| Basic Information | |
|---|---|
| Family ID | F012531 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 280 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MSDPERLVSADVAGLAAAIERAAADLAVAEEPAGFVVALEGEGDPGERRD |
| Number of Associated Samples | 192 |
| Number of Associated Scaffolds | 280 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 26.88 % |
| % of genes near scaffold ends (potentially truncated) | 25.36 % |
| % of genes from short scaffolds (< 2000 bps) | 72.14 % |
| Associated GOLD sequencing projects | 169 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.571 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (14.643 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.357 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.857 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.31% β-sheet: 0.00% Coil/Unstructured: 57.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 280 Family Scaffolds |
|---|---|---|
| PF01425 | Amidase | 44.64 |
| PF00849 | PseudoU_synth_2 | 35.71 |
| PF00072 | Response_reg | 3.57 |
| PF02517 | Rce1-like | 2.86 |
| PF00293 | NUDIX | 1.79 |
| PF02146 | SIR2 | 1.43 |
| PF07690 | MFS_1 | 0.71 |
| PF00291 | PALP | 0.71 |
| PF01479 | S4 | 0.71 |
| PF02954 | HTH_8 | 0.71 |
| PF01343 | Peptidase_S49 | 0.71 |
| PF00912 | Transgly | 0.71 |
| PF13561 | adh_short_C2 | 0.36 |
| PF02775 | TPP_enzyme_C | 0.36 |
| PF13493 | DUF4118 | 0.36 |
| PF03176 | MMPL | 0.36 |
| PF03069 | FmdA_AmdA | 0.36 |
| PF00158 | Sigma54_activat | 0.36 |
| PF00881 | Nitroreductase | 0.36 |
| PF07394 | DUF1501 | 0.36 |
| COG ID | Name | Functional Category | % Frequency in 280 Family Scaffolds |
|---|---|---|---|
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 44.64 |
| COG0564 | Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific | Translation, ribosomal structure and biogenesis [J] | 35.71 |
| COG1187 | Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605 | Translation, ribosomal structure and biogenesis [J] | 35.71 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 2.86 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 2.86 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.43 |
| COG0846 | NAD-dependent protein deacetylase, SIR2 family | Posttranslational modification, protein turnover, chaperones [O] | 1.43 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.36 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.36 |
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.36 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.57 % |
| Unclassified | root | N/A | 1.43 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664022|INPgaii200_c0645672 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 623 | Open in IMG/M |
| 3300000443|F12B_10088123 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
| 3300000559|F14TC_100445921 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 917 | Open in IMG/M |
| 3300001431|F14TB_101181505 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1111 | Open in IMG/M |
| 3300002561|JGI25384J37096_10007343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4110 | Open in IMG/M |
| 3300002561|JGI25384J37096_10069565 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300002562|JGI25382J37095_10021755 | All Organisms → cellular organisms → Bacteria | 2490 | Open in IMG/M |
| 3300002562|JGI25382J37095_10067306 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300002908|JGI25382J43887_10014424 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4111 | Open in IMG/M |
| 3300002912|JGI25386J43895_10050191 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1199 | Open in IMG/M |
| 3300004267|Ga0066396_10002397 | All Organisms → cellular organisms → Bacteria | 1795 | Open in IMG/M |
| 3300004268|Ga0066398_10161887 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 568 | Open in IMG/M |
| 3300004633|Ga0066395_10087327 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300004633|Ga0066395_10315684 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 859 | Open in IMG/M |
| 3300005167|Ga0066672_10195211 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300005167|Ga0066672_10619314 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300005171|Ga0066677_10021638 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2982 | Open in IMG/M |
| 3300005172|Ga0066683_10017997 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3893 | Open in IMG/M |
| 3300005172|Ga0066683_10040894 | All Organisms → cellular organisms → Bacteria | 2711 | Open in IMG/M |
| 3300005174|Ga0066680_10399411 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 873 | Open in IMG/M |
| 3300005175|Ga0066673_10276347 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300005177|Ga0066690_10576224 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300005180|Ga0066685_10000039 | All Organisms → cellular organisms → Bacteria | 24232 | Open in IMG/M |
| 3300005180|Ga0066685_10164968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium ADurb.BinA052 | 1511 | Open in IMG/M |
| 3300005181|Ga0066678_10606425 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300005186|Ga0066676_10014429 | All Organisms → cellular organisms → Bacteria | 3988 | Open in IMG/M |
| 3300005186|Ga0066676_10221775 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300005186|Ga0066676_10261649 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300005186|Ga0066676_10341905 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300005186|Ga0066676_10518621 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300005295|Ga0065707_10195264 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1339 | Open in IMG/M |
| 3300005295|Ga0065707_10967741 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 548 | Open in IMG/M |
| 3300005332|Ga0066388_100009419 | All Organisms → cellular organisms → Bacteria | 7459 | Open in IMG/M |
| 3300005332|Ga0066388_100288940 | All Organisms → cellular organisms → Bacteria | 2283 | Open in IMG/M |
| 3300005332|Ga0066388_100392098 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2034 | Open in IMG/M |
| 3300005332|Ga0066388_100848751 | All Organisms → cellular organisms → Bacteria | 1499 | Open in IMG/M |
| 3300005332|Ga0066388_101811281 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300005332|Ga0066388_103998189 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300005336|Ga0070680_100316221 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300005440|Ga0070705_100036425 | All Organisms → cellular organisms → Bacteria | 2766 | Open in IMG/M |
| 3300005445|Ga0070708_100907286 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300005446|Ga0066686_10035779 | All Organisms → cellular organisms → Bacteria | 2941 | Open in IMG/M |
| 3300005446|Ga0066686_10077253 | All Organisms → cellular organisms → Bacteria | 2100 | Open in IMG/M |
| 3300005446|Ga0066686_10894608 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300005450|Ga0066682_10524707 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 750 | Open in IMG/M |
| 3300005518|Ga0070699_100082332 | All Organisms → cellular organisms → Bacteria | 2805 | Open in IMG/M |
| 3300005518|Ga0070699_100198585 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1783 | Open in IMG/M |
| 3300005526|Ga0073909_10062766 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
| 3300005540|Ga0066697_10079042 | All Organisms → cellular organisms → Bacteria | 1897 | Open in IMG/M |
| 3300005543|Ga0070672_100604768 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300005546|Ga0070696_100746810 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 801 | Open in IMG/M |
| 3300005552|Ga0066701_10132223 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_40CM_68_15 | 1488 | Open in IMG/M |
| 3300005552|Ga0066701_10784387 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 568 | Open in IMG/M |
| 3300005558|Ga0066698_10149952 | All Organisms → cellular organisms → Bacteria | 1575 | Open in IMG/M |
| 3300005564|Ga0070664_100571971 | Not Available | 1046 | Open in IMG/M |
| 3300005569|Ga0066705_10166994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium ADurb.BinA052 | 1361 | Open in IMG/M |
| 3300005598|Ga0066706_10226857 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1446 | Open in IMG/M |
| 3300005713|Ga0066905_100106821 | All Organisms → cellular organisms → Bacteria | 1916 | Open in IMG/M |
| 3300005713|Ga0066905_100110620 | All Organisms → cellular organisms → Bacteria | 1890 | Open in IMG/M |
| 3300005713|Ga0066905_100401879 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300005713|Ga0066905_100627492 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300005713|Ga0066905_101051572 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 720 | Open in IMG/M |
| 3300005713|Ga0066905_101062798 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300005719|Ga0068861_101998808 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 578 | Open in IMG/M |
| 3300005764|Ga0066903_100029812 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6136 | Open in IMG/M |
| 3300005764|Ga0066903_100412977 | All Organisms → cellular organisms → Bacteria | 2229 | Open in IMG/M |
| 3300005764|Ga0066903_107381201 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 568 | Open in IMG/M |
| 3300005841|Ga0068863_101008494 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300005841|Ga0068863_101777338 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300005844|Ga0068862_100259487 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
| 3300006034|Ga0066656_10175205 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1354 | Open in IMG/M |
| 3300006049|Ga0075417_10001361 | All Organisms → cellular organisms → Bacteria | 6701 | Open in IMG/M |
| 3300006049|Ga0075417_10384962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 692 | Open in IMG/M |
| 3300006058|Ga0075432_10381784 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 604 | Open in IMG/M |
| 3300006844|Ga0075428_100693476 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1085 | Open in IMG/M |
| 3300006845|Ga0075421_100044407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5627 | Open in IMG/M |
| 3300006845|Ga0075421_100208072 | All Organisms → cellular organisms → Bacteria | 2418 | Open in IMG/M |
| 3300006852|Ga0075433_10613861 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300006852|Ga0075433_10736649 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 862 | Open in IMG/M |
| 3300006854|Ga0075425_100132872 | All Organisms → cellular organisms → Bacteria | 2846 | Open in IMG/M |
| 3300006854|Ga0075425_100245575 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2059 | Open in IMG/M |
| 3300006903|Ga0075426_10053198 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2893 | Open in IMG/M |
| 3300006904|Ga0075424_100301678 | All Organisms → cellular organisms → Bacteria | 1705 | Open in IMG/M |
| 3300006904|Ga0075424_101088686 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300006914|Ga0075436_100760029 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 720 | Open in IMG/M |
| 3300006969|Ga0075419_10001112 | All Organisms → cellular organisms → Bacteria | 17399 | Open in IMG/M |
| 3300007255|Ga0099791_10087296 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
| 3300009012|Ga0066710_100003166 | All Organisms → cellular organisms → Bacteria | 13845 | Open in IMG/M |
| 3300009012|Ga0066710_100032294 | All Organisms → cellular organisms → Bacteria | 6124 | Open in IMG/M |
| 3300009092|Ga0105250_10255609 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300009147|Ga0114129_10479562 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1627 | Open in IMG/M |
| 3300009162|Ga0075423_10016938 | All Organisms → cellular organisms → Bacteria | 7161 | Open in IMG/M |
| 3300009162|Ga0075423_12856493 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 529 | Open in IMG/M |
| 3300009444|Ga0114945_10502796 | Not Available | 730 | Open in IMG/M |
| 3300009793|Ga0105077_109840 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300009803|Ga0105065_1085114 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 508 | Open in IMG/M |
| 3300009808|Ga0105071_1001596 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2485 | Open in IMG/M |
| 3300009811|Ga0105084_1048746 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 748 | Open in IMG/M |
| 3300009812|Ga0105067_1011118 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300009816|Ga0105076_1004552 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2190 | Open in IMG/M |
| 3300009820|Ga0105085_1041944 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 819 | Open in IMG/M |
| 3300010046|Ga0126384_11623635 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 609 | Open in IMG/M |
| 3300010047|Ga0126382_10173710 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
| 3300010047|Ga0126382_11369691 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 643 | Open in IMG/M |
| 3300010301|Ga0134070_10068071 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1213 | Open in IMG/M |
| 3300010333|Ga0134080_10117087 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1108 | Open in IMG/M |
| 3300010336|Ga0134071_10000386 | All Organisms → cellular organisms → Bacteria | 14516 | Open in IMG/M |
| 3300010336|Ga0134071_10002064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 7338 | Open in IMG/M |
| 3300010358|Ga0126370_10029244 | All Organisms → cellular organisms → Bacteria | 3295 | Open in IMG/M |
| 3300010358|Ga0126370_11894442 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 580 | Open in IMG/M |
| 3300010359|Ga0126376_10007305 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6721 | Open in IMG/M |
| 3300010359|Ga0126376_10010146 | All Organisms → cellular organisms → Bacteria | 5832 | Open in IMG/M |
| 3300010359|Ga0126376_10174500 | All Organisms → cellular organisms → Bacteria | 1752 | Open in IMG/M |
| 3300010359|Ga0126376_10210229 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1621 | Open in IMG/M |
| 3300010359|Ga0126376_13253841 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300010362|Ga0126377_11335531 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 789 | Open in IMG/M |
| 3300010366|Ga0126379_10863252 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1006 | Open in IMG/M |
| 3300010398|Ga0126383_12807432 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 569 | Open in IMG/M |
| 3300010398|Ga0126383_13153956 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 538 | Open in IMG/M |
| 3300012096|Ga0137389_10021007 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4588 | Open in IMG/M |
| 3300012199|Ga0137383_11087889 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 579 | Open in IMG/M |
| 3300012202|Ga0137363_11015169 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 705 | Open in IMG/M |
| 3300012203|Ga0137399_10204925 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1603 | Open in IMG/M |
| 3300012203|Ga0137399_11628976 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 533 | Open in IMG/M |
| 3300012204|Ga0137374_10018647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 7908 | Open in IMG/M |
| 3300012205|Ga0137362_10022570 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4877 | Open in IMG/M |
| 3300012206|Ga0137380_10632792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium ADurb.BinA052 | 933 | Open in IMG/M |
| 3300012361|Ga0137360_10511190 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1023 | Open in IMG/M |
| 3300012362|Ga0137361_10153308 | All Organisms → cellular organisms → Bacteria | 2061 | Open in IMG/M |
| 3300012362|Ga0137361_10296685 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1478 | Open in IMG/M |
| 3300012362|Ga0137361_10730899 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300012582|Ga0137358_10055868 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2636 | Open in IMG/M |
| 3300012685|Ga0137397_10238139 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300012685|Ga0137397_10510576 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300012918|Ga0137396_10903196 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 647 | Open in IMG/M |
| 3300012927|Ga0137416_12123854 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 516 | Open in IMG/M |
| 3300012929|Ga0137404_10001578 | All Organisms → cellular organisms → Bacteria | 15069 | Open in IMG/M |
| 3300012929|Ga0137404_10018075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5035 | Open in IMG/M |
| 3300012929|Ga0137404_11412822 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 643 | Open in IMG/M |
| 3300012930|Ga0137407_10929660 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 823 | Open in IMG/M |
| 3300012944|Ga0137410_10129787 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1900 | Open in IMG/M |
| 3300012944|Ga0137410_10465781 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1028 | Open in IMG/M |
| 3300012948|Ga0126375_10056399 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2124 | Open in IMG/M |
| 3300012948|Ga0126375_10469707 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 929 | Open in IMG/M |
| 3300012971|Ga0126369_11290753 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 820 | Open in IMG/M |
| 3300012972|Ga0134077_10116750 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300012972|Ga0134077_10401433 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 592 | Open in IMG/M |
| 3300012976|Ga0134076_10532889 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 540 | Open in IMG/M |
| 3300012977|Ga0134087_10785978 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 514 | Open in IMG/M |
| 3300014154|Ga0134075_10132389 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300015245|Ga0137409_10001530 | All Organisms → cellular organisms → Bacteria | 24981 | Open in IMG/M |
| 3300015245|Ga0137409_10634725 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300015359|Ga0134085_10054261 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1608 | Open in IMG/M |
| 3300015359|Ga0134085_10118746 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300016319|Ga0182033_10276546 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
| 3300017656|Ga0134112_10042293 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1633 | Open in IMG/M |
| 3300017656|Ga0134112_10072036 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1274 | Open in IMG/M |
| 3300017792|Ga0163161_11046866 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300017939|Ga0187775_10260483 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 669 | Open in IMG/M |
| 3300017997|Ga0184610_1201888 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300018052|Ga0184638_1041962 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1662 | Open in IMG/M |
| 3300018052|Ga0184638_1067160 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1311 | Open in IMG/M |
| 3300018056|Ga0184623_10057604 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1779 | Open in IMG/M |
| 3300018058|Ga0187766_10263562 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1106 | Open in IMG/M |
| 3300018063|Ga0184637_10474357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 732 | Open in IMG/M |
| 3300018063|Ga0184637_10537055 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 674 | Open in IMG/M |
| 3300018074|Ga0184640_10052373 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1691 | Open in IMG/M |
| 3300018075|Ga0184632_10220527 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300018431|Ga0066655_10003444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6172 | Open in IMG/M |
| 3300018431|Ga0066655_10026571 | All Organisms → cellular organisms → Bacteria | 2770 | Open in IMG/M |
| 3300018431|Ga0066655_10499050 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300018433|Ga0066667_10142157 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1678 | Open in IMG/M |
| 3300018433|Ga0066667_11770681 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300018468|Ga0066662_10015044 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4164 | Open in IMG/M |
| 3300019259|Ga0184646_1285541 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1069 | Open in IMG/M |
| 3300019789|Ga0137408_1130388 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4858 | Open in IMG/M |
| 3300019789|Ga0137408_1272312 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4670 | Open in IMG/M |
| 3300019789|Ga0137408_1286631 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4462 | Open in IMG/M |
| 3300019789|Ga0137408_1286632 | All Organisms → cellular organisms → Bacteria | 2642 | Open in IMG/M |
| 3300019789|Ga0137408_1377354 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300020170|Ga0179594_10259976 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 655 | Open in IMG/M |
| 3300022534|Ga0224452_1010064 | All Organisms → cellular organisms → Bacteria | 2453 | Open in IMG/M |
| 3300022694|Ga0222623_10210898 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 753 | Open in IMG/M |
| 3300024347|Ga0179591_1142061 | All Organisms → cellular organisms → Bacteria | 3239 | Open in IMG/M |
| 3300025918|Ga0207662_10399294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 932 | Open in IMG/M |
| 3300025972|Ga0207668_11772508 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 557 | Open in IMG/M |
| 3300026089|Ga0207648_10236389 | All Organisms → cellular organisms → Bacteria | 1626 | Open in IMG/M |
| 3300026089|Ga0207648_10851310 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 850 | Open in IMG/M |
| 3300026296|Ga0209235_1056828 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1850 | Open in IMG/M |
| 3300026296|Ga0209235_1136381 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1004 | Open in IMG/M |
| 3300026297|Ga0209237_1004230 | All Organisms → cellular organisms → Bacteria | 8713 | Open in IMG/M |
| 3300026297|Ga0209237_1013213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4881 | Open in IMG/M |
| 3300026309|Ga0209055_1118002 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1015 | Open in IMG/M |
| 3300026315|Ga0209686_1040997 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1731 | Open in IMG/M |
| 3300026315|Ga0209686_1135942 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 784 | Open in IMG/M |
| 3300026317|Ga0209154_1187849 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 813 | Open in IMG/M |
| 3300026324|Ga0209470_1023114 | All Organisms → cellular organisms → Bacteria | 3314 | Open in IMG/M |
| 3300026324|Ga0209470_1246284 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300026325|Ga0209152_10221272 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 708 | Open in IMG/M |
| 3300026334|Ga0209377_1095366 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1243 | Open in IMG/M |
| 3300026342|Ga0209057_1047088 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2068 | Open in IMG/M |
| 3300026351|Ga0257170_1008160 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1268 | Open in IMG/M |
| 3300026523|Ga0209808_1160180 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 844 | Open in IMG/M |
| 3300026524|Ga0209690_1070588 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_40CM_68_15 | 1494 | Open in IMG/M |
| 3300026532|Ga0209160_1063693 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2041 | Open in IMG/M |
| 3300026537|Ga0209157_1002568 | All Organisms → cellular organisms → Bacteria | 14350 | Open in IMG/M |
| 3300026537|Ga0209157_1380440 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 509 | Open in IMG/M |
| 3300026538|Ga0209056_10628177 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 541 | Open in IMG/M |
| 3300026550|Ga0209474_10507524 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 611 | Open in IMG/M |
| 3300027273|Ga0209886_1010746 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
| 3300027384|Ga0209854_1006119 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1805 | Open in IMG/M |
| 3300027511|Ga0209843_1001015 | All Organisms → cellular organisms → Bacteria | 6522 | Open in IMG/M |
| 3300027527|Ga0209684_1006991 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1849 | Open in IMG/M |
| 3300027527|Ga0209684_1011719 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1394 | Open in IMG/M |
| 3300027646|Ga0209466_1001802 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4348 | Open in IMG/M |
| 3300027646|Ga0209466_1030058 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300027654|Ga0209799_1006264 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2482 | Open in IMG/M |
| 3300027655|Ga0209388_1034390 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
| 3300027821|Ga0209811_10010346 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2993 | Open in IMG/M |
| 3300027873|Ga0209814_10003013 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6230 | Open in IMG/M |
| 3300027873|Ga0209814_10041050 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1925 | Open in IMG/M |
| 3300027873|Ga0209814_10237754 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 789 | Open in IMG/M |
| 3300027874|Ga0209465_10006645 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5075 | Open in IMG/M |
| 3300027874|Ga0209465_10264631 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 861 | Open in IMG/M |
| 3300027874|Ga0209465_10312429 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300027880|Ga0209481_10047050 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1991 | Open in IMG/M |
| 3300027903|Ga0209488_10085545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 2350 | Open in IMG/M |
| 3300027909|Ga0209382_10368212 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
| 3300027952|Ga0209889_1010149 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2322 | Open in IMG/M |
| 3300027954|Ga0209859_1005437 | All Organisms → cellular organisms → Bacteria | 2741 | Open in IMG/M |
| 3300027961|Ga0209853_1039306 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
| 3300028380|Ga0268265_10243338 | All Organisms → cellular organisms → Bacteria | 1589 | Open in IMG/M |
| 3300028792|Ga0307504_10013610 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1894 | Open in IMG/M |
| 3300028792|Ga0307504_10174146 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 746 | Open in IMG/M |
| 3300028792|Ga0307504_10217870 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300028814|Ga0307302_10645807 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 526 | Open in IMG/M |
| 3300028828|Ga0307312_10386583 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 918 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1024860 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300031170|Ga0307498_10101152 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10023415 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1591 | Open in IMG/M |
| 3300031199|Ga0307495_10156784 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 594 | Open in IMG/M |
| 3300031226|Ga0307497_10431089 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300031538|Ga0310888_10402508 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300031543|Ga0318516_10203827 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300031544|Ga0318534_10004964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6230 | Open in IMG/M |
| 3300031544|Ga0318534_10664058 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 590 | Open in IMG/M |
| 3300031561|Ga0318528_10205086 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1055 | Open in IMG/M |
| 3300031572|Ga0318515_10050604 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2090 | Open in IMG/M |
| 3300031720|Ga0307469_10046105 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2697 | Open in IMG/M |
| 3300031720|Ga0307469_10081328 | All Organisms → cellular organisms → Bacteria | 2196 | Open in IMG/M |
| 3300031720|Ga0307469_10267960 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300031720|Ga0307469_11693300 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300031724|Ga0318500_10269499 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 829 | Open in IMG/M |
| 3300031740|Ga0307468_100509805 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 956 | Open in IMG/M |
| 3300031740|Ga0307468_102490165 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 507 | Open in IMG/M |
| 3300031777|Ga0318543_10034698 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1984 | Open in IMG/M |
| 3300031794|Ga0318503_10093269 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 952 | Open in IMG/M |
| 3300031820|Ga0307473_10009933 | All Organisms → cellular organisms → Bacteria | 3397 | Open in IMG/M |
| 3300031820|Ga0307473_10034071 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2254 | Open in IMG/M |
| 3300031820|Ga0307473_10170857 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300031821|Ga0318567_10211248 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1085 | Open in IMG/M |
| 3300031894|Ga0318522_10190381 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 776 | Open in IMG/M |
| 3300031908|Ga0310900_11044624 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 673 | Open in IMG/M |
| 3300031940|Ga0310901_10322536 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 654 | Open in IMG/M |
| 3300031943|Ga0310885_10028554 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2157 | Open in IMG/M |
| 3300032003|Ga0310897_10315551 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300032009|Ga0318563_10400432 | Not Available | 743 | Open in IMG/M |
| 3300032044|Ga0318558_10370587 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 711 | Open in IMG/M |
| 3300032055|Ga0318575_10250603 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 893 | Open in IMG/M |
| 3300032063|Ga0318504_10524803 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 568 | Open in IMG/M |
| 3300032067|Ga0318524_10110136 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1371 | Open in IMG/M |
| 3300032075|Ga0310890_11274840 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 600 | Open in IMG/M |
| 3300032180|Ga0307471_100024926 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4481 | Open in IMG/M |
| 3300032180|Ga0307471_100189117 | All Organisms → cellular organisms → Bacteria | 2043 | Open in IMG/M |
| 3300032180|Ga0307471_100623966 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1239 | Open in IMG/M |
| 3300032180|Ga0307471_102461479 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300033433|Ga0326726_10057580 | All Organisms → cellular organisms → Bacteria | 3410 | Open in IMG/M |
| 3300033550|Ga0247829_11400443 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 578 | Open in IMG/M |
| 3300034115|Ga0364945_0177415 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 645 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 14.64% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.64% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.21% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.43% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.64% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.64% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 4.64% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.79% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.71% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.71% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.71% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.36% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.36% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.36% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.36% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.36% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.36% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.36% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.36% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009793 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 | Environmental | Open in IMG/M |
| 3300009803 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 | Environmental | Open in IMG/M |
| 3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
| 3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
| 3300009812 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 | Environmental | Open in IMG/M |
| 3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
| 3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027273 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027384 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027954 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_06456721 | 2228664022 | Soil | MGNPEQLIGAEVANLAAAIERAAADLAMAEEPAGFTVALEGEDESGERRD |
| F12B_100881233 | 3300000443 | Soil | MGNPERLVGAEVANLAAAIERAAADLAMAEEPSGFTVALEGENDAGEERD* |
| F14TC_1004459212 | 3300000559 | Soil | MGNPERLVGAEVANLAAAIERAAADLAMAEEPSGFTVALE |
| F14TB_1011815052 | 3300001431 | Soil | MSHPVRPVSAEVAGLAAAIERAAIDLALAEEPAGFIVALEGEDDPVERRD* |
| JGI25384J37096_100073432 | 3300002561 | Grasslands Soil | MSEPERRVGADVAALAAAIERAAADLAVAEEPAGFVVALEGDDDPGEPRD* |
| JGI25384J37096_100695652 | 3300002561 | Grasslands Soil | MSDPERVVSADVAGLAAAIERAAADLAVAEEPAGFVVALEGESDLGERDD* |
| JGI25382J37095_100217552 | 3300002562 | Grasslands Soil | MSDPERVVSADIAGLAAAIERAAADLAVAEEPAGFVVALEGASDLGERGD* |
| JGI25382J37095_100673062 | 3300002562 | Grasslands Soil | MNAPENRVSADAAGLAAAVERVAADLAIGEEPSGFVLALEGDASPTEPRD* |
| JGI25382J43887_100144244 | 3300002908 | Grasslands Soil | MSEPERRVGADVAALAAAIERAAAXLAVAEEPAGFVVALEGDDDPGEPRD* |
| JGI25386J43895_100501912 | 3300002912 | Grasslands Soil | MSDPERLVSADVAGLAAAIERAAADLAVAEEPAGFVVALEG |
| Ga0066396_100023972 | 3300004267 | Tropical Forest Soil | MTEKEDRVNADVAGLAAAVERVAADLAIAEEPAGFAQALEGEASPDQRRD* |
| Ga0066398_101618872 | 3300004268 | Tropical Forest Soil | MNTPERNARESRVSADVAGLAAAVERIAADLAIAEEPAGFTLALEGESPAETHD* |
| Ga0066395_100873272 | 3300004633 | Tropical Forest Soil | MMTGKEDRVSADVAGLAAAVERVAADLAIAEEPAGFAQALEGEASPDQRRD* |
| Ga0066395_103156841 | 3300004633 | Tropical Forest Soil | RCYDPRTKPVMNDRDKRVSPDVAGLAGAIERMAADLAIGEEPAGFVRALEGDATPTEPRD |
| Ga0066672_101952112 | 3300005167 | Soil | MNAPESRVSADVAGLAAAVERVAADLAIAEEPAGFVLALEGESPTETA* |
| Ga0066672_106193142 | 3300005167 | Soil | VTRCYDPASVMNAPENRVSADAAGLAAAVERVAADLAIGEEPSGFVLALEGDASPTEPRD |
| Ga0066677_100216385 | 3300005171 | Soil | WQRVCRSMNAPESRVSADVAGLAAAVERVAADLAIAEEPAGFVLALEGESPTETA* |
| Ga0066683_100179972 | 3300005172 | Soil | MGNPERRVGAEVANLAAAIERAAADLALAEEPAGFTVALEGEEDADERRD* |
| Ga0066683_100408944 | 3300005172 | Soil | MRRQSAMSEPERRPSAEVAGLAAAIERAAADLAIAEEPAGFTVALEGERDLDERRD* |
| Ga0066680_103994112 | 3300005174 | Soil | MNAPETRVSADAAGLAAAIERVAADLAIGEEPSGFVLALEGDASPTQPRD* |
| Ga0066673_102763472 | 3300005175 | Soil | MRRQSAMSEPERRPSAEVAGLAAAIERAAVDLAIAEEPAGFTVALEGERDLDERRD* |
| Ga0066690_105762242 | 3300005177 | Soil | VTAGAMIPLIKVMNAPENRVGADAAGLAAAIERAAADLAIGEEPAGFVLALEGDAGPAESRD* |
| Ga0066685_1000003912 | 3300005180 | Soil | MSTPENRVSADVAGLAAAVERIAADLAIAEEPAGFVLALEGEIPAEPRD* |
| Ga0066685_101649681 | 3300005180 | Soil | PSAEVAGLAAAIERAAADLAIAEEPAGFTVALEGERDLDERRD* |
| Ga0066678_106064252 | 3300005181 | Soil | MSEPERRPSAEVAGLAAAIERAAADLAIGEEPAGFTVALEGESDLGERRD* |
| Ga0066676_100144292 | 3300005186 | Soil | MGNPERLVGAEVANLAAAIERAAADLALAEEPAGFTVALEGEEDADERRD* |
| Ga0066676_102217752 | 3300005186 | Soil | MIRGESPMNDPEKQVSADVAGLAAAIERMAADLAIGEEPAGFVLALEGDAKPEEPRD* |
| Ga0066676_102616492 | 3300005186 | Soil | MSDPERLVSADVAGLAAAIERAAADLAVAEEPAGFVVALEGEGDPGERRD* |
| Ga0066676_103419052 | 3300005186 | Soil | MSDPERVMSADVAGLAAAIERASADLAVAEAPAGFVVALEGESDRGERGG* |
| Ga0066676_105186212 | 3300005186 | Soil | MSERERKPSAEVAGLAAAIERAAADLAIAEEPSGFTVALEGESELGERRD* |
| Ga0065707_101952642 | 3300005295 | Switchgrass Rhizosphere | MGNPERLVGAEVANLAAAIERAAADLAMTEEPAGFTVALEGEDEAGEPRE* |
| Ga0065707_109677412 | 3300005295 | Switchgrass Rhizosphere | MSDPQNRVSADAAGLAAAIERAAADLAIAEEPAGFVLALE |
| Ga0066388_1000094195 | 3300005332 | Tropical Forest Soil | VSADVAGLAAAVERIAADLAIAEEPAGFTLALEGESPAETHD* |
| Ga0066388_1002889402 | 3300005332 | Tropical Forest Soil | MGNPERLIGAEVANLAAAIERAAADLAMAEEPAGFTVALEGEDESGERRD* |
| Ga0066388_1003920982 | 3300005332 | Tropical Forest Soil | MGNPEWLVGAEVANLAAAIERAAADLAMTEEPAGFTVALEGEDEAGELRE* |
| Ga0066388_1008487512 | 3300005332 | Tropical Forest Soil | MSIPDKRASADVAGLAGAIERLAADLALGEEPAGFVLALEGDPQPVEPRD* |
| Ga0066388_1018112812 | 3300005332 | Tropical Forest Soil | MMSGKEDRVSADVAGLAAAVERVAADLAIAEEPAGFVQALEGQASPDQRRD* |
| Ga0066388_1039981892 | 3300005332 | Tropical Forest Soil | MNDRDKRVSPDVAGLAGAIERMAADLAIGEEPAGFVRALEGDATPTEPRD* |
| Ga0070680_1003162212 | 3300005336 | Corn Rhizosphere | MSDPQNRVSADAAGLAAAIERAAADLAIAEEPAGFVLALEGEATPPDQPRD* |
| Ga0070705_1000364252 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDPEKQVSADVAGLAAAIERMAADLAIGEEPAGFVLALEGGAKSEEPRD* |
| Ga0070708_1009072862 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDPERVVSADVAGLAAAIERAAADLAVAEEPAGFVVALEGESDLDERGD* |
| Ga0066686_100357794 | 3300005446 | Soil | MSEPERRVGADVAALAAAIERAAANLAVAEEPAGFVVALEGDDDPGEPRD* |
| Ga0066686_100772532 | 3300005446 | Soil | MSEPERRPSAEVAGLAAAIERAAADLAIAEEPAGFTVALEGERDLDERRD* |
| Ga0066686_108946082 | 3300005446 | Soil | MSDPERVMSADVAGLAAAIERAAADLAVAEEPAGFVVALEGESDRGERGD* |
| Ga0066689_109767631 | 3300005447 | Soil | MTAGAMIPLANAMNEGESRVGADVAGLVAAIERAAADLAIAEEPAGFVVSLEGAFDEATALRLGH |
| Ga0066682_105247071 | 3300005450 | Soil | RVGAEVANLAAAIERAAADLALAEEPAGFTVALEGEEDADERRD* |
| Ga0070699_1000823321 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAPENRVSADAAGLAAAVERVAADLAIGEEPSGFVLALEGDASPT |
| Ga0070699_1001985851 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDPERVVSADIAGLAAAIERAAADLAVAEEPAGFVVALEGESDLDERGD* |
| Ga0073909_100627662 | 3300005526 | Surface Soil | MNDPEKQVSADVAGLAAAIERMAADLAIGEEPAGFVLALEGDEKPEEPRD* |
| Ga0066697_100790422 | 3300005540 | Soil | MNAPETRLSADAAGLAAAIERVAADLAIGEEPSGFVLALEGDANPTQPRD* |
| Ga0070672_1006047682 | 3300005543 | Miscanthus Rhizosphere | MGNPERLVGAEVANLAAAIERAAADLAMTEEPAGFTVALEGEDEAGEPCE* |
| Ga0070696_1007468101 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | RLVGAEVANLAAAIERAAADLAMTEEPAGFTVALEGEDEAGEPRE* |
| Ga0066701_101322233 | 3300005552 | Soil | MSDPERMVSADVAGLAAAIERAAADLAVAEEPAGFVVALEGESDLDERGD* |
| Ga0066701_107843872 | 3300005552 | Soil | MSEPERRVGADVAALAAAIERAAANLAVAEEPAGFVVALEG |
| Ga0066698_101499522 | 3300005558 | Soil | MGNPEWRVGAEVANLAAAIERAAADLALAEEPAGFTVALEGEEDADERRD* |
| Ga0070664_1005719712 | 3300005564 | Corn Rhizosphere | MSIPDKRASADVAGLAGAIERAAADLAISEEPTGFVLALEGDAQPVEPR |
| Ga0066705_101669941 | 3300005569 | Soil | ADAIMRRQSAMSEPERRPSAEVAGLAAAIERAAADLAIAEEPAGFTVALEGERDLDERRD |
| Ga0066706_102268573 | 3300005598 | Soil | MNAPENRVSADAAGLAAAVERVAADLAIGEEPSGFVLALEGDASPTQPRD* |
| Ga0066905_1001068212 | 3300005713 | Tropical Forest Soil | MNDPQNRVSADAAGLAAAIERAAADLAIAEEPAGFVLALEGEAMPPDETRD* |
| Ga0066905_1001106202 | 3300005713 | Tropical Forest Soil | MSNAERLIGAEAADLAAAIERAAADLAMAEEPAGFTGALEGEDESGERRD* |
| Ga0066905_1004018792 | 3300005713 | Tropical Forest Soil | MGNPVRLVGAEVANLAAAIERAAADLAMTEEPAGFTVALEGENEAGEPRE* |
| Ga0066905_1006274922 | 3300005713 | Tropical Forest Soil | MIRVNASMNAPEKSAPENRVSADAAGLAAAVERIAADLAIAEEPAGFVLALEGERPVEAP |
| Ga0066905_1010515722 | 3300005713 | Tropical Forest Soil | MGNPERLIGAEVANLAAAIERAAADLAMAEEPAGFTVALEGEDESGARRD* |
| Ga0066905_1010627982 | 3300005713 | Tropical Forest Soil | MMSGKEDRVSADVAGLAAAVERVAADLAIAEEPAGFVQVLEGEASPDQRRD* |
| Ga0068861_1019988082 | 3300005719 | Switchgrass Rhizosphere | KQVSADVAGLAAAIERMAADLAIGEEPAGFVLALEGGAKSEEPRD* |
| Ga0066903_1000298126 | 3300005764 | Tropical Forest Soil | MSGKDDRVSADVAGLAAAVERVAADLAIAEEPAGFVQALEGEASSDQRGD* |
| Ga0066903_1004129772 | 3300005764 | Tropical Forest Soil | MNTPERNAPESRVSADVAGLAAAVERIAADLAIAEEPAGFTLALEGDSLAETHD* |
| Ga0066903_1073812012 | 3300005764 | Tropical Forest Soil | MMSGKEDRVSADVAGLAAAVERIAADLAIAEEPAGFTLALEG |
| Ga0068863_1010084942 | 3300005841 | Switchgrass Rhizosphere | MSIPDKRASADVAGLAGAIERAAADLAISEEPAGFVLALEGDAQPVEPRD* |
| Ga0068863_1017773382 | 3300005841 | Switchgrass Rhizosphere | MNDPEKQVSADVAGLAAAIERMAADLAIGEEPAGFVLALEGDAKPEEPRD* |
| Ga0068862_1002594872 | 3300005844 | Switchgrass Rhizosphere | MSDPEQQVSADVAGLAAAIERMAADLAIGEEPAGFVLALEGGAKSEEPRD* |
| Ga0066656_101752052 | 3300006034 | Soil | RVSADAAGLAAAVERVAADLAIGEEPSGFVLALEGDASPTEPRD* |
| Ga0075417_100013611 | 3300006049 | Populus Rhizosphere | MSDPQNRVSADAAGLAAAIERAAADLAIAEEPAGFVLALEGEA |
| Ga0075417_103849622 | 3300006049 | Populus Rhizosphere | MGNPERLVGAEVANLAAAIERAAADLAMTEEPAGFTVALEGEDETGEPRE* |
| Ga0075432_103817842 | 3300006058 | Populus Rhizosphere | MNAPENRVSADAAGLAAAVERVATDLAIGEEPSGFVLALEGDASPTEPRD* |
| Ga0075428_1006934761 | 3300006844 | Populus Rhizosphere | ASEHRVSADAAGLAAAIERIAADLAIAEEPAGFVLALEGDASPPEPRD* |
| Ga0075421_1000444075 | 3300006845 | Populus Rhizosphere | MSASEHRVSADAAGLAAAIERIAADLAIAEEPAGFVLALEGDASPPEPRD* |
| Ga0075421_1002080722 | 3300006845 | Populus Rhizosphere | MQTPENRVSADAAGLAAAIERAANDLAIGEEPAGFVLALEGDASPAEPRD* |
| Ga0075433_106138612 | 3300006852 | Populus Rhizosphere | MSVSDKRASADVAGLAGAIERVAADLALSEEPAGFVLALEGDAQPVESRD* |
| Ga0075433_107366492 | 3300006852 | Populus Rhizosphere | MSIPDKRASADVAGLAGAIERVAADLALSEEPAGFVLALEGDAQPVESRD* |
| Ga0075425_1001328723 | 3300006854 | Populus Rhizosphere | MIRVDAFMKAPENRVSADVAGLAAAVERIAADLAIAEEPAGFVLALEGESPAEPRD* |
| Ga0075425_1002455753 | 3300006854 | Populus Rhizosphere | MNAPENRVSADAAGLAAAVERVAADLAIGEEPSGFALALEGDASPTEPRD* |
| Ga0075426_100531982 | 3300006903 | Populus Rhizosphere | MSILDKRASADVAGLAGAIERVAADLAISEEPAGFVLALEGDAQPVEPRD* |
| Ga0075424_1003016782 | 3300006904 | Populus Rhizosphere | MSVSDKRASADVAGLAGAIERVAADLAISEEPAGFVLALEGDAQPVEPRD* |
| Ga0075424_1010886862 | 3300006904 | Populus Rhizosphere | MSILDKRASADVAGLAGAIERIAADLALSEEPAGFLLTLEGDAQPVESRD* |
| Ga0075436_1007600291 | 3300006914 | Populus Rhizosphere | APENRVSADAAGLAAAVERVAADLAIGEEPSGFVLALEGDASPTEPRD* |
| Ga0075419_1000111214 | 3300006969 | Populus Rhizosphere | MSDPQNRVSADAAGLAAAIERAAADLAVAEEPAGFVLALEGEATPPDEPRD* |
| Ga0099791_100872962 | 3300007255 | Vadose Zone Soil | MNAPENRVSADVAGLAAAVERVAADLAIAEEPAGFVLALEGENPAEPRD* |
| Ga0066710_10000316612 | 3300009012 | Grasslands Soil | MSEPERRPSAEVAGLAAAIERAAADLAIGEEPAGFTVALEGESDLGERRD |
| Ga0066710_1000322948 | 3300009012 | Grasslands Soil | MGNPERRVGAEVANLAAAIERAAADLALAEEPAGFTVALEGEEDADERRD |
| Ga0105250_102556092 | 3300009092 | Switchgrass Rhizosphere | MSDPEKQVSADVAGLAAAIERMAADLAIGEEPAGLVLALEGGAKSEEPRD* |
| Ga0114129_104795622 | 3300009147 | Populus Rhizosphere | MSDPQNRVSADAAGLAAAIERAAADLAIAEEPAGFVLALEGEATPPDEPRG* |
| Ga0075423_100169387 | 3300009162 | Populus Rhizosphere | MSDPEKQVSADVAGLAAAIERMAADLAIGEEPAGFVLALEGDAKTEEPRD* |
| Ga0075423_128564931 | 3300009162 | Populus Rhizosphere | MSIPDKRASADVAGLAGAIERVAADLALSEEPAGFVLALEGDAQPVES |
| Ga0114945_105027962 | 3300009444 | Thermal Springs | MTGPESPVSPDVAKLVAVIEGASADLSMAEEPAGFVVALESGGDDD* |
| Ga0105077_1098402 | 3300009793 | Groundwater Sand | MSAPERRVSADVAGLAAAIERAAVDLALAEEPAGFVVALEGEAEPGEPRD* |
| Ga0105065_10851141 | 3300009803 | Groundwater Sand | EPRVSADVASLAAAIERAAADLALAEEPSGFVVALEGETDPGEDRD* |
| Ga0105071_10015962 | 3300009808 | Groundwater Sand | MSAPEPRVSADVASLAAAIERAAADLALTEEPSGFVVALEGQTDPGEPRD* |
| Ga0105084_10487462 | 3300009811 | Groundwater Sand | MSDPERVVSADVAGLAAAIERAAADLAVAEEPAGFVVALEGESDLGERGD* |
| Ga0105067_10111182 | 3300009812 | Groundwater Sand | MSAPEPRVSADVASLAAAIERAAADLALAEEPSGFVVALEGETDPGEDRD* |
| Ga0105076_10045522 | 3300009816 | Groundwater Sand | MSDPERVVSADVAGLAAAIERAAADLAVAEEPAGFVVALEGESDLGERSD* |
| Ga0105085_10419442 | 3300009820 | Groundwater Sand | MSDPERMVSADVAGLAAAIERAAADLAVAEEPAGFVVALEGESDLGERGD* |
| Ga0126384_116236351 | 3300010046 | Tropical Forest Soil | MSADVAGLAAAVERSAADLAIAEEPAGFVQALEGEASSDQRGD* |
| Ga0126382_101737102 | 3300010047 | Tropical Forest Soil | MNAPEKSAPENRVSADVAGLAAAVERIAADLAIAEEPAGFVLALEGESPVEPRD* |
| Ga0126382_113696911 | 3300010047 | Tropical Forest Soil | MMSGNENSRSADVAGLAAAVERVAADLAIAEEPAGFVQALEGDASADQR |
| Ga0134070_100680712 | 3300010301 | Grasslands Soil | MRRQSAMSEPERRPSAEVAGLAAAIERAAADLAIDEEPAGFTVALEGERDLDERRD* |
| Ga0134080_101170872 | 3300010333 | Grasslands Soil | MRRQSAMSEPERRPSAEVAGLAAAIERAAADLAIAEEPAGFTVALEGERDLDERSD* |
| Ga0134071_1000038614 | 3300010336 | Grasslands Soil | MSTPENRVSADVAGLAAAVERIAADLAIAEEPAGFVLALEGEANPAEPRD* |
| Ga0134071_100020649 | 3300010336 | Grasslands Soil | DTMSTPENRVSADVAGLAAAVERIAVDLAIAEEPAGFVLALEGEIPAEPRD* |
| Ga0126370_100292443 | 3300010358 | Tropical Forest Soil | MSGKDDRVSADVAGLAAAVERIAADLAIAEEPAGFVQALEGEASSDQRGD* |
| Ga0126370_118944422 | 3300010358 | Tropical Forest Soil | MSIPDKRASADVAGLAGAIERVAADLALSEEPAGFVLALEGDPQPVEPRD* |
| Ga0126376_100073051 | 3300010359 | Tropical Forest Soil | ARESRVSADVAGLAAAVERIAADLAIAEEPAGFTLALEGESPAETHD* |
| Ga0126376_100101462 | 3300010359 | Tropical Forest Soil | MNTPERNARESRVSADVAGLAAAVERIAADLAIAEEPAGFTLALEGDSLAETHD* |
| Ga0126376_101745002 | 3300010359 | Tropical Forest Soil | MSGKDDRVSADVASLAAAVERIAADLAIAEEPAGFVQALEGEASSDQRGD* |
| Ga0126376_102102293 | 3300010359 | Tropical Forest Soil | MMTEKEDRVSADVAGLAAAVERVAADLAIAEEPAGFAQALEGEASPDQRRD* |
| Ga0126376_132538412 | 3300010359 | Tropical Forest Soil | MGNPERLVGAEVANLAAAIERAAADLAMTEEPAGFTVALEGEDEAGELRE* |
| Ga0126377_113355312 | 3300010362 | Tropical Forest Soil | MIRVDASMKAPENRVSADVAGLAAAVERIAADLAIAEEPAGFVLALEGESPAEPRD* |
| Ga0126379_108632522 | 3300010366 | Tropical Forest Soil | MGNPERLIGAEVANLAAAIERAAADLAMTEEPAGFTVALEGEDEAGELRE* |
| Ga0126383_128074321 | 3300010398 | Tropical Forest Soil | PERLIGADVANLAAAIERAAADLAMAEEPAGFTVALEGEDESGERRD* |
| Ga0126383_131539562 | 3300010398 | Tropical Forest Soil | MMTGKEDRVSADVAGLAAAVERVAADLAIAEEPAGFVQALEGEASPDQRRD* |
| Ga0137389_100210072 | 3300012096 | Vadose Zone Soil | MNAPENRVSADVAGFAAAVERAAADLAIGEEPAGFVLALEGDASPAEPRD* |
| Ga0137383_110878891 | 3300012199 | Vadose Zone Soil | ERKPSAEDAGLAAAIERAAADLAIAEEPSGFTVALEGESELGERRD* |
| Ga0137363_110151691 | 3300012202 | Vadose Zone Soil | MNAPENRVSADAAGLAAAIERAAVDLAIGEEPAGFVLALEDDANPAKPRD* |
| Ga0137399_102049252 | 3300012203 | Vadose Zone Soil | MGNPERLVGAEVANLAAAIERAAADLALAEEPAGFTVALEGGQDADERRD* |
| Ga0137399_116289762 | 3300012203 | Vadose Zone Soil | MSEPERRPSAEVAGLAAAIERAAADLAIAEEPSGFTVALEGQGDLGERRD* |
| Ga0137374_100186475 | 3300012204 | Vadose Zone Soil | MSDPERVVSADVAGLAAAIERAAADLAVAEEPAGFVVALEGESDPGERGD* |
| Ga0137362_100225705 | 3300012205 | Vadose Zone Soil | MNGPETRVSADAAGLAAAIERAAVDLAIGEEPAGFVLALEDDANPAKPRD* |
| Ga0137380_106327921 | 3300012206 | Vadose Zone Soil | DVAALAAAIERAAANLAVAEEPAGFVVALEGDDDPGEPRD* |
| Ga0137360_105111902 | 3300012361 | Vadose Zone Soil | MNGPETRVSADAAGLAAAIERAAIDLAIGEEPAGFVLALEDDANPAKPRD* |
| Ga0137361_101533081 | 3300012362 | Vadose Zone Soil | MSDPERVVSADVAGLAAAIERAAADLVVAEEPAGFVVALEGESDLGERDD* |
| Ga0137361_102966852 | 3300012362 | Vadose Zone Soil | MSEPERRPSAEVAGLAAAIERAAADLAIAEEPAGFTAALEGESDLDERRD* |
| Ga0137361_107308992 | 3300012362 | Vadose Zone Soil | MNAPENRVSADVAGLAAAVERVAADLAIAEESAGFVLALEGENPAEPRD* |
| Ga0137358_100558684 | 3300012582 | Vadose Zone Soil | MNAPENRVSADVAGLAAAVERVAADLAIAEEPAGFVLALEGENPTEPRD* |
| Ga0137397_102381392 | 3300012685 | Vadose Zone Soil | MSEPERRQSAEVAGLAAAIERAAVDLAIAEEPAGFTVALEGAGDVDEHRD* |
| Ga0137397_105105762 | 3300012685 | Vadose Zone Soil | MNAPENRVSADAAGLAAAVERAAADLAIAEEPAGFVLVLEGEPSPAEPRD* |
| Ga0137396_109031962 | 3300012918 | Vadose Zone Soil | MSEPERKPSAEVAGLAAAIERAAADLAIAEEPSGFTVALEGESELGERRD* |
| Ga0137416_121238541 | 3300012927 | Vadose Zone Soil | MSEPERRPSAEVAGLAAAIERAAADLAIAEEPSGFTVALEGQGDLG |
| Ga0137404_100015787 | 3300012929 | Vadose Zone Soil | MNGPETRVSADAAGLAAAIERAAADLAIGEEPAGFVLALEDDANPAKPRD* |
| Ga0137404_100180755 | 3300012929 | Vadose Zone Soil | MGNPERLVGAEVANLAAAIERAAADLALAEEPAGFTVALEGEEDERRD* |
| Ga0137404_114128222 | 3300012929 | Vadose Zone Soil | MSDPERLVSADVAAAIERAAADLAVAEEPAGFVVALEGESDLGARGD* |
| Ga0137407_109296602 | 3300012930 | Vadose Zone Soil | MGNPERLVGAEVANLAAAIERAAADLALAEEPAGFTVALEGEED |
| Ga0137410_101297872 | 3300012944 | Vadose Zone Soil | MSEPERRPSAEVAGLAAAIERAAVDLAIAEEPAGFTVALEGAGDVDEHRD* |
| Ga0137410_104657812 | 3300012944 | Vadose Zone Soil | MRRQIPHMSEPERRPSAEVAGLAAAIERAAADLAIAEEPAGFTAALEGESDLDERRD* |
| Ga0126375_100563992 | 3300012948 | Tropical Forest Soil | VSADVAGLAAAVERIAADLAIAEEPAGFTLALEGDSLAETHD* |
| Ga0126375_104697071 | 3300012948 | Tropical Forest Soil | RWRDGMGNPERLIGAEVANLAAAIERAAADLAMAEEPAGFTVALEGEDESGARRD* |
| Ga0126369_112907532 | 3300012971 | Tropical Forest Soil | MGNPERLVGAEVANLAAAIERAAADLAMTEEPAGFTVALEGENEVGELGE* |
| Ga0134077_101167502 | 3300012972 | Grasslands Soil | MNAPETRLSADAAGLAAAIERVAADLAIGEEPSGFVLALEGDASPTQPRD* |
| Ga0134077_104014331 | 3300012972 | Grasslands Soil | MSDPERVVSADVTGLAAAIERAAADLAVAEEPAGFVVALEGESDLDERGD* |
| Ga0134076_105328892 | 3300012976 | Grasslands Soil | MNAPETRVSADAAGLAAAIERVAADLAIGEEPSGFVLALEGDANPTQPRD* |
| Ga0134087_107859782 | 3300012977 | Grasslands Soil | MSTPENRVSADVAGLAAAVERIAADLAIAEEPAGFVLALEGESPTETA* |
| Ga0134075_101323892 | 3300014154 | Grasslands Soil | MNAPENRVSADAAGLAAAVERVAADLAIGEEPSGFVLALEGDANPTQPRD* |
| Ga0137409_1000153013 | 3300015245 | Vadose Zone Soil | MGNPERLVGAEVANLAAAIERAAADLALAEEPAGFTVALEGEEEADERRD* |
| Ga0137409_106347252 | 3300015245 | Vadose Zone Soil | MSDPERVVSADVAGLAAAIERAAADLAVAEEPAGFVVALEGESDLGARGD* |
| Ga0134085_100542611 | 3300015359 | Grasslands Soil | MRRQSAMSEPERRPSAEVAGLAAAIERAAADLAIAEEPAGFTVALEGERDLD |
| Ga0134085_101187462 | 3300015359 | Grasslands Soil | MSDPERLVSADVAGLAAAIERAAADLAVAEEPAGFVVALEGESDRGERGD* |
| Ga0182033_102765462 | 3300016319 | Soil | MNDRDKRVSPDVAGLAGAIERMAADLAIGEEPAGFVRALEGDATPAEPRD |
| Ga0134112_100422932 | 3300017656 | Grasslands Soil | MSDPERVMSADVAGLAAAIERAAADLAVAEEPAGFVVALEGESDRGERGD |
| Ga0134112_100720363 | 3300017656 | Grasslands Soil | MGNPERLVGAEVANLAAAIERAAADLALAEEPAGFTVALEDEEDADERRD |
| Ga0163161_110468662 | 3300017792 | Switchgrass Rhizosphere | MSDPEKQVSADVAGLAAAIERMAADLAIGEEPAGFVLALEGGAKSEEPRD |
| Ga0187775_102604831 | 3300017939 | Tropical Peatland | MSNADKRVSAEVAGLAGAVERVAVDLAIGEEPAGFVVALEGDVKSAEPRD |
| Ga0184610_12018882 | 3300017997 | Groundwater Sediment | MSDPDRVVSADVAGLAAAIERAAADLAVAEEPAGFVVALEGESDLGERGD |
| Ga0184638_10419623 | 3300018052 | Groundwater Sediment | MSNPERVVSADVAGLAAAIERAAADLAVAEEPAGFVVALEGESDL |
| Ga0184638_10671601 | 3300018052 | Groundwater Sediment | RVVSADVAGLAAAIERAAADLAVAEEPAGFVVALEGESDLGERGD |
| Ga0184623_100576042 | 3300018056 | Groundwater Sediment | MSNPERVVSADVAGLAAAIERAAADLAVAEEPAGFVVALEGESDLDERGD |
| Ga0187766_102635621 | 3300018058 | Tropical Peatland | MNDRDKRVSPDVAGLAGAIERMAADLAIGEEPAGFVRALEGDATSAEPRD |
| Ga0184637_104743571 | 3300018063 | Groundwater Sediment | PERVVSADVAGLAAAIERAAADLAVAEEPAGFVVALEGESDLGERGD |
| Ga0184637_105370552 | 3300018063 | Groundwater Sediment | MSNPERVVSADVAGLAAAIERAAADLAVAEEPAGFVVALEGES |
| Ga0184640_100523731 | 3300018074 | Groundwater Sediment | MSNPERVVSADVAGLAAAIERAAADLAVAEEPAGFVVALEGESVL |
| Ga0184632_102205272 | 3300018075 | Groundwater Sediment | MSNPERVVSADVAGLAAAIERAAADLAVAEEPAGFVVALEGESDLGARGD |
| Ga0066655_100034445 | 3300018431 | Grasslands Soil | MSTPENRVSADVAGLAAAVERIAADLAIAEEPAGFVLALEGEIPAEPRD |
| Ga0066655_100265714 | 3300018431 | Grasslands Soil | MRRQSAMSEPERRPSAEVAGLAAAIERAAADLAIAEEPAGFTVALEGERDLDERRD |
| Ga0066655_104990502 | 3300018431 | Grasslands Soil | MNAPENRVSADAAGLAAAVERVAADLAIGEEPSGFVLALECDASQTEPRD |
| Ga0066667_101421574 | 3300018433 | Grasslands Soil | MNAPENRVSADAAGLAAAVERVAADLAIGEEPSGFVLALEGDASPTEPRD |
| Ga0066667_117706812 | 3300018433 | Grasslands Soil | MSDPERLVSADVAGLAAAIERAAADLAVAEEPAGFVVALEGEGDPGERRD |
| Ga0066662_100150442 | 3300018468 | Grasslands Soil | MNAPETRVSADAAGLAAAIERVAADLAIGEEPSGFVLALEGDASPTQPRD |
| Ga0184646_12855412 | 3300019259 | Groundwater Sediment | MSDPERVVSADVAGLAAAIERAAADLAVAEEPAGFVVALEGESDLDERGD |
| Ga0137408_11303886 | 3300019789 | Vadose Zone Soil | MGNPERLVGAEVANLAAAIERAAADLALAEEPAGFTVALEGEEDERRD |
| Ga0137408_12723126 | 3300019789 | Vadose Zone Soil | MGNPERLVGAEVANLAAAIERAAADLALAEEPAGFTVALEGEEDADERRD |
| Ga0137408_12866315 | 3300019789 | Vadose Zone Soil | MNGPETRVSADAAGLAAAIERAAADLAIGEEPAGFVLALEDDANPAKPRD |
| Ga0137408_12866322 | 3300019789 | Vadose Zone Soil | MNGPETRVSADAAGLAAAIERAAADLAIAEEPAGFVLALEDDANPAKPRD |
| Ga0137408_13773542 | 3300019789 | Vadose Zone Soil | VSADAAGLAAAIERAAADLAIGEEPAGFVLALEDDANPAKPRD |
| Ga0179594_102599761 | 3300020170 | Vadose Zone Soil | MNGPETRVSADAAGLAAAIERAAVDLAIGEEPAGFVLALEDDANPAKPRD |
| Ga0224452_10100642 | 3300022534 | Groundwater Sediment | MSDPERVVSADVAGLAAAIERAAADLAVAEEPAGFVVALEGESDLGARGD |
| Ga0222623_102108981 | 3300022694 | Groundwater Sediment | SDPERVVSADVAGLAAAIERAAADLAVAEEPAGFVVALEGESDLGARGD |
| Ga0179591_11420615 | 3300024347 | Vadose Zone Soil | MIRGESPMNDPEKQVSADVAGLAAAIERMAADLAIGEEPAGFVLALEGDAKPEEPRD |
| Ga0207662_103992943 | 3300025918 | Switchgrass Rhizosphere | MGNPERLVGAEVANLAAAIERAAADLAMTEEPAGFTVALEGEDEAGEPRE |
| Ga0207668_117725081 | 3300025972 | Switchgrass Rhizosphere | RLVGAEVANLAAAIERAAADLAMTEEPAGFTVALEGEDEAGEPRE |
| Ga0207648_102363892 | 3300026089 | Miscanthus Rhizosphere | MNDPEKQVSADVAGLAAAIERMAADLAIGEEPAGFVLALEGDAKPEEPRD |
| Ga0207648_108513101 | 3300026089 | Miscanthus Rhizosphere | RWRDDMGNPERLVGAEVANLAAAIERAAADLAMTEEPAGFTVALEGEDEAGEPCE |
| Ga0209235_10568282 | 3300026296 | Grasslands Soil | MSEPERRVGADVAALAAAIERAAANLAVAEEPAGFVVALEGDDDPGEPRD |
| Ga0209235_11363812 | 3300026296 | Grasslands Soil | MSEPERRPSAEVAGLAAAIERAAADLAIAEEPAGFTAALEGESDLDERRD |
| Ga0209237_10042308 | 3300026297 | Grasslands Soil | MSEPERRVGADVAALAAAIERAAADLAVAEEPAGFVVALEGDDDPGEPRD |
| Ga0209237_10132135 | 3300026297 | Grasslands Soil | MSDPERVVSADVAGLAAAIERAAADLAVAEEPAGFVVALEGESDLGERDD |
| Ga0209055_11180022 | 3300026309 | Soil | MNAPESRVSADVAGLAAAVERVAADLAIAEEPAGFVLALEGESPTETA |
| Ga0209686_10409973 | 3300026315 | Soil | WQRVCRSMNAPESRVSADVAGLAAAVERVAADLAIAEEPAGFVLALEGESPTETA |
| Ga0209686_11359421 | 3300026315 | Soil | APETRVSADAAGLAAAIERVAADLAIGEEPSGFVLALEGDASPTQPRD |
| Ga0209154_11878492 | 3300026317 | Soil | AGNASVGPMNAPESRVSADVAGLAAAVERVAADLAIAEEPAGFVLALEGESPTETA |
| Ga0209470_10231143 | 3300026324 | Soil | MSDPERVMSADVAGLAAAIERASADLAVAEAPAGFVVALEGESDRGERGG |
| Ga0209470_12462842 | 3300026324 | Soil | MNAPETRLSADAAGLAAAIERVAADLAIGEEPSGFVLALEGDASPTQPRD |
| Ga0209152_102212722 | 3300026325 | Soil | VTRCYDLASVMNAPENRVSADAAGLAAAVERVAADLAIGEEPSGFVLALEGDASPTEPRD |
| Ga0209377_10953662 | 3300026334 | Soil | MSEPERRVGADVAALAAAIERAAADLAVVEEPAGFVVALEGDDDPGDR |
| Ga0209057_10470882 | 3300026342 | Soil | MNAPETRLSADAAGLAAAIERVAADLAIGEEPSGFVLALEGDANPTQPRD |
| Ga0257170_10081601 | 3300026351 | Soil | MSDPERVVSADVAGLAAAIERAAADLAVAEEPAGFVVALEGES |
| Ga0209808_11601801 | 3300026523 | Soil | GAMIRWQRVCRSMNAPESRVSADVAGLAAAVERVAADLAIAEEPAGFVLALEGESPTETA |
| Ga0209690_10705882 | 3300026524 | Soil | MSDPERMVSADVAGLAAAIERAAADLAVAEEPAGFVVALEGESDLDERGD |
| Ga0209160_10636933 | 3300026532 | Soil | MRRQSAMSEPERRPSAEVAGLAAAIERAAVDLAIAEEPAGFTVALEGERDLDERRD |
| Ga0209157_10025684 | 3300026537 | Soil | MSDPERVMSADVAGLAAAIERAAADLAVAEEPAGFVVALEGESDRGERGG |
| Ga0209157_13804402 | 3300026537 | Soil | MNAPETRVSADAAGLAAAIERVAADLAIGEEPSGFVLALE |
| Ga0209056_106281771 | 3300026538 | Soil | MNAPENRVSADAAGLAAAVERVAADLAIGEEPSGFVLALEGD |
| Ga0209474_105075242 | 3300026550 | Soil | MIRWQRVCRSMNAPESRVSADVAGLAAAVERVAADLAIAEEPAGFVLALEGESPTETA |
| Ga0209886_10107462 | 3300027273 | Groundwater Sand | MSAPEPRVSADVASLAAAIERAAADLALTEEPSGFVVALEGQTDPGEPRD |
| Ga0209854_10061192 | 3300027384 | Groundwater Sand | MSAPEPRVSADVASLAAAIERAAADLALAEEPSGFVVALEGETDPGEDRD |
| Ga0209843_10010157 | 3300027511 | Groundwater Sand | MSDPERVVSADVAGLAAAIERAAADLALAEEPAGFVVALEGESDLGER |
| Ga0209684_10069912 | 3300027527 | Tropical Forest Soil | MSGKDDRVSADVASLAAAVERIAADLAIAEEPAGFVQALEGEASSDQRGD |
| Ga0209684_10117192 | 3300027527 | Tropical Forest Soil | MTEKEDRVNADVAGLAAAVERVAADLAIAEEPAGFAQALEGEASPDQRRD |
| Ga0209466_10018023 | 3300027646 | Tropical Forest Soil | MNAPEKSAPENRVSADVAGLAAAVERIAADLAIAEEPAGFVLALEGESPVEPRD |
| Ga0209466_10300582 | 3300027646 | Tropical Forest Soil | MGNPVRLVGAEVANLAAAIERAAADLAMTEEPAGFTVALEGENEAGEPRE |
| Ga0209799_10062642 | 3300027654 | Tropical Forest Soil | MNTPERNARESRVSADVAGLAAAVERIAADLAIAEEPAGFTLALEGESPAETHD |
| Ga0209388_10343902 | 3300027655 | Vadose Zone Soil | MGNPERLVGAEVANLAAAIERAAADLALAEEPAGFTVALEGEEEADERRD |
| Ga0209811_100103462 | 3300027821 | Surface Soil | MNDPEKQVSADVAGLAAAIERMAADLAIGEEPAGFVLALEGDEKPEEPRD |
| Ga0209814_100030136 | 3300027873 | Populus Rhizosphere | MSDPQNRVSADAAGLAAAIERAAADLAIAEEPAGFVLALEGEATPPDEPRD |
| Ga0209814_100410503 | 3300027873 | Populus Rhizosphere | HRVSADAAGLAAAIERIAADLAIAEEPAGFVLALEGDASPPEPRD |
| Ga0209814_102377541 | 3300027873 | Populus Rhizosphere | VLSSRWRDDMGNPERLVGAEVANLAAAIERAAADLAMTEEPAGFTVALEGEDETGEPRE |
| Ga0209465_100066452 | 3300027874 | Tropical Forest Soil | MNTPERNARESRVSADVAGLAAASERIAADLAIAEEPAGFTLALEGESPAETHD |
| Ga0209465_102646312 | 3300027874 | Tropical Forest Soil | KPVMNDRDKRVSPDVAGLAGAIERMAADLAIGEEPAGFVRALEGDATPTEPRD |
| Ga0209465_103124292 | 3300027874 | Tropical Forest Soil | MMTGKEDRVSADVAGLAAAVERVAADLAIAEEPAGFAQALEGEASPDQRRD |
| Ga0209481_100470502 | 3300027880 | Populus Rhizosphere | MSASEHRVSADAAGLAAAIERIAADLAIAEEPAGFVLALEGDASPPEPRD |
| Ga0209488_100855452 | 3300027903 | Vadose Zone Soil | MNAPENRVSADVAGFAAAVERAAADLAIGEEPAGFVLALEGDASPAEPRD |
| Ga0209382_103682122 | 3300027909 | Populus Rhizosphere | MQTPENRVSADAAGLAAAIERAANDLAIGEEPAGFVLALEGDASPAEPRD |
| Ga0209889_10101492 | 3300027952 | Groundwater Sand | MSDPERVVSADVAGLAAAIERAAADLALAEEPAGFVVALEGESDLGERSD |
| Ga0209859_10054372 | 3300027954 | Groundwater Sand | MSDPERMVSADVAGLAAAIERAAADLAVAEEPAGFVVALEGESDLGERSD |
| Ga0209853_10393062 | 3300027961 | Groundwater Sand | MSAPERRVSADVAGLAAAIERAAVDLALAEEPAGFVVALEGEAEPGEPRD |
| Ga0268265_102433382 | 3300028380 | Switchgrass Rhizosphere | MSDPEQQVSADVAGLAAAIERMAADLAIGEEPAGFVLALEGGAKSEEPRD |
| Ga0307504_100136102 | 3300028792 | Soil | MNAPENRVSADVAGLAAAIERAAADLAIGEEPAGFVLALEGDAGPAEPRD |
| Ga0307504_101741462 | 3300028792 | Soil | MIRDESPMNDPEKQVSADVAGLAAAIERMAADLAIGEEPAGFVLALEGDAKPEEPRD |
| Ga0307504_102178702 | 3300028792 | Soil | MNVPEKRVSADVAGLAAVIERLAADLAIGEEPSGFALALEGDGKPAEPRD |
| Ga0307302_106458071 | 3300028814 | Soil | MSDLERVVSADVAGLAAAIERAAADLAVAEEPAGFVVALEGES |
| Ga0307312_103865831 | 3300028828 | Soil | MSDPERVVSADVAGLAAAIERAAADLAVAEEPAGFVVALEGESDL |
| (restricted) Ga0255311_10248602 | 3300031150 | Sandy Soil | MNAPENRVSADVAGLAAAIERTAADLAIGEEPAGFVLALEGDAGPAEPRD |
| Ga0307498_101011522 | 3300031170 | Soil | MKDPEKQVSADVAGLAAAIERMAADLAIGEEPAGFVLALEGDAKPEEPRD |
| (restricted) Ga0255310_100234153 | 3300031197 | Sandy Soil | MNAPENRVSADVAGLAAAIERAVADLAIGEEPAGFVLALEGDAGPAEPRD |
| Ga0307495_101567842 | 3300031199 | Soil | MIRDESPMNDPEKQVSADVAGLAAAIERMAADLAIGEEPAGFVLALEGDAKPEEPHD |
| Ga0307497_104310892 | 3300031226 | Soil | MGNPERLVGAEVANLAAAIERAAADLAMAEEPAGFTVALEGADDAGEGRD |
| Ga0310888_104025082 | 3300031538 | Soil | MSDPQNRVSADAAGLAAAIERAAADLAIAEEPAGFVLALEGEATPPDQPRD |
| Ga0318516_102038272 | 3300031543 | Soil | MMTEKEDRVSADVAGLAAAVERVAADLAIAEEPAGFAQALEGEASPDQRRD |
| Ga0318534_100049645 | 3300031544 | Soil | MMTEKEDRVSADVAGLGAAVERVAADLAIAEEPAGFAQALEGEASPDQRRD |
| Ga0318534_106640582 | 3300031544 | Soil | KRVSPDVAGLAGAIERMAADLAIGEEPAGFVRALEGDATSAEPRD |
| Ga0318528_102050861 | 3300031561 | Soil | MNDRDKRVSPDVAGLAGAIERMAADLAIGEEPAGFVRALEGDATSAE |
| Ga0318515_100506042 | 3300031572 | Soil | MNDRDKRVSPDVAGLAGAIERMAADLAIGEEPAGFVRALEGDATSAERRD |
| Ga0307469_100461053 | 3300031720 | Hardwood Forest Soil | MGNPERLVGAEVANLAAAIERAAADLAMAEEPAGFTAALEGEGDAGQGRD |
| Ga0307469_100813282 | 3300031720 | Hardwood Forest Soil | MIRVDAFMKAPENRVSADVAGLAAAVERIAADLAIAEEPAGFVLALEGESPAEPRD |
| Ga0307469_102679602 | 3300031720 | Hardwood Forest Soil | MNDPEKQVSADVAGLAAAIERMATDLAIGEEPAGFVLALEGDAKPEEPRD |
| Ga0307469_116933002 | 3300031720 | Hardwood Forest Soil | MSEPERRPSAEVAGLAAAIERAAADLAIAEEPSGFTAALEGQSDLGEPRRD |
| Ga0318500_102694991 | 3300031724 | Soil | TKPVMNDRDKRVSPDVAGLAGAIERMAADLAIGEEPAGFVRALEGDATSAEPRD |
| Ga0307468_1005098051 | 3300031740 | Hardwood Forest Soil | MSDPEKQVSADVAGLAAAIERMAADLAIGEEPAGFVLALEGDAKPEEPRD |
| Ga0307468_1024901651 | 3300031740 | Hardwood Forest Soil | MSEPERRPSAEVAGLAAAIERAAADLAIAEEPSGFTVALEGESDLGDR |
| Ga0318543_100346984 | 3300031777 | Soil | MMTEKEDRVSADVAGLAAAVERVAADLAIAEEPAGFAQALEGEASPD |
| Ga0318503_100932691 | 3300031794 | Soil | MNDRDKRVSPDVAGLAGAIERMAADLAIGEEPAGFVRALEGDATSAEP |
| Ga0307473_100099333 | 3300031820 | Hardwood Forest Soil | MNAPENRVSADVAGLAAAVERVAADLAIAEEPAGFVLALEGDSPADPS |
| Ga0307473_100340713 | 3300031820 | Hardwood Forest Soil | RCYDPRRRVMKAPENRVSADVAGLAAAVERIAADLAIAEEPAGFVLALEGESPAEPRD |
| Ga0307473_101708572 | 3300031820 | Hardwood Forest Soil | MGNPEQLIGAEVANLAAAIERAAADLAMAEEPAGFTAALEGEGDAGQGRD |
| Ga0318567_102112481 | 3300031821 | Soil | TRVPMMTEKEDRVSADVAGLGAAVERVAADLAIAEEPAGFAQALEGEASPDQRRD |
| Ga0318522_101903812 | 3300031894 | Soil | DRVSADVAGLAAAVERVAADLAIAEEPAGFAQALEGEASPDQRRD |
| Ga0310900_110446242 | 3300031908 | Soil | GRCYHPPVMSDPQNRVSADAAGLAAAIERAAADLAIAEEPAGFVLALEGEATPPDQPRD |
| Ga0310901_103225362 | 3300031940 | Soil | RRKSMMNDPEKQVSADVAGLAAAIERMAADLAIGEEPAGFVLALEGDEKPEEPRD |
| Ga0310885_100285541 | 3300031943 | Soil | VSADAAGLAAAIERAAADLAIAEEPAGFVLALEGEATPPDQPRD |
| Ga0310897_103155512 | 3300032003 | Soil | MMNDPEKQVSADVAGLAAAIERMAADLAIGEEPAGFVLALEGDAKPEEPRD |
| Ga0318563_104004321 | 3300032009 | Soil | MMTEKEDRVSADVAGLGAAVERVAADLAIAEEPAGFAQALEGEASP |
| Ga0318558_103705872 | 3300032044 | Soil | MNDRDKRVSPDVAGLAGAIARMAADLAIGEEPAGFVRALEGDATSAEPRD |
| Ga0318575_102506031 | 3300032055 | Soil | MMTEKEDRVSADVAGLAAAVERVAADLAIAEEPAGFAQALEGEAS |
| Ga0318504_105248031 | 3300032063 | Soil | RVSPDVAGLAGAIERMAADLAIGEEPAGFVRALEGDATSAERRD |
| Ga0318524_101101361 | 3300032067 | Soil | DRVSADVAGLGAAVERVAADLAIAEEPAGFAQALEGEASPDQRRD |
| Ga0310890_112748401 | 3300032075 | Soil | NDPEKQVSADVAGLAAAIERMAADLAIGEEPAGFVLALEGDAKPEEPRD |
| Ga0307471_1000249266 | 3300032180 | Hardwood Forest Soil | MIRVNAPMNAPESRVSADVAGLAAAVERIAADLAIAEEPAGFVLALEGESPAEPRD |
| Ga0307471_1001891172 | 3300032180 | Hardwood Forest Soil | MNDPEKRVSADVAGLAAAIERVAADLAIGEEPAGFVLALEGDAKPTEPRD |
| Ga0307471_1006239661 | 3300032180 | Hardwood Forest Soil | MGNPERLIGAEVANLAAAIERAAVDIAMAEEPAGFTVALEGEDEDGR |
| Ga0307471_1024614792 | 3300032180 | Hardwood Forest Soil | MGNPERRLVGAEVANLAAAIERAAADLALAEEPAGFTVALEGEEDAGERRD |
| Ga0326726_100575803 | 3300033433 | Peat Soil | MHDPEKRVSADVAGLAAAIERMAADLAIGEEPAGFVLALDGDAKPAEPRD |
| Ga0247829_114004432 | 3300033550 | Soil | MGNPERLVGAEVANLAAAIERAAPDLAMTEEPAGFTVALEGEDEAGEPRE |
| Ga0364945_0177415_108_260 | 3300034115 | Sediment | MGNPERLVGAEVANLAAAIERAAADLAMAEEPAGFTAALEGEDDAGEGRD |
| ⦗Top⦘ |