRWLGSGLPAWATSSVLAIFLLGVVAVLTVVFARFLQPRQVAAD |
| Ga0066710_1026997371 | 3300009012 | Grasslands Soil | DWETGSVLAIFLLGVVAALTIVFARFLRPREVAAG |
| Ga0066710_1041911782 | 3300009012 | Grasslands Soil | GFPDWETGSVLAVFLLGVVAVLTAAFARVLQVRQVAGG |
| Ga0099830_103002263 | 3300009088 | Vadose Zone Soil | SLVGGATGYMYGNQIVDLFGTGFPDWETGAVLAMFLLGVVTVLTVAFSRFLQPRQVAAAD |
| Ga0099827_106752732 | 3300009090 | Vadose Zone Soil | FGTGFPDWETGSVLAIFLLGVVAVLTIVFSRFLQPRQVAAD* |
| Ga0099827_113800832 | 3300009090 | Vadose Zone Soil | LFGTGFPDWETGSVLSIFLLGVVATLTVVFARFLQPGDVTVD* |
| Ga0105240_108915642 | 3300009093 | Corn Rhizosphere | VGGTGGYMYGNQIVDLFETGFPDWETGAALALFLIGVIAVLTVVFVRFLRVGEARTA* |
| Ga0105245_108388401 | 3300009098 | Miscanthus Rhizosphere | YMYGNQIADLFQTGFPDWETGSVLALFLLGVVTVLTLCFARFTQLREPA* |
| Ga0105245_129013032 | 3300009098 | Miscanthus Rhizosphere | VDKFGAGFPDWETGSVLALFLIIVVAILTAIFSRFLQPQRVAAE* |
| Ga0105247_102192214 | 3300009101 | Switchgrass Rhizosphere | GFPDWRTGAVLALFLLAVVAGLSAVFSRFLQPQQLEAS* |
| Ga0066709_1013975611 | 3300009137 | Grasslands Soil | GFPDWETGSVLAVFLLAIVAVLTAAFARVLQVRQVAGG* |
| Ga0099792_108180801 | 3300009143 | Vadose Zone Soil | FPDWETGAVLAMFLLVVVTMLTVVFARFLQPRQVATG* |
| Ga0075423_110623901 | 3300009162 | Populus Rhizosphere | LFETGFPDWETGSVLAIFLLGVVTVLTIAFSRFLQPKQVSSG* |
| Ga0105241_110522432 | 3300009174 | Corn Rhizosphere | GGYMYGNQIVDKFGAGFPDWETGSVLALFLIIVVAVLTTVCSRFLQPQRVAAE* |
| Ga0105241_110607732 | 3300009174 | Corn Rhizosphere | SLVGGASGYMYGNQIVDLFGAGFPDWETGSVLALFLIIVVAILTAIFSRFLQPQRVAAE* |
| Ga0105242_116529972 | 3300009176 | Miscanthus Rhizosphere | GFPDWETGSVLAIFLLGVVTLLTLLFSRFLQFRQAGTG* |
| Ga0105248_109290031 | 3300009177 | Switchgrass Rhizosphere | LFATGFPDWRTGSVLALFLLGVVGALTLVFARFLQPRQVATD* |
| Ga0105237_123552931 | 3300009545 | Corn Rhizosphere | LVGGTSGYMYGNQIADLFQTGFPDWETGSVLALFLLGVVTVLTLCFARFTQLREPA* |
| Ga0105238_125205632 | 3300009551 | Corn Rhizosphere | FGAGFPDWETGSVLALFLIIVVAILTALFSRFLQPQRVAAE* |
| Ga0126382_105587122 | 3300010047 | Tropical Forest Soil | WRTGSVLALFLLGVVVVLTLVFARFLQPRQVATD* |
| Ga0126373_123669471 | 3300010048 | Tropical Forest Soil | FPDWETGSVLALFLLAVIALLTAVFSRFLQVQQVPDR* |
| Ga0134070_101254242 | 3300010301 | Grasslands Soil | WRTGSVLAIFLLGVVAILIALFGRFLQVRTVGAD* |
| Ga0134082_104680312 | 3300010303 | Grasslands Soil | FGTGFPDWETGSVLAIFLLGVVALLTVVFARFLQPGQVAAD* |
| Ga0134109_102483892 | 3300010320 | Grasslands Soil | FGTGFPDWETGSVLAIFLLGVVGALTVVFARFLQPRQVAAD* |
| Ga0134086_102938312 | 3300010323 | Grasslands Soil | FPDWETGSVLSLFLLGVVAVLTVVFSRFLRSGQVAAN* |
| Ga0134063_105162781 | 3300010335 | Grasslands Soil | DLFGTGFPDWETGSVLSIFLLGVVAILTVVFARFLQPGEVTVD* |
| Ga0134063_106239441 | 3300010335 | Grasslands Soil | QTGFPDWQTGSVLAIFLLGVVVVLTVVFSRFLQPRQVAAG* |
| Ga0126370_115742241 | 3300010358 | Tropical Forest Soil | GTGFPDWQTGSVLALFLLVVVGLLTVVFARFLQPGQVSAD* |
| Ga0126378_119004402 | 3300010361 | Tropical Forest Soil | WETGSVLALFLLVVVAALTVVFAQFLQPEQMAAD* |
| Ga0134066_101446132 | 3300010364 | Grasslands Soil | VGGTSGYMYGNQIVDLFQTGFPDWETGAVLALFLLAVILALTLVFVRFLRVGEARPT* |
| Ga0134125_105963721 | 3300010371 | Terrestrial Soil | TGFPDWETGSVLAMFLLGVVALLTVAFSRFLQPRRVVTD* |
| Ga0134125_130608032 | 3300010371 | Terrestrial Soil | GNQIVDKFGAGFPDWETGSVLALFLIIVVAVLTAVCSRFLQPQRVAAE* |
| Ga0134128_105943003 | 3300010373 | Terrestrial Soil | GTGFPDWQTGSVLALFLLGVVALLTIVFSRFLQTREVTAG* |
| Ga0105239_108018691 | 3300010375 | Corn Rhizosphere | AGFPDWETGSVLSIFLLVVVAALTVVFSRFLRTGQVAAR* |
| Ga0126381_1019193842 | 3300010376 | Tropical Forest Soil | GFPDWETGSVLALFLILVVAVLTVVFSRFLQSSQMAAD* |
| Ga0126381_1051294372 | 3300010376 | Tropical Forest Soil | LFETGFPDWETGSVLALFLVGVVAVLTLVFARFLRPRELAAD* |
| Ga0136449_1017754062 | 3300010379 | Peatlands Soil | VDLFGTGFPDWETGSVLAMFLLVVVTVLTVVFSRFLQPRQVATD* |
| Ga0134126_110721902 | 3300010396 | Terrestrial Soil | GFPDWETGSVLAMFLLGVVALLTVAFSRFLQPRRVVTD* |
| Ga0126383_113708481 | 3300010398 | Tropical Forest Soil | WQTGSVLALFLLVVVGLLTVVFARFLQPGQVSAD* |
| Ga0126383_134555062 | 3300010398 | Tropical Forest Soil | YGNQIVDLFGTGFPDWETGSVLALFLLAVIALLTAVFSRFLQVQQVPGR* |
| Ga0126350_101407632 | 3300010880 | Boreal Forest Soil | GFPDWETGSVLAMFLFGVVTILTVVFARFLQPRQLAAD* |
| Ga0126350_104074592 | 3300010880 | Boreal Forest Soil | SLVGGTSGYMYGNQIVDLFGTGFPDWETGSVLALFLLAVIAALTVVFARFIGRGAAPA* |
| Ga0137393_111911711 | 3300011271 | Vadose Zone Soil | NQIVDLFGTGFPDWETGSVLAIFLFGVVTVLTVVFSRFLSVRRVTAG* |
| Ga0120174_11486802 | 3300012008 | Permafrost | DWETGSVLSIFLLVVVATLTVVFARFLQPREVRAG* |
| Ga0120159_10569603 | 3300012014 | Permafrost | GYMYGNQIVDLFGAGFPDWETGSVLALFLIGVVAVLTAVFSRSLQPQRVATE* |
| Ga0120139_10669642 | 3300012019 | Permafrost | MYGNQIVDLFGTGFPDWETGSVLALFLLVVVAVLTGVFTRFMRVGQAARS* |
| Ga0137383_104674831 | 3300012199 | Vadose Zone Soil | QIVDLFGTGFPDWETGSVLAIFLFGIVTVLTVAFTRFLQPRRVAAD* |
| Ga0137383_108502481 | 3300012199 | Vadose Zone Soil | DLFETGFPDWETGSVLALFLLGVVVLLTVVFARFLQPKHVAAS* |
| Ga0137363_116272582 | 3300012202 | Vadose Zone Soil | MYGNQIVDLFGTGFPDWETGSVLAIFLFGVVTVLTVAFS |
| Ga0137399_114376241 | 3300012203 | Vadose Zone Soil | DWETGSVLAIFLLCVVTVLTVAFSRFLQPRRIAAD* |
| Ga0137380_102092803 | 3300012206 | Vadose Zone Soil | FPDWETGSVLAIFLFGIVTVLTVVFARFLQPRQVTAG* |
| Ga0137380_106421591 | 3300012206 | Vadose Zone Soil | DWETGSVLAIFLLGVVAVLTVAFSRFLQPRQVAAD* |
| Ga0137380_110946282 | 3300012206 | Vadose Zone Soil | VDLFGTGFPDWETGSVLAIFLLGVVTVLTVAFSRFLQPRRVAAD* |
| Ga0137376_115789422 | 3300012208 | Vadose Zone Soil | WEIGSVLAMFLLGVVTVLTVVFSRFLQPRRVATD* |
| Ga0137377_101818123 | 3300012211 | Vadose Zone Soil | GFPDWETGSVLAIFLLGVVGALTIVFARFLQPGEVTVD* |
| Ga0137377_118456522 | 3300012211 | Vadose Zone Soil | TSGYMYGNQIVDLFQQGFPDWETGATLALFLIAVISVLTFVFVRFLRLGEARVA* |
| Ga0137366_104292401 | 3300012354 | Vadose Zone Soil | TGFPDWETGSVLAIFLLGVVAVLTVVFARFLQPKQVVAE* |
| Ga0137366_110301781 | 3300012354 | Vadose Zone Soil | NQIVDLFGTGFPDWETGSVLALFLIAVVAVLTVVFSRFLQPQQIAAD* |
| Ga0137371_108624512 | 3300012356 | Vadose Zone Soil | FPDWETGSVLAIFLLGVVAVLTVVFGRFLQPRQVVAE* |
| Ga0137361_101503103 | 3300012362 | Vadose Zone Soil | FSTGFPDWETGSVLSIFLLGVVAILTVVFARFLQPGEVTVD* |
| Ga0137358_104527681 | 3300012582 | Vadose Zone Soil | TGFPDWETGSVLALFLLAVIAALTVVFARFIQQEAPA* |
| Ga0157281_10701162 | 3300012883 | Soil | LFGTGFPDWRTGSVLALFLLGVVVALTLVFARFLQPRQVATD* |
| Ga0157305_102044051 | 3300012891 | Soil | DLFGTGFPDWETGSVLAIFLLLVVAVLTIVFARFLQPSQVTAD* |
| Ga0157284_103448911 | 3300012893 | Soil | TGFPDWETGSVLAIFLLLVVAVLTIVFARFLQPSQVTAD* |
| Ga0157285_102091091 | 3300012897 | Soil | TGFPDWRTGSVLALFLLGVVCALTLVFARFLQPRQVVAD* |
| Ga0157288_102783002 | 3300012901 | Soil | YGNQIVDLFVAGFPDWQTGSVLALFLLGVVAVLTIAFSRFLGAQAAAR* |
| Ga0157283_104239142 | 3300012907 | Soil | GTGFPDWQTGSVLAIFLLLVVAVLTIVFARFLQPSQVTAD* |
| Ga0137416_110098482 | 3300012927 | Vadose Zone Soil | FGTGFPDWETGAVLAMFLLGVVTVLTVAFSRFLQPRQVATD* |
| Ga0137404_101093423 | 3300012929 | Vadose Zone Soil | FPDWETGSVLAIFLFGVVTVLTVVFARFLQPRQVTAG* |
| Ga0164300_100230764 | 3300012951 | Soil | IVDLFGAGFPDWETGSVLALFLIGVVVVLTVAFSRFLQPQQVTAE* |
| Ga0164298_103655112 | 3300012955 | Soil | GFPDWETGSVLALFLLGVVAVLTLVFSRFLTPSQVATE* |
| Ga0164303_110028492 | 3300012957 | Soil | DWETGSVLALFLIAVVALLTVVFSRFLQPQQVVAE* |
| Ga0164299_106224831 | 3300012958 | Soil | QIVDLFETGFPDWETGSVLALFLLGVVAVLTLVFSRFLTPSQVATE* |
| Ga0164301_112567912 | 3300012960 | Soil | SLVGGTSGYMYGNQIVDLFQTGFPDWETGAVLSLFVLAVILTLTLVFVRFLRVSEARTT* |
| Ga0126369_103943391 | 3300012971 | Tropical Forest Soil | WETGSVLALFLLGVVAVLTIVFSRFLRSGQVAAN* |
| Ga0164304_101636973 | 3300012986 | Soil | DWQTGSVLALFLLGVVAVLTIVFSRFLLSREVAAG* |
| Ga0164304_105676672 | 3300012986 | Soil | SGYMYGNQIVDLFGTGFPDWETGSVLALFLLAVIAALTAVFSRFMQVRQVPA* |
| Ga0164305_103728933 | 3300012989 | Soil | GTGFPDWETGSVLAIFLFGVVTVLTLVFARFLQPRQVTAR* |
| Ga0164305_106606472 | 3300012989 | Soil | ETGFPDWETGSVLALFLLGVVAVLTLVFSRFLTPSQVATE* |
| Ga0164305_118718801 | 3300012989 | Soil | NQIVDLFQTGFPDWETGAVLSLFVLAVILTLTLVFVRFLRVSEARTT* |
| Ga0157373_100992533 | 3300013100 | Corn Rhizosphere | TGFPDWQTGSVLALFLLIVVAALTVLFARFLQPGQVSAD* |
| Ga0157371_101735264 | 3300013102 | Corn Rhizosphere | YGNQIVDKFGAGFPDGETGSVLALFLIIVVAVLTTVCSRFLQPQRVAAE* |
| Ga0157369_117333151 | 3300013105 | Corn Rhizosphere | GGYMYGNQIVDKFGAGFPDWETGSVLALFLIVVVAVLTALFSRFLQPQRAAAG* |
| Ga0157378_102617651 | 3300013297 | Miscanthus Rhizosphere | NQIADLFGTGFPDWRTGSVLALFLRGVVVALTLVFARFLQPRQVATD* |
| Ga0120172_10402573 | 3300013765 | Permafrost | GAPGYMYGNQIVDLFGTGFPDWETGSVLALFLLGVVTVLTLAFGRFLRTDR* |
| Ga0120123_10560351 | 3300013770 | Permafrost | GYMYGNQIVDLFGTGFPDWETGSVLALFLLGVVTVLTLVFGRFLRTDR* |
| Ga0120125_11311812 | 3300014056 | Permafrost | MYGNQIVDLFGTGFPDWETGSVLALFLIAVVAVLTVAFSRFLQPRQVAAE* |
| Ga0120149_11767472 | 3300014058 | Permafrost | MYGNQITDLFGTGFPDWRTGSVLALFLLVVVGVLTAVFSRFNQVGSVARG* |
| Ga0075352_12636042 | 3300014324 | Natural And Restored Wetlands | YGNQIVDLFGTGFPDWRSGAVLALFLLGVVGLLTIVFSRLLQPSHVATD* |
| Ga0157376_117341091 | 3300014969 | Miscanthus Rhizosphere | QIVDLFGAGSPDWETGSVLALFLIGVVVVLTVAFSRFLQPQQVTAE* |
| Ga0167660_10268593 | 3300015078 | Glacier Forefield Soil | PDWETGSVLAIFLFGVVTLLTVVFARFLQPGQVAAD* |
| Ga0134089_102659451 | 3300015358 | Grasslands Soil | TGFPDWETGSGLAIFLFGVVTVLTVVFTRFLQPRRVAAD* |
| Ga0132256_1007360331 | 3300015372 | Arabidopsis Rhizosphere | QIVDLFETGFPDWETGSVLAIFLLGVVVLLTIAFSRFLQPRQVSSG* |
| Ga0132256_1025733491 | 3300015372 | Arabidopsis Rhizosphere | VGGASGYMYGNQIVDLFGTGFPDWETGSVLALFLLGVVAVLTIVFSRFLRSGQVAAS* |
| Ga0132257_1024997402 | 3300015373 | Arabidopsis Rhizosphere | GRQIVDLFQTGFPDWETGDVPALFLLAVILALTLVFVRFLRAGEARAA* |
| Ga0132255_1015658421 | 3300015374 | Arabidopsis Rhizosphere | MYGNQIVDLFGTGFPDWETGSVLALFLIGVVVVLTVAFSRFLQPQQVTAE* |
| Ga0132255_1045571651 | 3300015374 | Arabidopsis Rhizosphere | GFPDWRTGSVLALFLLGVVAALTLVFARFLQPRQVAAD* |
| Ga0182041_118086552 | 3300016294 | Soil | FPDWETGSVLALFLLAVIAALTVVFARFIQRPVTP |
| Ga0182032_120685091 | 3300016357 | Soil | TGFPDWETGSVLAIFLLAVVALLTVVFSRFLQPRQVAQD |
| Ga0134112_104005032 | 3300017656 | Grasslands Soil | DWRTGSVLAVFLLAVVATLIALFGRFLQPRRLVAD |
| Ga0134083_104345492 | 3300017659 | Grasslands Soil | VGGPSGYMYGNQISDLFSTGFPDWETGSVLALFLLGVVTVLTAAFSRFMRLGEVASS |
| Ga0187786_101031571 | 3300017944 | Tropical Peatland | LFGTGFPDWETGAVLAIFLLLVVTLLTVTFSRFLQPRQVAAD |
| Ga0187786_104483961 | 3300017944 | Tropical Peatland | NQIVDLFGTGFPDWETGSVLAMFLLVVVTVLTVVFSRFLQPRQVATD |
| Ga0187785_107727041 | 3300017947 | Tropical Peatland | MYGNQIVDLFQTGFPDWETGSVLAIFLLAVVVLLTLVFSRFLQPRQVSAG |
| Ga0187779_109978892 | 3300017959 | Tropical Peatland | YMYGNQIVDLFGTGFPDWETGAVLAIFLLLVVTVLTITFSRFLQPRQVAAD |
| Ga0187778_102440483 | 3300017961 | Tropical Peatland | YMYGNQIVDLFQTGFPDWETGSVLAIFLLGVVTLLTLVFSRFLQPKQVAAG |
| Ga0187776_100752153 | 3300017966 | Tropical Peatland | FPDWQTGSVLALFLLLVVALLTIVFARFLGSRQATAG |
| Ga0187776_102438491 | 3300017966 | Tropical Peatland | QIVDLFGTGFPDWETGSVLALFLILVVALLTVVFSRFLQPQRVATD |
| Ga0187787_101343911 | 3300018029 | Tropical Peatland | GYMYGNQIVDLFGTGFPDWETGAVLAIFLLLVVTLLTVTFSRFLQPRQVAAD |
| Ga0187774_110070641 | 3300018089 | Tropical Peatland | YLYGNQIVDLFGTGFPDWRTGSVLALFLLVVVAGLAAAFSRFLQPQQLEAS |
| Ga0066655_113179772 | 3300018431 | Grasslands Soil | ARLFGTGFPDWETGSVLAIFLFVVVTVLTVVFARFLQPRQVTAG |
| Ga0066667_121856962 | 3300018433 | Grasslands Soil | FGTGFPDWETGSVLAIFLLGVVAALTIVFARFLQPGQVATD |
| Ga0066662_106084492 | 3300018468 | Grasslands Soil | YMYGNQIVDLFGTGFPDWETGSVLALFLLAVIAILTLVLTLVFVRFLRTGEAQTA |
| Ga0066662_107003132 | 3300018468 | Grasslands Soil | LVGGTSGYMYGNQIHDLFYAGFPDWETGAVLALFLIGVISALTLVFVRFLRLGDARTI |
| Ga0066669_101566491 | 3300018482 | Grasslands Soil | GFPDWETGSVLAIFLLGVVTVLTAAFSRFLQGRQVAGT |
| Ga0066669_118116762 | 3300018482 | Grasslands Soil | IVDLFGTGFPDWETGSVLALFLLAVIAALTVVFGRFIQTEAPA |
| Ga0193699_101025043 | 3300021363 | Soil | IVDLFVTGFPDWQTGSVLALFLLGVVAVLTIVFSRFLQSREVTAG |
| Ga0247746_11772811 | 3300022886 | Soil | TGFPDWETGSVLAIFLLLVVAVLTIVFARFLQPSQVTAD |
| Ga0179589_105606571 | 3300024288 | Vadose Zone Soil | DLFGTGFPDWQTGSVLALFLLGVVAVLTIVFSRFLQSREVTAG |
| Ga0247666_10348541 | 3300024323 | Soil | LVGGATGYMYGNQIVDLFGTGFPDWETGSVLALFLIAVVAVLTIAFSRFLQPRQVVAE |
| Ga0209519_100414791 | 3300025318 | Soil | PAVPGGSAQTGSVLALFLLGVVAVLTAVFARFLQVRQVTTG |
| Ga0207699_101715051 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | TGFPDWETGSVLAIFLLAVVGALTIVFARFLQPRQVAAD |
| Ga0207705_113252882 | 3300025909 | Corn Rhizosphere | GFPDWETGSVLALFLIIVVAILTALFSRFLQPQRVAAE |
| Ga0207707_112481772 | 3300025912 | Corn Rhizosphere | MYGNQIVDKFGAGFPDWETGSVLALFLIIVVAVLTTVCSRFLQPQRVAAE |
| Ga0207671_102814671 | 3300025914 | Corn Rhizosphere | GYMYGNQIVDKFGAGFPDWETGSVLALFLIIVVAILTALFSRFLQPQRVAAE |
| Ga0207693_107211521 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | GYMYGNQIVDLFGTGFPDWETGSVLALFLLAVIAALTVVFSRFIQGRDAAPA |
| Ga0207693_114351731 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | GFPDWETGSVLALFLLAVIAALTAVFSRFIQQEVPA |
| Ga0207693_114624432 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MYGNQIVDLFGAGFPDWETGSVLALFLIGVVAVLTVVFSRFLQPQQVAAD |
| Ga0207663_112475592 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LFGTGFPDWETGSVLAIFLLGVVGALTIVFARFLQPGEVTVD |
| Ga0207652_101465814 | 3300025921 | Corn Rhizosphere | GFPDWQTGSVLALFLLGVVALLTIVFSRFLQTREVTAG |
| Ga0207650_103190961 | 3300025925 | Switchgrass Rhizosphere | PDWRTGSVLALFLLGVVVALTLVFARFLQPRQVATD |
| Ga0207687_105602642 | 3300025927 | Miscanthus Rhizosphere | YMYGNQIADLFQTGFPDWETGSVLALFLLGVVTVLTLCFARFTQLREPA |
| Ga0207700_115810861 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | FGTGFPDWQTGSVLALFLLIVVAALTVLFARFLQPGQVSAD |
| Ga0207700_119590621 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | YGNQIVDLFGTGFPDWETGSVLAIFLLGVVTVLTLVFGRFLRTDR |
| Ga0207664_117751332 | 3300025929 | Agricultural Soil | LFGTGFPDWETGSVLAIFLLCVVAALTVVFSRFLQPKQVATE |
| Ga0207704_103507501 | 3300025938 | Miscanthus Rhizosphere | FPDWRTGAVLALFLLGVVVTLTLVFARFLQPRQVVAD |
| Ga0207665_107952422 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | FPDWETGAVLSIFLLAVVGVLSIVFARFLQPRQMAAD |
| Ga0207665_111328891 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | QIVDLFGTGFPDWETGSVLALFLLAVIAALTVLFARFVQAREAPA |
| Ga0207691_113301662 | 3300025940 | Miscanthus Rhizosphere | ADLFGTGFPDWRTGAVLALFLLGVVVALTLVFARFLQPRQVATD |
| Ga0207667_108756362 | 3300025949 | Corn Rhizosphere | QIVDKFGAGFPDWETGSVLALFLIIVVAILTALFSRFLQPQRVAAE |
| Ga0207640_102668283 | 3300025981 | Corn Rhizosphere | DWETGSVLALFLIIVVAVLTTVCSRFLQPQRVAAE |
| Ga0207640_103782513 | 3300025981 | Corn Rhizosphere | DWQTGSVLALFLLGVVALLTIVFSRFLQTREVTAG |
| Ga0207708_105190451 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | ADLFGTGFPDWRTGSVLALFLLGVVGALSLVFARFLQPRQVATD |
| Ga0207683_106997531 | 3300026121 | Miscanthus Rhizosphere | FPDWETGSVLALFLIGVVVVLTVAFSRFLQPQQVTAE |
| Ga0209688_10801052 | 3300026305 | Soil | PDWETGSVLAIFLLGVVAVLTVVFARFLQPRQVVAD |
| Ga0209801_10443761 | 3300026326 | Soil | PDWETGSVLSIFLLGVVAILTVVFARFLQPGEVTVD |
| Ga0209473_12016251 | 3300026330 | Soil | YGNQIVDLFGTGFPDWETGSVLALFLLGVVAALTAIFARFIRAGQTAGG |
| Ga0209577_105021792 | 3300026552 | Soil | FPDWETGSVLALFLLAVIAALSVVFARFIQTEVPA |
| Ga0209166_106440471 | 3300027857 | Surface Soil | MHGNQIVDLFGTGFPDWETGSVLALFLLAVIAALSVVFARFIQTDVPA |
| Ga0209579_100935853 | 3300027869 | Surface Soil | GYMYGNQIVDLFGTGFPDWETGSVLALFLLVVIAALTAVFSRFLQLRQPAG |
| (restricted) Ga0233418_103073521 | 3300027995 | Sediment | FGTGFPDWRTGSVLALFLLGVVCALTLVFARFLQPRQVAAD |
| Ga0247826_113632502 | 3300030336 | Soil | FGTGFPDWQTGSVLALFLLGVVAVLTVVFSRFLQTREVTAG |
| Ga0268241_101295731 | 3300030511 | Soil | GAGFPDWETGSVLALFLIVVVAALTAVFSRFLQPQQVVAD |
| Ga0307499_102637062 | 3300031184 | Soil | LFGTGFPDWQTGSVLALFLLGVVALLTIVFSRFLQTREVTAG |
| Ga0307497_100690921 | 3300031226 | Soil | GFPDWETGSVLAIFLFGVVTVLTVVFARFLQPRQVTAG |
| Ga0318534_104420302 | 3300031544 | Soil | FPDWETGSVLALFLLGVVVVLTVVFARFLQPRRVAAD |
| Ga0318534_104608162 | 3300031544 | Soil | VDLFGTGFPDWETGSVLSLFLLGVVAALTVVFSRFMRVR |
| Ga0318555_102439521 | 3300031640 | Soil | QIVDLFETGFPDWETGSVLALFLLGVVAVLTLVFSRFLQPRDLAAD |
| Ga0318542_102300861 | 3300031668 | Soil | FGTGFPDWETGAVLAIFLLLVVATLTVVFARFLQPQQVATD |
| Ga0307468_1004489201 | 3300031740 | Hardwood Forest Soil | DLFSTGFPDWRTGSVLALFLLAVVAVLTGAFSRFLGMRQTTS |
| Ga0306918_110548601 | 3300031744 | Soil | LFQTGFPDWETGSVLAIFLLAVVLVLTVVFSRFLQPKQVATD |
| Ga0307475_107918051 | 3300031754 | Hardwood Forest Soil | PDWETGSVLALFLLGVVAILTVAFSRFLQPRRVVTD |
| Ga0318566_100622123 | 3300031779 | Soil | FETGFPDWETGSVLALFLLGVVVVLTVVFARFLQPRRVAAD |
| Ga0318523_105918222 | 3300031798 | Soil | FETGFPDWETGSVLALFLLGVVAVLTLVFSRFLQPRDLAAD |
| Ga0318568_107111961 | 3300031819 | Soil | IESLFLGFPDWETGSVLAVFLLGVVAVLTIVFARFLQPRHAATD |
| Ga0318564_104569441 | 3300031831 | Soil | DWETGSVLALFLLGVVVVLTVVFARFLQPRRVAAD |
| Ga0318551_101873893 | 3300031896 | Soil | VDLFETGFPDWETGSVLALFLLGVVAVLTLVFSRFLQPRELAAD |
| Ga0306923_105116053 | 3300031910 | Soil | FETGFPDWETGSVLALFLLGVVAVLTLVFSRFLQPRELAAD |
| Ga0306921_110254842 | 3300031912 | Soil | LFGTGFPDWETGAVLAIFLLLVVATLTVVFARFLQPQQVATD |
| Ga0308175_1001702481 | 3300031938 | Soil | FPDWETGSVLAIFLLGVVAVLMVVFSRFLQPRQVAAD |
| Ga0308175_1028834201 | 3300031938 | Soil | NTGFPDWETGSVLALFLILVVGVLTVVFSRFLQPQQVTAE |
| Ga0306926_123578992 | 3300031954 | Soil | GTSGYMYGNQIVDLFGTGFPDWETGSVLALFLLAVIAALTVVFARFIQRPVTP |
| Ga0318562_102055871 | 3300032008 | Soil | VDLFETGFPDWETGSVLALFLLGVVAVLTLVFSRFLQPRDLAAD |
| Ga0310906_101772611 | 3300032013 | Soil | GFPDWRTGSVLALFLLGVVGALTLVFARFLQPRQVAAD |
| Ga0318507_102164922 | 3300032025 | Soil | GNQIVDLFGTGFPDWETGSVLALFLLAVIAALTVVFARFIQRPVTP |
| Ga0318514_106075142 | 3300032066 | Soil | GFPDWETGSVLAIFLLGVVALLTVVFARFLQPQQVTAD |
| Ga0311301_117365361 | 3300032160 | Peatlands Soil | VDLFGTGFPDWETGSVLAMFLLVVVTVLTVVFSRFLQPRQVATD |
| Ga0307471_1017800861 | 3300032180 | Hardwood Forest Soil | PDWETGAVLAMFLLAVVTILTVVFARFLQPSQVATD |
| Ga0315286_113224481 | 3300032342 | Sediment | PDWRTGSVLAIFLLVVVAALTAAFSRFLQVRPVAAN |
| ⦗Top⦘ |