Basic Information | |
---|---|
Family ID | F012502 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 280 |
Average Sequence Length | 40 residues |
Representative Sequence | KDDAALEAHRAAPHFLQHAKKDLPKIADRVEGHLFEPLG |
Number of Associated Samples | 228 |
Number of Associated Scaffolds | 280 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.57 % |
% of genes from short scaffolds (< 2000 bps) | 89.29 % |
Associated GOLD sequencing projects | 217 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.29 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (87.500 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.714 % of family members) |
Environment Ontology (ENVO) | Unclassified (20.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.929 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.94% β-sheet: 0.00% Coil/Unstructured: 88.06% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 280 Family Scaffolds |
---|---|---|
PF00334 | NDK | 36.79 |
PF01361 | Tautomerase | 28.57 |
PF00549 | Ligase_CoA | 4.64 |
PF06649 | DUF1161 | 3.57 |
PF08442 | ATP-grasp_2 | 2.50 |
PF02629 | CoA_binding | 2.14 |
PF13649 | Methyltransf_25 | 1.07 |
PF00326 | Peptidase_S9 | 1.07 |
PF01609 | DDE_Tnp_1 | 0.71 |
PF14534 | DUF4440 | 0.71 |
PF13302 | Acetyltransf_3 | 0.71 |
PF02922 | CBM_48 | 0.71 |
PF03551 | PadR | 0.71 |
PF12867 | DinB_2 | 0.36 |
PF07883 | Cupin_2 | 0.36 |
PF08241 | Methyltransf_11 | 0.36 |
PF00076 | RRM_1 | 0.36 |
PF11455 | MazE-like | 0.36 |
PF03992 | ABM | 0.36 |
PF03473 | MOSC | 0.36 |
PF01346 | FKBP_N | 0.36 |
PF04434 | SWIM | 0.36 |
PF02885 | Glycos_trans_3N | 0.36 |
PF00892 | EamA | 0.36 |
PF00903 | Glyoxalase | 0.36 |
PF02055 | Glyco_hydro_30 | 0.36 |
PF01042 | Ribonuc_L-PSP | 0.36 |
PF00583 | Acetyltransf_1 | 0.36 |
PF02567 | PhzC-PhzF | 0.36 |
PF02635 | DrsE | 0.36 |
PF13662 | Toprim_4 | 0.36 |
COG ID | Name | Functional Category | % Frequency in 280 Family Scaffolds |
---|---|---|---|
COG0105 | Nucleoside diphosphate kinase | Nucleotide transport and metabolism [F] | 36.79 |
COG1942 | Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 28.57 |
COG0045 | Succinyl-CoA synthetase, beta subunit | Energy production and conversion [C] | 7.14 |
COG0458 | Carbamoylphosphate synthase large subunit | Amino acid transport and metabolism [E] | 5.00 |
COG0074 | Succinyl-CoA synthetase, alpha subunit | Energy production and conversion [C] | 4.64 |
COG0151 | Phosphoribosylamine-glycine ligase | Nucleotide transport and metabolism [F] | 2.50 |
COG0026 | Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) | Nucleotide transport and metabolism [F] | 2.50 |
COG1042 | Acyl-CoA synthetase (NDP forming) | Energy production and conversion [C] | 2.50 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.71 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.71 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.71 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.71 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.71 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.71 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.71 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.71 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.71 |
COG4279 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.36 |
COG4715 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.36 |
COG0545 | FKBP-type peptidyl-prolyl cis-trans isomerase | Posttranslational modification, protein turnover, chaperones [O] | 0.36 |
COG5431 | Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain | General function prediction only [R] | 0.36 |
COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 0.36 |
COG5520 | O-Glycosyl hydrolase | Cell wall/membrane/envelope biogenesis [M] | 0.36 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.36 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 87.50 % |
Unclassified | root | N/A | 12.50 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459019|G14TP7Y01C8NF6 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300000567|JGI12270J11330_10012197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5643 | Open in IMG/M |
3300000789|JGI1027J11758_12735644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 523 | Open in IMG/M |
3300000789|JGI1027J11758_12904545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
3300000955|JGI1027J12803_102244865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 536 | Open in IMG/M |
3300001305|C688J14111_10210120 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Edwardsbacteria | 606 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100823176 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300003324|soilH2_10119987 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
3300004082|Ga0062384_100652962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 719 | Open in IMG/M |
3300004092|Ga0062389_104486853 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300004121|Ga0058882_1416737 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300005167|Ga0066672_10313568 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
3300005332|Ga0066388_107774499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 537 | Open in IMG/M |
3300005364|Ga0070673_101941859 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300005437|Ga0070710_10003164 | All Organisms → cellular organisms → Bacteria | 7800 | Open in IMG/M |
3300005467|Ga0070706_101561616 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300005540|Ga0066697_10686285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 561 | Open in IMG/M |
3300005541|Ga0070733_10037771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3012 | Open in IMG/M |
3300005541|Ga0070733_10076420 | All Organisms → cellular organisms → Bacteria | 2115 | Open in IMG/M |
3300005549|Ga0070704_101096768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 723 | Open in IMG/M |
3300005555|Ga0066692_10666842 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300005559|Ga0066700_10097671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1919 | Open in IMG/M |
3300005561|Ga0066699_10556653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 822 | Open in IMG/M |
3300005578|Ga0068854_100015244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 5088 | Open in IMG/M |
3300005607|Ga0070740_10358131 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300005610|Ga0070763_10967715 | Not Available | 509 | Open in IMG/M |
3300005614|Ga0068856_101030110 | Not Available | 841 | Open in IMG/M |
3300005650|Ga0075038_10583356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 527 | Open in IMG/M |
3300005841|Ga0068863_100792799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 945 | Open in IMG/M |
3300005876|Ga0075300_1041554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 644 | Open in IMG/M |
3300006047|Ga0075024_100396135 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300006050|Ga0075028_100385087 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300006050|Ga0075028_100976407 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300006052|Ga0075029_101021440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
3300006059|Ga0075017_100071747 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2366 | Open in IMG/M |
3300006059|Ga0075017_100254227 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
3300006059|Ga0075017_101055599 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300006059|Ga0075017_101311967 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300006059|Ga0075017_101340600 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300006102|Ga0075015_100863067 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300006162|Ga0075030_100585422 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
3300006172|Ga0075018_10118972 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
3300006175|Ga0070712_101154593 | Not Available | 673 | Open in IMG/M |
3300006176|Ga0070765_100419114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 1252 | Open in IMG/M |
3300006354|Ga0075021_10006222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6330 | Open in IMG/M |
3300006796|Ga0066665_10362084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 1186 | Open in IMG/M |
3300006797|Ga0066659_10839768 | Not Available | 763 | Open in IMG/M |
3300006797|Ga0066659_11487618 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300006800|Ga0066660_11111215 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300006854|Ga0075425_100764433 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
3300006871|Ga0075434_101299813 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300006904|Ga0075424_102472594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 544 | Open in IMG/M |
3300006954|Ga0079219_11120576 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300007265|Ga0099794_10462479 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300007982|Ga0102924_1002597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 19557 | Open in IMG/M |
3300007982|Ga0102924_1133748 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
3300007982|Ga0102924_1261119 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300009012|Ga0066710_103492903 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300009012|Ga0066710_103796005 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300009029|Ga0066793_10218399 | Not Available | 1108 | Open in IMG/M |
3300009090|Ga0099827_10668869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
3300009090|Ga0099827_11735618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
3300009137|Ga0066709_103027208 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300009156|Ga0111538_13177290 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300009174|Ga0105241_10109156 | All Organisms → cellular organisms → Bacteria | 2213 | Open in IMG/M |
3300009520|Ga0116214_1242729 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300009520|Ga0116214_1246740 | Not Available | 678 | Open in IMG/M |
3300009521|Ga0116222_1027495 | All Organisms → cellular organisms → Bacteria | 2535 | Open in IMG/M |
3300009522|Ga0116218_1081328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1476 | Open in IMG/M |
3300009525|Ga0116220_10421829 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300009552|Ga0116138_1013929 | All Organisms → cellular organisms → Bacteria | 2610 | Open in IMG/M |
3300009617|Ga0116123_1080221 | Not Available | 887 | Open in IMG/M |
3300009631|Ga0116115_1094034 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300009643|Ga0116110_1307490 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300009683|Ga0116224_10393979 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300009700|Ga0116217_10640177 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300010048|Ga0126373_12632396 | Not Available | 561 | Open in IMG/M |
3300010336|Ga0134071_10097161 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
3300010341|Ga0074045_10173990 | All Organisms → cellular organisms → Bacteria | 1452 | Open in IMG/M |
3300010359|Ga0126376_11038462 | Not Available | 823 | Open in IMG/M |
3300010360|Ga0126372_13204638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
3300010361|Ga0126378_10641767 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
3300010366|Ga0126379_11154501 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300010371|Ga0134125_11178920 | Not Available | 837 | Open in IMG/M |
3300010379|Ga0136449_100863174 | Not Available | 1482 | Open in IMG/M |
3300010379|Ga0136449_102848796 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300010398|Ga0126383_10347492 | All Organisms → cellular organisms → Bacteria | 1502 | Open in IMG/M |
3300010398|Ga0126383_11876317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
3300011088|Ga0138576_1166511 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
3300011269|Ga0137392_10789328 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
3300011271|Ga0137393_11300211 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300011271|Ga0137393_11377233 | Not Available | 594 | Open in IMG/M |
3300012096|Ga0137389_10873089 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300012198|Ga0137364_11110987 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300012201|Ga0137365_11153514 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300012205|Ga0137362_10914861 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300012206|Ga0137380_10918287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 751 | Open in IMG/M |
3300012212|Ga0150985_118475313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
3300012354|Ga0137366_10267240 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
3300012361|Ga0137360_11538603 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300012362|Ga0137361_10283656 | All Organisms → cellular organisms → Bacteria | 1514 | Open in IMG/M |
3300012362|Ga0137361_11866863 | Not Available | 518 | Open in IMG/M |
3300012510|Ga0157316_1034922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 628 | Open in IMG/M |
3300012917|Ga0137395_10896327 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300012917|Ga0137395_11310274 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300012923|Ga0137359_10223103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1683 | Open in IMG/M |
3300012924|Ga0137413_10519981 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300012924|Ga0137413_10748890 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
3300012925|Ga0137419_11681533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
3300012929|Ga0137404_11276127 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300012930|Ga0137407_10187618 | All Organisms → cellular organisms → Bacteria | 1848 | Open in IMG/M |
3300012930|Ga0137407_11935311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 562 | Open in IMG/M |
3300012944|Ga0137410_11328536 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300012971|Ga0126369_13612113 | Not Available | 507 | Open in IMG/M |
3300012971|Ga0126369_13683033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
3300012989|Ga0164305_10356583 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
3300012989|Ga0164305_10568796 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300014150|Ga0134081_10042286 | Not Available | 1346 | Open in IMG/M |
3300014151|Ga0181539_1117937 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
3300014159|Ga0181530_10516861 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300014162|Ga0181538_10023048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4283 | Open in IMG/M |
3300014169|Ga0181531_10012005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4969 | Open in IMG/M |
3300014169|Ga0181531_10158576 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
3300014502|Ga0182021_10432893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1563 | Open in IMG/M |
3300014655|Ga0181516_10634149 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300014657|Ga0181522_10050050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2348 | Open in IMG/M |
3300014657|Ga0181522_10247959 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
3300014969|Ga0157376_11125526 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
3300015241|Ga0137418_10566073 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300016750|Ga0181505_10325937 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300017925|Ga0187856_1348210 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300017930|Ga0187825_10376784 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300017940|Ga0187853_10264533 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
3300017943|Ga0187819_10199618 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
3300017943|Ga0187819_10345414 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
3300017948|Ga0187847_10272007 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
3300017955|Ga0187817_11039365 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300017955|Ga0187817_11131899 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300017972|Ga0187781_11361229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
3300017975|Ga0187782_10355747 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
3300017975|Ga0187782_10553912 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
3300017975|Ga0187782_10877575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
3300018003|Ga0187876_1271174 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300018006|Ga0187804_10102386 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
3300018009|Ga0187884_10431134 | Not Available | 530 | Open in IMG/M |
3300018022|Ga0187864_10138874 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
3300018024|Ga0187881_10429218 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300018025|Ga0187885_10539100 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300018027|Ga0184605_10240504 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300018037|Ga0187883_10404448 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300018042|Ga0187871_10122295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella | 1485 | Open in IMG/M |
3300018042|Ga0187871_10522943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 657 | Open in IMG/M |
3300018043|Ga0187887_10077435 | All Organisms → cellular organisms → Bacteria | 2015 | Open in IMG/M |
3300018062|Ga0187784_10143791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1948 | Open in IMG/M |
3300018062|Ga0187784_10385299 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1134 | Open in IMG/M |
3300018085|Ga0187772_10307612 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
3300018088|Ga0187771_10134452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2021 | Open in IMG/M |
3300018088|Ga0187771_10372441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1202 | Open in IMG/M |
3300018088|Ga0187771_11917429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
3300018090|Ga0187770_10211988 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
3300018090|Ga0187770_10241044 | Not Available | 1400 | Open in IMG/M |
3300018468|Ga0066662_10087167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2159 | Open in IMG/M |
3300018482|Ga0066669_10336725 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
3300019082|Ga0187852_1278228 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300019264|Ga0187796_1484791 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 801 | Open in IMG/M |
3300019278|Ga0187800_1053129 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300019877|Ga0193722_1045137 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
3300019887|Ga0193729_1045580 | Not Available | 1799 | Open in IMG/M |
3300019999|Ga0193718_1043575 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
3300020579|Ga0210407_10703426 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300020581|Ga0210399_11209062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
3300020583|Ga0210401_10995931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 697 | Open in IMG/M |
3300021168|Ga0210406_11061380 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300021170|Ga0210400_10825998 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300021402|Ga0210385_10195785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1467 | Open in IMG/M |
3300021403|Ga0210397_10785509 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300021404|Ga0210389_11320721 | Not Available | 552 | Open in IMG/M |
3300021405|Ga0210387_10247012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1560 | Open in IMG/M |
3300021406|Ga0210386_10134758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2054 | Open in IMG/M |
3300021433|Ga0210391_10145124 | All Organisms → cellular organisms → Bacteria | 1869 | Open in IMG/M |
3300021433|Ga0210391_10854048 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300021478|Ga0210402_10527476 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
3300021478|Ga0210402_11173173 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300021479|Ga0210410_10336887 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
3300021479|Ga0210410_11053788 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300021479|Ga0210410_11617139 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300022509|Ga0242649_1079281 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300022523|Ga0242663_1052103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
3300022533|Ga0242662_10209472 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300022557|Ga0212123_10842737 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300022724|Ga0242665_10213431 | Not Available | 642 | Open in IMG/M |
3300022734|Ga0224571_109910 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300025134|Ga0207416_1011838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5353 | Open in IMG/M |
3300025134|Ga0207416_1112745 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
3300025500|Ga0208686_1123193 | Not Available | 536 | Open in IMG/M |
3300025612|Ga0208691_1017600 | All Organisms → cellular organisms → Bacteria | 1716 | Open in IMG/M |
3300025910|Ga0207684_10917488 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300025910|Ga0207684_11097740 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300025927|Ga0207687_10337090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1225 | Open in IMG/M |
3300025934|Ga0207686_11735877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
3300025960|Ga0207651_10895253 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300026023|Ga0207677_11498579 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300026035|Ga0207703_11507632 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300026304|Ga0209240_1080285 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
3300026309|Ga0209055_1236500 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300026374|Ga0257146_1081463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
3300026499|Ga0257181_1067219 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300026508|Ga0257161_1115716 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300026532|Ga0209160_1273533 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300026551|Ga0209648_10821285 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300026557|Ga0179587_10649038 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300027168|Ga0208239_1028337 | Not Available | 549 | Open in IMG/M |
3300027605|Ga0209329_1022517 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
3300027645|Ga0209117_1189564 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300027745|Ga0209908_10098441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 720 | Open in IMG/M |
3300027745|Ga0209908_10163701 | Not Available | 592 | Open in IMG/M |
3300027795|Ga0209139_10185896 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300027869|Ga0209579_10398135 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
3300027882|Ga0209590_10584428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 719 | Open in IMG/M |
3300027884|Ga0209275_10407911 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300027898|Ga0209067_10182948 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
3300027911|Ga0209698_10771590 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
3300028536|Ga0137415_10685300 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300028673|Ga0257175_1030924 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
3300028780|Ga0302225_10072958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1688 | Open in IMG/M |
3300029882|Ga0311368_10469795 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
3300029883|Ga0311327_10377733 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300029955|Ga0311342_11024657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
3300029999|Ga0311339_10071945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4454 | Open in IMG/M |
3300029999|Ga0311339_10186060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2375 | Open in IMG/M |
3300029999|Ga0311339_11271862 | Not Available | 669 | Open in IMG/M |
3300030399|Ga0311353_10732176 | Not Available | 850 | Open in IMG/M |
3300030520|Ga0311372_11036949 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
3300030520|Ga0311372_11186447 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
3300030580|Ga0311355_10294172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1636 | Open in IMG/M |
3300030677|Ga0302317_10473947 | Not Available | 546 | Open in IMG/M |
3300030991|Ga0073994_12030339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
3300031010|Ga0265771_1008297 | Not Available | 726 | Open in IMG/M |
3300031057|Ga0170834_101094209 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
3300031234|Ga0302325_10190005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3562 | Open in IMG/M |
3300031234|Ga0302325_11676903 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300031234|Ga0302325_11895398 | Not Available | 741 | Open in IMG/M |
3300031247|Ga0265340_10551749 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300031249|Ga0265339_10568526 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300031258|Ga0302318_10039099 | All Organisms → cellular organisms → Bacteria | 1840 | Open in IMG/M |
3300031446|Ga0170820_13832470 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300031525|Ga0302326_10261403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2808 | Open in IMG/M |
3300031525|Ga0302326_13738402 | Not Available | 500 | Open in IMG/M |
3300031564|Ga0318573_10323236 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300031679|Ga0318561_10664385 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300031708|Ga0310686_106366149 | Not Available | 762 | Open in IMG/M |
3300031715|Ga0307476_10574244 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
3300031716|Ga0310813_10052117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3017 | Open in IMG/M |
3300031718|Ga0307474_10015426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5538 | Open in IMG/M |
3300031718|Ga0307474_10020470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4818 | Open in IMG/M |
3300031754|Ga0307475_10849000 | Not Available | 723 | Open in IMG/M |
3300031823|Ga0307478_10574026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 943 | Open in IMG/M |
3300031823|Ga0307478_11047837 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300031833|Ga0310917_10995231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 562 | Open in IMG/M |
3300031912|Ga0306921_11243606 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300031947|Ga0310909_10603432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 917 | Open in IMG/M |
3300031996|Ga0308176_12509398 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300032160|Ga0311301_11060463 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
3300032160|Ga0311301_12954356 | Not Available | 513 | Open in IMG/M |
3300032180|Ga0307471_101336291 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300032180|Ga0307471_101950373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
3300032205|Ga0307472_100514123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1036 | Open in IMG/M |
3300032205|Ga0307472_100836427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
3300032205|Ga0307472_101656735 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300032782|Ga0335082_10224693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1769 | Open in IMG/M |
3300032783|Ga0335079_11224037 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300032805|Ga0335078_11893810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 644 | Open in IMG/M |
3300032828|Ga0335080_10014712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8318 | Open in IMG/M |
3300032898|Ga0335072_11195904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
3300033158|Ga0335077_12002798 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300033805|Ga0314864_0001835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3938 | Open in IMG/M |
3300033808|Ga0314867_070249 | Not Available | 815 | Open in IMG/M |
3300034163|Ga0370515_0184412 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.71% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.36% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.36% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.00% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.64% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.29% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.93% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.21% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.86% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.14% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.14% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.14% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.14% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.14% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.50% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.79% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.79% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.43% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.43% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.07% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.07% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.07% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.71% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.71% |
Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.71% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.71% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.71% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.71% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.71% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.36% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.36% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.36% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.36% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.36% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.36% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.36% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.36% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.36% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.36% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.36% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.36% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.36% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.36% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.36% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.36% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.36% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.36% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.36% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004121 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_055 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005876 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
3300009617 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 | Environmental | Open in IMG/M |
3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011088 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Host-Associated | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
3300019264 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3 | Host-Associated | Open in IMG/M |
3300025134 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027168 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF037 (SPAdes) | Environmental | Open in IMG/M |
3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
4MG_05217460 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | YKDDAALEAHRAAPHFLQYAKKELPKVADRVDGNLFEPLG |
JGI12270J11330_100121977 | 3300000567 | Peatlands Soil | YEQYKDAAALEAHRAAPHFLQMAKKDLPKLGDRIEGHLYEPLG* |
JGI1027J11758_127356443 | 3300000789 | Soil | ALEAHRTSSHFLQYAKKELPKLGERVEGNLYEPLE* |
JGI1027J11758_129045453 | 3300000789 | Soil | DAALEAHRVAPHFLQHAKKDLPKVADRVEGHLFEPLG* |
JGI1027J12803_1022448651 | 3300000955 | Soil | YKDDAALEAHRTSSHFLQYAKKELPKLGERVEGNLYEPLE* |
C688J14111_102101203 | 3300001305 | Soil | AALDLHRRTPHFFQYARTELPKVAERVSGELYEPV* |
JGIcombinedJ26739_1008231761 | 3300002245 | Forest Soil | DDAALEAHRTAPHFLQYARKELPKVAERVEGNLFEPLG* |
soilH2_101199873 | 3300003324 | Sugarcane Root And Bulk Soil | YKDDAALEAHRTSPHFLQYAKKDLPKIADRVEGNLYELLG* |
Ga0062384_1006529622 | 3300004082 | Bog Forest Soil | IYEQYKDDAALEAHRTTPHFMQLAKKELPKIAERTEGHLYEPLG* |
Ga0062389_1044868531 | 3300004092 | Bog Forest Soil | YEQYKDDAALEAHRTAPHFLQFARKDLPKVADRVEGHLFEPLG* |
Ga0058882_14167371 | 3300004121 | Forest Soil | FIYEQYKDDAALEAHRAAAHFLQHAKKELPKIADRTEGHLFEPLG* |
Ga0066672_103135681 | 3300005167 | Soil | QYTDDAALEAHRTAPHFLRYAKKDLPKIADRVEGNLYEPLQ* |
Ga0066388_1077744991 | 3300005332 | Tropical Forest Soil | YEQYKDDAALEAHRTAPHFLQHAKKELPKIADRVEGHLFEPLG* |
Ga0070673_1019418592 | 3300005364 | Switchgrass Rhizosphere | RRFFIYELYKDDAALEAHRTTSHFLQYARKELPKIADRVEGNLYEPLG* |
Ga0070710_100031641 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | EQYKDDAALEAHRTTPHFLQYARKDLPKVADRIEGHLYEPLG* |
Ga0070706_1015616162 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | KDDAALEAHRTSPHFLQMAKKDLPKLGDRTEGHLFEPLG* |
Ga0066697_106862853 | 3300005540 | Soil | YKDDSALEAHRAAPHFLQYVKKQLPKVADRVEGHLYEPLG* |
Ga0070733_100377711 | 3300005541 | Surface Soil | QYKDDAALEAHRNASHFLQFARKDLPKIADRVEGHLFEPLG* |
Ga0070733_100764207 | 3300005541 | Surface Soil | LEAHRAAPHFLQHARKDLPKIADRVEGHLFEPLG* |
Ga0070732_110441142 | 3300005542 | Surface Soil | DAALQAHRNSPHFLKYAKEELPRIADRVEGELYEPM* |
Ga0070704_1010967681 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | EQYKDDAALEAHRAAPHFLQYAKKELPKFGDRVEGHLYEPLG* |
Ga0066692_106668421 | 3300005555 | Soil | KDDAALEAHRSAPHFLQYARKDLPKIADRVEGHLLEPLA* |
Ga0066700_100976715 | 3300005559 | Soil | AALEAHRATAHFLQYARKELPRVADRVEGVVYEPLG* |
Ga0066699_105566532 | 3300005561 | Soil | DDAALEAHRSAPHFLQFAKKDLPKIADRVEGNLFEPLG* |
Ga0068854_1000152446 | 3300005578 | Corn Rhizosphere | DDAGLGGHRAAPHFLQYAKKDLPKIADRVEGHLLEPLA* |
Ga0070740_103581311 | 3300005607 | Surface Soil | QYQDDAALEAHRAAPHFLQHAKKDLPKIADRVEGHLFEPLG* |
Ga0070763_109677151 | 3300005610 | Soil | AALEAHRAAPHFLQYARKDLPKVADRVEGHLYEALE* |
Ga0068856_1010301101 | 3300005614 | Corn Rhizosphere | KDDAALEAHRAAPHFLQYAKKDLPKIADRVEGNLFEPLG* |
Ga0075038_105833562 | 3300005650 | Permafrost Soil | KDEAALEAHRTTPHFLQYARKELTKVADRVEGNLYEPLE* |
Ga0068863_1007927993 | 3300005841 | Switchgrass Rhizosphere | KDDAALEAHRAAPHFIQFAKKELPKLADRVEGHLYEPLG* |
Ga0075300_10415543 | 3300005876 | Rice Paddy Soil | IYEQYKDDAALEAHRTATHFLQHAKKDLPKIADRVEGHLFDPLG* |
Ga0075024_1003961353 | 3300006047 | Watersheds | YKDDAALEAHRAAPHFLQYAKKELPKLADRVEGHLYEPLS* |
Ga0075028_1003850871 | 3300006050 | Watersheds | YKDDAALEAHRSATHFLQFAKKDLPKLADRVEGHLYEPLG* |
Ga0075028_1009764071 | 3300006050 | Watersheds | YKDDGALEAHRAAPHFLQHARKELPKFAERTEGHLYEPLG* |
Ga0075029_1010214402 | 3300006052 | Watersheds | YKDDAALEAHRTAPHFLQFARKDLPKVADRVEGHLFEPLG* |
Ga0075017_1000717476 | 3300006059 | Watersheds | DDTALEAHRAAPHFLQHAKKDLPKIADRVEGHLFEPLG* |
Ga0075017_1002542271 | 3300006059 | Watersheds | EQYKDDAALEAHRTSPHFLQLAKKELPKLGDRTEGHLFEPLG* |
Ga0075017_1010555991 | 3300006059 | Watersheds | YKDDAALEAHRAAPHFLQHAKKELPRVADRIEGHLFEPLG* |
Ga0075017_1013119672 | 3300006059 | Watersheds | QYKDDAALEAHRTAPHFLQFARKDLPKVADRVEGHLFEPLG* |
Ga0075017_1013406002 | 3300006059 | Watersheds | QYKDDAALEAHRAAPHFLQFAKKELPRVADRVEGQVYEALG* |
Ga0075015_1008630671 | 3300006102 | Watersheds | QYKDDAALEAHRAAPHFLQHARKDLPKIADRVEGHLFEPLG* |
Ga0075030_1005854221 | 3300006162 | Watersheds | EQYKDDAALEAHRTAPHFLQFARKDLPKVADRVEGHLFEPLG* |
Ga0075018_101189724 | 3300006172 | Watersheds | YKDDAALEAHRAAPHFLQFAKKELPKIADRVEGQLYEPLG* |
Ga0070712_1011545932 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LEAHRAAPHFLQHARKDLPKIADRVEGHLFVPLG* |
Ga0070765_1004191143 | 3300006176 | Soil | AALEAHRAAPHFLQYARKDLPKVADRVEGHLYEALG* |
Ga0075021_1000622210 | 3300006354 | Watersheds | YKDDAALEAHKSAPHFLEYAKKSLPKIADRIEGQLYSPLD* |
Ga0066665_103620841 | 3300006796 | Soil | DAALEAHRSAPHFLQYARKDLPKIADRVEGHLLEPLAQPM* |
Ga0066659_108397682 | 3300006797 | Soil | LEAHRAASHFLQYAKKDLPKIADRVEGNLFEPLG* |
Ga0066659_114876181 | 3300006797 | Soil | QYKDDSALEAHRAAPHFLQYVKKQLPKVADRVEGHLYEPLG* |
Ga0066660_111112152 | 3300006800 | Soil | EQYKDEAALEAHRAASHFLQYAKKDLPKIADRVEGNLFEPLG* |
Ga0075425_1007644331 | 3300006854 | Populus Rhizosphere | AALEAHRAAPHFLQYARKELPKIADRLEGHLFEPLGDA* |
Ga0075434_1012998132 | 3300006871 | Populus Rhizosphere | LEAHRAAPHFLQYARKELPKIADRLEGHLFEPLGDA* |
Ga0075424_1024725941 | 3300006904 | Populus Rhizosphere | FKDDAALEAHRATPHFLKYGKKELPRVADRVDGQLYDALD* |
Ga0079219_111205762 | 3300006954 | Agricultural Soil | YEQYKDDAALEAHRTTAHFLQYAKKDLPKVADRLEGHLFEPLG* |
Ga0099794_104624793 | 3300007265 | Vadose Zone Soil | EQYKDDAALEAHRTAPHFLQLAKKDLPKIADRIEGHLYEPLG* |
Ga0102924_100259723 | 3300007982 | Iron-Sulfur Acid Spring | YEQYKDDAALEAHRAAPHFLQFAKKELPKIADRVDGQLYEPLG* |
Ga0102924_11337484 | 3300007982 | Iron-Sulfur Acid Spring | YEQYKDDAALEAHRAAPHFLQHAKKDLPKIADRVEGHLFEPLG* |
Ga0102924_12611191 | 3300007982 | Iron-Sulfur Acid Spring | QYKDDAALEAHRTAPHFLQHAKKDLPKIADRVEGNLFEPLG* |
Ga0066710_1034929031 | 3300009012 | Grasslands Soil | YKDDAAFEAHRTAPHFLQYAKKDLPKIADRVEGNLYEPIE |
Ga0066710_1037960051 | 3300009012 | Grasslands Soil | QYKDDSALEAHRAAPHFLQYVKKQLPKVADRVEGHLYEPLG |
Ga0066793_102183994 | 3300009029 | Prmafrost Soil | LEAHRTAPHFLQLAKKDLPKLGDRIEAHLFEPLG* |
Ga0099830_112886343 | 3300009088 | Vadose Zone Soil | DEAALEAHRNSPHFLKHAKEELPRIAERVEGEPYEPI* |
Ga0099827_106688691 | 3300009090 | Vadose Zone Soil | EQYQDDSAIEAHRSASHFLQYAKKDLPKIADRTEGNLYEPLG* |
Ga0099827_117356181 | 3300009090 | Vadose Zone Soil | YKDDAALEAHRTAPHFLQYARKDLPKVAERVEGHLYEALV* |
Ga0066709_1030272082 | 3300009137 | Grasslands Soil | FFIYEQYKDEAALEAHRAASYFLQYAKKDLPKIADRVEGNLFEPLG* |
Ga0111538_131772901 | 3300009156 | Populus Rhizosphere | DDAALEAHRTSSHFLQYAKKELPKLGERIEGNLYEPLG* |
Ga0105241_101091562 | 3300009174 | Corn Rhizosphere | YKDDAALEAHRTTAHFLQYAKKDLPKVADRLEGHLFEPLG* |
Ga0116214_12427291 | 3300009520 | Peatlands Soil | DAALEAHRAAPHFLQFGKKDLPKIADRTEGHLFEPLG* |
Ga0116214_12467403 | 3300009520 | Peatlands Soil | IYEQYKDDAALEAHRAAPHFLQHAKKELPRIADRVESQLYEPLG* |
Ga0116222_10274956 | 3300009521 | Peatlands Soil | DAALEAHRAAPHFLQYAKKDLPKVADRVEGHLFEPLG* |
Ga0116218_10813283 | 3300009522 | Peatlands Soil | YKDDAALEAHRAAPHFLQFGKKDLPKIADRTEGHLFEPLG* |
Ga0116220_104218291 | 3300009525 | Peatlands Soil | AALEAHRAAPHFLQHARKDLPKIADRVEGHLFEPLG* |
Ga0116138_10139296 | 3300009552 | Peatland | IEAHRTAPHFLQFAKKDLPKVADRIEGHLFEPLG* |
Ga0116123_10802213 | 3300009617 | Peatland | YKDAAALEAHRTAPHFLQFAKKDLPKVAARIEGHLFEPLG* |
Ga0116115_10940341 | 3300009631 | Peatland | DDAAIEAHRTAPHFLQFAKKDLPKVADRIEGHLFEPLG* |
Ga0116110_13074901 | 3300009643 | Peatland | AALEAHRSSPHFLQLAKKELPKLGDRTEGHLFEPLG* |
Ga0116224_103939791 | 3300009683 | Peatlands Soil | LEAHRTSPHFLQMAKKDLIKVADRTEGHLFEPLG* |
Ga0116217_106401772 | 3300009700 | Peatlands Soil | YEQYKDAAALEAHRAAPHFLQMAKKDLPKLGDRIEGHLYEPLGKL* |
Ga0126373_126323961 | 3300010048 | Tropical Forest Soil | LEAHRAAPHFLQYAKKELPKLADRVDGQLYEPLA* |
Ga0134071_100971614 | 3300010336 | Grasslands Soil | AALEAHRAAPHFLQYARKGLPKVAERVEGHLLVPIEDAQSK* |
Ga0074045_101739901 | 3300010341 | Bog Forest Soil | YKDDAALEAHRATPHFLQHAKKELPKIADRTEGHLFEPLG* |
Ga0126376_110384621 | 3300010359 | Tropical Forest Soil | DAALEAHRNAPHFLQYAKKDLPKVADRVEGHLLEPLVP* |
Ga0126372_132046381 | 3300010360 | Tropical Forest Soil | KDDAALEAHRAAPHFLQFAKKELTKVADRVEGNLFEPLG* |
Ga0126378_106417671 | 3300010361 | Tropical Forest Soil | YKDDAALEAHRAAPHFLQHARKDLPKIADRVEGHLFEPLG* |
Ga0126379_111545011 | 3300010366 | Tropical Forest Soil | YKDDAALEAHRAAPHFLQHAKKELPKIADRVEGHLFEPLG* |
Ga0134125_111789201 | 3300010371 | Terrestrial Soil | QYKDDAALESHRGTPHFLQHAKKELPKVADRVDGQLYEPLG* |
Ga0136449_1008631744 | 3300010379 | Peatlands Soil | FIYEQYKDDAALEAHRTAAHFLQYARKDLLKVADRVEGHLFEPIG* |
Ga0136449_1028487963 | 3300010379 | Peatlands Soil | YEQYKDAAALEAHRVAAHFLQFARKDLPKIADRVEGHLYEPLG* |
Ga0126383_103474923 | 3300010398 | Tropical Forest Soil | DAALEAHRAAPHFLQHAKKELPKIADRVEGHLFEPLG* |
Ga0126383_118763171 | 3300010398 | Tropical Forest Soil | KDDAALEAHRAAPHFLQHAKKDLPKIADRVEGHLFEPLG* |
Ga0138576_11665111 | 3300011088 | Peatlands Soil | KDDAALEAHRTSPHFLQYARKELPKVADRVEGHLYEAMG* |
Ga0137392_107893281 | 3300011269 | Vadose Zone Soil | KDDAALEAHRTAPHFLQLAKKDLPKIADRIEGHLYEPLG* |
Ga0137393_113002113 | 3300011271 | Vadose Zone Soil | IYEQYQDDAALEAHRTASHFLQLAKKDLPKIADRVEGHLFEPLG* |
Ga0137393_113772332 | 3300011271 | Vadose Zone Soil | IYEQYKDDAALEAHRSTSHFLQYARKELPKVADRVEGNLYEALG* |
Ga0137389_108730891 | 3300012096 | Vadose Zone Soil | ALEAHRTAPHFLQLAKKDLPKIADRIEGHLYEPLG* |
Ga0137364_111109873 | 3300012198 | Vadose Zone Soil | DDAALEAHRTAPHFLQYAKKDLPKIADRVEGSLYDPLQ* |
Ga0137365_111535143 | 3300012201 | Vadose Zone Soil | AALEAHRTAPHFLQYAKKDLPKIADRVEGSLYDPLQ* |
Ga0137362_109148613 | 3300012205 | Vadose Zone Soil | DAALEAHRTAPHFLQWAKKDLPKIADRVEGHLFEPLG* |
Ga0137380_109182871 | 3300012206 | Vadose Zone Soil | KDDAALEAHRNAPHFLQYAKKELPKMADRVEGQLYEPLG* |
Ga0150985_1184753132 | 3300012212 | Avena Fatua Rhizosphere | SSDLAALEAHRAAPHFLQHAKKDLPKIADRVEGHLFEPLA* |
Ga0137366_102672401 | 3300012354 | Vadose Zone Soil | LEAHRAAPHFLQHAKKDLPKVADRIEGHLYEPLG* |
Ga0137360_115386031 | 3300012361 | Vadose Zone Soil | KDDAALEAHRTAPHFLQLAKKDLPKIADRVEGHLFEPLG* |
Ga0137361_102836561 | 3300012362 | Vadose Zone Soil | DAALEAHRTAPHFLQYARKELPKVAERVEGNLFEPLG* |
Ga0137361_118668631 | 3300012362 | Vadose Zone Soil | LEAHRSAPHFLQYAKKELPKIADRVEGQLYEPLG* |
Ga0157316_10349221 | 3300012510 | Arabidopsis Rhizosphere | IYEQYKDDAGLEGHRAAPHFLQYAKKDLPKIADRVEGHLLEPLA* |
Ga0137395_108963271 | 3300012917 | Vadose Zone Soil | KDDAALEAHRAAPHFLQFAKKDLPKVADRTEGHLFEPLG* |
Ga0137395_113102742 | 3300012917 | Vadose Zone Soil | YEQYKDDAALEAHRNAPHFLQYAKKELPKMADRVEGQLYEPLG* |
Ga0137359_102231031 | 3300012923 | Vadose Zone Soil | DDAAIEAHRAAPHFLQYVRKDLPKMADRTEGNLYEPLE* |
Ga0137413_105199811 | 3300012924 | Vadose Zone Soil | QYKDDAALEAHRAAPHFLQFAKKDLPKVADRTEGHLFEPLG* |
Ga0137413_107488903 | 3300012924 | Vadose Zone Soil | EQYKDDAALEAHRAAPHFLQFAKKDLPKVADRTEGHLFEPLG* |
Ga0137419_116815332 | 3300012925 | Vadose Zone Soil | AALEAHRAAPHFLQFAKKDLPKVADRTEGHLFEPLG* |
Ga0137404_112761273 | 3300012929 | Vadose Zone Soil | FIYEQYKDDAGLEAHRAATHFLQFAKKDLPKVADRVEGHLYEPLG* |
Ga0137407_101876184 | 3300012930 | Vadose Zone Soil | IYEQYKDDAGLEAHRAAPHFLQFARKQLPKIAERVEGNLFEPLG* |
Ga0137407_119353111 | 3300012930 | Vadose Zone Soil | ALEAHRASPHFLQYAKKELPKLGERVEGNLYAPIGD* |
Ga0137410_113285362 | 3300012944 | Vadose Zone Soil | EQYKDDAGLEAHRAAPHFLQFARKELPKIAERVEGNLFEPLG* |
Ga0126369_136121132 | 3300012971 | Tropical Forest Soil | AALEQHRNAAHFLQYAKKDLPKVADRVEGHLLEPLV* |
Ga0126369_136830332 | 3300012971 | Tropical Forest Soil | QYKDDAALEAHRAAPHFLQHAKKELPKIADRVEGHLFEPLG* |
Ga0164305_103565834 | 3300012989 | Soil | AALEAHRAAPHFLQYAKKELPKLGDRVEGHLYEPLG* |
Ga0164305_105687961 | 3300012989 | Soil | DDAALEAHRAAPHFIQFAKKELPKLADRVEGHLYEPLS* |
Ga0134081_100422864 | 3300014150 | Grasslands Soil | LEAHRAAPHFLQYVKKQLPKVADRVEGHLYEPLG* |
Ga0181539_11179371 | 3300014151 | Bog | VYEQYKDDAALEAHRASAHFLQLAKKELPKLGDRTEGHLFEPLG* |
Ga0181530_105168613 | 3300014159 | Bog | AALEAHRAAPHFLQFGKKDLPKIADRTEGHLFEPLG* |
Ga0181538_100230487 | 3300014162 | Bog | YKDDAAIEAHRAAPHFLQMAKKDLPKIADRVEGHLFEPLG* |
Ga0181531_100120057 | 3300014169 | Bog | DDAALEAHRTLPHFLQFAKKDLPKIADRTEGHLFEPLG* |
Ga0181531_101585764 | 3300014169 | Bog | LEAHRAAPHFLQYAKKELPKLGERIEGQLYEPLG* |
Ga0182021_104328931 | 3300014502 | Fen | YEQYKDDAAIEAHRAAPHFLQFAKKDLPKVADRIEGHLFEPIG* |
Ga0181516_106341493 | 3300014655 | Bog | DAALEAHRASPHFMQYAKKELPKVAERVEGNLYEPLG* |
Ga0181522_100500501 | 3300014657 | Bog | YEQYKDDAALEAHRAAPHFLQYARKDLPKVADRVEGHLYEPLG* |
Ga0181522_102479591 | 3300014657 | Bog | YKDDAALEAHRAAPHFLQHARKDLPKVADRVEGHLFEPLG* |
Ga0157376_111255262 | 3300014969 | Miscanthus Rhizosphere | QYKDDAALEAHRAAPHFLQYARKELPKIADRLEGHLFEPLGDA* |
Ga0137418_105660731 | 3300015241 | Vadose Zone Soil | KDDAALEAHRTASHFLQYARKDLPKIADRIEGHLFEPLG* |
Ga0181505_103259372 | 3300016750 | Peatland | EQYQDDAALEAHRAAPHFLQLAKKDLPKIADRTEGHLFEPLG |
Ga0187856_13482102 | 3300017925 | Peatland | YEQYKDDAAIEAHRTAPHFLQMAKKDLPKIADRIEGHLFEPLG |
Ga0187825_103767843 | 3300017930 | Freshwater Sediment | DDAALEAHRATPHFLQYAKKELPKLGDRVEGNLFEPLG |
Ga0187853_102645333 | 3300017940 | Peatland | AALEAHRAAPHFLQMAKKDLPKIADRTEGHLFEPLG |
Ga0187819_101996184 | 3300017943 | Freshwater Sediment | QYKDDAALEAHRAAPHFLQYVKKELPKLGDRIEGQLYEPLG |
Ga0187819_103454141 | 3300017943 | Freshwater Sediment | DDAALEAHRTTPHFLQMAKKDLVKVADRTEGHLFEPLG |
Ga0187847_102720071 | 3300017948 | Peatland | QYKDDAALEAHRATPHFLQHAKKELPKIADRTEGHLFEPLG |
Ga0187817_110393651 | 3300017955 | Freshwater Sediment | IYEQYKDDAAIEAHRSAPHFLQLAKKDLPKIADRTEGHLFEPLG |
Ga0187817_111318991 | 3300017955 | Freshwater Sediment | ALEAHRNAQHFLQFARKDLPKIADRVEGHLFEPLG |
Ga0187781_113612292 | 3300017972 | Tropical Peatland | ALEAHRAAPHFLQMAKKDLPKIADRTEGHLFVPLG |
Ga0187782_103557471 | 3300017975 | Tropical Peatland | EQYKDDAALEAHRSAPHFLRYAKKELPKLGDRIEGQLYEPLG |
Ga0187782_105539121 | 3300017975 | Tropical Peatland | AALEAHRTTPHFLQYARKDLPKIADRVEGHLYEALG |
Ga0187782_108775752 | 3300017975 | Tropical Peatland | DAALEAHRAAPYFLQFARKDLPKVADRVEGQLFEPLG |
Ga0187876_12711742 | 3300018003 | Peatland | EQYQDDAALEAHRASPHFLQLAKKDLPKIADRTEGHLFEPLG |
Ga0187804_101023861 | 3300018006 | Freshwater Sediment | KDDAALEAHRAAPHFLQFGKKDLPKIADRTEGHLFEPLG |
Ga0187884_104311342 | 3300018009 | Peatland | DDAALEAHRTSPHFLLHARKELPKVADRVEGHLYEALG |
Ga0187864_101388741 | 3300018022 | Peatland | ALEAHRAAPHFLQLAKKDLPKIADRTEGHLFEPLG |
Ga0187881_104292183 | 3300018024 | Peatland | DDAALEAHRNAPHFLQYARKDLPRIAERVEGHLFEPLG |
Ga0187885_105391001 | 3300018025 | Peatland | EQYKDDAALEAHRAAPHFLQHAKKDLPKVADRVEGHLFEPLG |
Ga0184605_102405044 | 3300018027 | Groundwater Sediment | EQYKDDAALEAHRATPHFLQYARKELPRIADRVEGVVYEPLG |
Ga0187883_104044481 | 3300018037 | Peatland | KDDAALEAHRAAPHFLQHAKKDLPKIADRVEGHLFEPLG |
Ga0187871_101222951 | 3300018042 | Peatland | EQYKDDAALEAHRAAPHFLQMGKKDLPKIADRTEGHLFEPLG |
Ga0187871_105229432 | 3300018042 | Peatland | EQYQDDAALEAHRASPHFLQMAKKDLPKLGDRTEGHLFEPLG |
Ga0187887_100774355 | 3300018043 | Peatland | DAALEAHRAAPHFLQHAKKDLPKIADRVEGHLFEPLG |
Ga0187784_101437911 | 3300018062 | Tropical Peatland | DDAALEAHRSAPHFLRYVKKELPKLGDRIEGNLYEALG |
Ga0187784_103852991 | 3300018062 | Tropical Peatland | DAALEAHRAAPHFLQYAKKELPKLGDRIEGHLFTPVG |
Ga0187772_103076121 | 3300018085 | Tropical Peatland | KDDAALEAHRTSPHFLQMAKKDLIKVADRTEGHLFEPLG |
Ga0187771_101344521 | 3300018088 | Tropical Peatland | KDDAALEAHRAAPHFLQYAKKELPKLGERIEGHLFTPVG |
Ga0187771_103724411 | 3300018088 | Tropical Peatland | DDAALEAHRTTPHFLQMAKKDLPKVADRTEGHLFEPIG |
Ga0187771_119174291 | 3300018088 | Tropical Peatland | ALEAHRAAPHFLQYAKKELPKLGDRIEGHLFTPVG |
Ga0187770_102119885 | 3300018090 | Tropical Peatland | YEQYKDDAALEAHRTAPHFLQFAKKDLPRVADRVEGHLFEPLG |
Ga0187770_102410441 | 3300018090 | Tropical Peatland | KDDAALEAHRTTHHFLQMAKKELPKIADRTEGHLFEPIG |
Ga0066662_100871671 | 3300018468 | Grasslands Soil | KEDAETRSPRPAPHFLQFAKRDLPKIADRVEGNLFELLG |
Ga0066669_103367254 | 3300018482 | Grasslands Soil | IYEQYKDDSALEAHRAARHFLQYVKKELPKIADRVEGHLYEPLG |
Ga0187852_12782283 | 3300019082 | Peatland | AIEAHRTAPHFLQMAKKDLPKIADRIEGHLFEPLG |
Ga0187796_14847911 | 3300019264 | Peatland | IYEQYKDDAALEAHRVAPHFLQFARKDLPKLADRVEGHLFEPLG |
Ga0187800_10531291 | 3300019278 | Peatland | KDDAALEAHRTTPHFLQMAKKDLPKVADRTEGHLFEPLG |
Ga0193722_10451371 | 3300019877 | Soil | QYKDDAALEAHRAAPHFLQYARKELPRIADRVEGVVYEPLG |
Ga0193729_10455804 | 3300019887 | Soil | YEQYSGDAALEAHRTAPHFLQYAKKELPKVAERVQGDLYVPLDEPV |
Ga0193718_10435753 | 3300019999 | Soil | QYKDDAALEAHRAAPHFLQLAKKELPKVADRVEGHLFEPLA |
Ga0210407_107034261 | 3300020579 | Soil | EQYKDDAALEAHRASPHFLQYVKKELPRVGDRVEGQLYEPLG |
Ga0210399_112090621 | 3300020581 | Soil | KDDAALEAHRAAPHFLQFARKELPKVADRVEGNLFEPLG |
Ga0210401_109959313 | 3300020583 | Soil | YEQYKDDAALEAHRAAPHFLQYAKKELPRHGDRVEGQLYEPLG |
Ga0210406_110613801 | 3300021168 | Soil | YKDDAALEAHRAAPHFLQYVKKELPKIGDRVEGHLYEPLG |
Ga0210400_108259981 | 3300021170 | Soil | KDDAALEAHRAAPHFLQYAKKELPKLGERIEGQLYEPLG |
Ga0210385_101957851 | 3300021402 | Soil | YEQYKDDAALEAHRAASHFLQYARKDLPKVADRMEGHLYEALG |
Ga0210397_107855093 | 3300021403 | Soil | ALEAHRAAPHFLQYARKELPKIAERTEGNLYEPLG |
Ga0210389_113207212 | 3300021404 | Soil | YEQYKGDAALEAHRAAPHFLQYAKKDLPRVADRIDGQLYEPLA |
Ga0210387_102470121 | 3300021405 | Soil | EQYKDDAALEAHRAAPHFLQYAKKELPKFGERIEGHLYEPLA |
Ga0210386_101347581 | 3300021406 | Soil | KDDAALEAHRATTHFLQYARKDLPKVADRVEGNLFEPLE |
Ga0210391_101451241 | 3300021433 | Soil | ALEAHRGAPHFLQHARKDLPKIADRVEGHLFEPLG |
Ga0210391_108540483 | 3300021433 | Soil | AALEAHRAAPHFLQHAKKDLPKIADRVEGHLFEPLG |
Ga0210402_105274764 | 3300021478 | Soil | QYKDDAALEAHRATTHFLQYARKELSKVADRVEGNLYEPLG |
Ga0210402_111731731 | 3300021478 | Soil | DAALEGHRTAPHFLQLAKKDLPKIADRIEGHLYEPLG |
Ga0210410_103368874 | 3300021479 | Soil | KDDAALEAHRVAPHFLQHAKKDLPKIADRVEGHLFEPLG |
Ga0210410_110537881 | 3300021479 | Soil | QYKDDAALEAHRNAPHFLQFARKELPKLADRVEGHLFEPLG |
Ga0210410_116171392 | 3300021479 | Soil | EQYKDDAALEAHRGAPHFLQHARKDLPKVADRVEGHLFEPLG |
Ga0242649_10792811 | 3300022509 | Soil | DDAALEAHRAAPHFLQHAKKDLPKVADRVEGHLYEPLG |
Ga0242663_10521032 | 3300022523 | Soil | YEQYKDDAALEAHRAAPHFLQHAKKDLPKFADRVEGHLFEPLG |
Ga0242662_102094723 | 3300022533 | Soil | AALEAHRASPHFLLHARKELPKVADRVEGHLYEALG |
Ga0212123_108427371 | 3300022557 | Iron-Sulfur Acid Spring | YVQYKDDAALESHRATTHFLQYARKELPKVADRVEGNLFEPLG |
Ga0242665_102134313 | 3300022724 | Soil | ALEAHRAAPHFLQYAKKELPKFGERIEGHLYEPLG |
Ga0224571_1099103 | 3300022734 | Rhizosphere | KDDTALEAHRNAPHFLQYARKDLPRIAERVEGHLFEPLG |
Ga0207416_10118387 | 3300025134 | Iron-Sulfur Acid Spring | YEQYKDDAALEAHRAAPHFLQFAKKELPKIADRVDGQLYEPLG |
Ga0207416_11127453 | 3300025134 | Iron-Sulfur Acid Spring | KDDAALEAHRAAPHFLQHARKDLPKIADRVEGHLFEPLG |
Ga0208686_11231932 | 3300025500 | Peatland | EQYKDDASLEAHRNAPHFLQYARKDLPRIADRVEGHLFEPLG |
Ga0208691_10176005 | 3300025612 | Peatland | QYKDDAALEAHRAAPHFLQHAKKDLPKIADRVEGHLFEPLG |
Ga0207684_109174882 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | KDDAALEAHRTSPHFLQMAKKDLPKLGDRTEGHLFEPLG |
Ga0207684_110977403 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | DAALEAHRTSPHFLQMAKKDLPKLGDRTEGHLFEPLG |
Ga0207687_103370904 | 3300025927 | Miscanthus Rhizosphere | EQYKDDAGLEAHRAAPHFLQYAKKELPKIADRVEGHLYEPIS |
Ga0207686_117358771 | 3300025934 | Miscanthus Rhizosphere | YEQYKDDAALEAHRAAPHFLQYAKKELPKIGDRVEGHLYEPLG |
Ga0207651_108952531 | 3300025960 | Switchgrass Rhizosphere | YEQYKDDAALEAHRASAHFLQYAKKELPKLGERVEGNLYSPVE |
Ga0207677_114985793 | 3300026023 | Miscanthus Rhizosphere | DDAALEAHRSAPHFLQHAKKDLPKIAERVEGQLFDLLG |
Ga0207703_115076323 | 3300026035 | Switchgrass Rhizosphere | YEQYKDDAALEAHRTSSHFLQYAKKELPKLGERIEGNLYEPLG |
Ga0209240_10802854 | 3300026304 | Grasslands Soil | DDAALEAHRTAPHFLQYARKDLPRIADRVEGHLFEPLG |
Ga0209055_12365001 | 3300026309 | Soil | YKDDAALEAHRTAPHFLQLAKKDLPKIADRIEGHLYEPLG |
Ga0257146_10814632 | 3300026374 | Soil | FIYEQYKDDAALEAHRAAPYFLQFVRKELPKVADRVEGNLFEPLG |
Ga0257181_10672193 | 3300026499 | Soil | QYKDDAALEAHRTAPHFLQLAKKDLPKIADRIEGHLYEPLG |
Ga0257161_11157161 | 3300026508 | Soil | YKDDAALEAHRAAAHFLQHAKKELPRVADRVEGHLFEPLG |
Ga0209160_12735333 | 3300026532 | Soil | EQYKDDSALEAHRAAPHFLQYVKKQLPKVADRVEGHLYEPLG |
Ga0209648_108212851 | 3300026551 | Grasslands Soil | AALEAHRTAPHFLQYARKELPKVAERVEGNLFEPLG |
Ga0179587_106490383 | 3300026557 | Vadose Zone Soil | YEQYKDDAALEAHRTSPHFLQLAKKDLPKIGDRTEGHLFEPLG |
Ga0208239_10283372 | 3300027168 | Forest Soil | QYKDDASLEAHRAAPHFLQYARKDLPKVADRVEGHLYEALG |
Ga0209329_10225174 | 3300027605 | Forest Soil | DAALEAHRTSPHFLQFAKKDLPKIGDRTEGHLFEPLG |
Ga0209117_11895641 | 3300027645 | Forest Soil | YKDDAALEAHRNTPHFLQYARKDLPKIADRVEGHLYDPLG |
Ga0209908_100984413 | 3300027745 | Thawing Permafrost | MCIRDRYKDDAALESHRAAPHFLQFGKKELPKIAERTEGHLFEPLG |
Ga0209908_101637012 | 3300027745 | Thawing Permafrost | MCIRDRYKDDAALEAHRCAPHFLQHARKDLPKIADRVEGHLFEPLG |
Ga0209139_101858962 | 3300027795 | Bog Forest Soil | VGRLREAHRAAPHFLQYAKKELPRIADRTEGQLYEPLG |
Ga0209579_103981351 | 3300027869 | Surface Soil | ALEAHRAAPHFLQYAKKELPKVGDRVEGHLYAPLD |
Ga0209590_105844283 | 3300027882 | Vadose Zone Soil | EQYQDDSAIEAHRSASHFLQYAKKDLPKIADRTEGNLYEPLG |
Ga0209275_104079113 | 3300027884 | Soil | AALEAHRTSAHFLQHARKDLPKVADRVEGHLYEALG |
Ga0209067_101829484 | 3300027898 | Watersheds | YKDDAALEAHRAAPHFLQHARKDLPKIADRVEGHLFEPLG |
Ga0209698_107715903 | 3300027911 | Watersheds | ALEAHRTAPHFLQFARKDLPKVADRVEGHLFEPLG |
Ga0137415_106853001 | 3300028536 | Vadose Zone Soil | QYKDDAALEAHRASSHFLQYAKKELPKLGERVEGNLYAPLG |
Ga0257175_10309243 | 3300028673 | Soil | EQYQDDAALEAHRAAPHFLQYAKKELPKFGDRVEGHLFAPLD |
Ga0302225_100729583 | 3300028780 | Palsa | EQYKDDAALEAHRTTPHFLQYARKDLPRIADRVEGHLYEALA |
Ga0311368_104697951 | 3300029882 | Palsa | YKDDTALEAHRASPHFLQMAKKDLPKLGDRTEGHLFEPLG |
Ga0311327_103777333 | 3300029883 | Bog | EQYKDDAALEAHRNAPHFLQYARKDLPKIADRVEGHLYEPLG |
Ga0311342_110246572 | 3300029955 | Bog | QYKDDAALEAHRAAPHFLQFGKKELPKIADRTEGHLFEPLG |
Ga0311339_100719457 | 3300029999 | Palsa | DDAALEAHRAAPHFLQHARKDLPKFADRVEGHLFEPLG |
Ga0311339_101860601 | 3300029999 | Palsa | ALEAHRTTPHFLQMAKKDLPKIGERTEGHLFEPLG |
Ga0311339_112718621 | 3300029999 | Palsa | KDDAALEAHRTTPHFLQYARKDLPRIADRVEGHLYEALG |
Ga0311353_107321763 | 3300030399 | Palsa | KDDAALEAHRTSAHFLQFGKKELPKIADRTEGHLFEPLG |
Ga0311372_110369491 | 3300030520 | Palsa | AALEAHRNAAHFLQFAKKDLPKVAERVEGHLFEPLG |
Ga0311372_111864471 | 3300030520 | Palsa | YQDDAALEAHRAAPHFLQLAKKDLTKIADRTEGHLFEPLG |
Ga0311355_102941723 | 3300030580 | Palsa | DAALEAHRTTPHFLQYARKDLPRIADRVEGHLYEALA |
Ga0302317_104739472 | 3300030677 | Palsa | ALEAHRSTPHFLQYARKELPKVADRVEGNLFEPLG |
Ga0073994_120303392 | 3300030991 | Soil | EQYKDDAALEAHRTAPHFLQYAKKDLPKIADRVEGHLYEPLG |
Ga0265771_10082971 | 3300031010 | Soil | QYKDDAALEAHRNAPHFLQFARKDLPKIAERVEGHLFEPLG |
Ga0170834_1010942091 | 3300031057 | Forest Soil | KDDAALEAHRATPHFLQYAKKELPKLGDRVEGNLYEPLG |
Ga0302325_101900055 | 3300031234 | Palsa | YEQYNDDAALEAHRAAPHFLQHARKDLPKFADRVEGHLFEPLG |
Ga0302325_116769031 | 3300031234 | Palsa | IYEQYNDDAALEAHRAAPHFLQHARKDLPKFADRVEGHLFEPLG |
Ga0302325_118953981 | 3300031234 | Palsa | DAALEAHRTTPHFLQMGKKDLPKIADRTEGHLFEPLG |
Ga0265340_105517492 | 3300031247 | Rhizosphere | DDAAIEAHRAAPHFLQFAKKDLPKVADRIEGHLFEPIG |
Ga0265339_105685261 | 3300031249 | Rhizosphere | QYQDDAALEAHRTAPHFLQMAKKDLPKIADRTEGHLFEPLG |
Ga0302318_100390991 | 3300031258 | Bog | EQYKDDAALEAHRSTPHFLQYARKDLPKVADRVEGNLFEPLG |
Ga0170820_138324701 | 3300031446 | Forest Soil | YEQYKDDAALEAHRTAPHFLQHARKDLPKIADRVEGHLFEPLG |
Ga0302326_102614031 | 3300031525 | Palsa | KDDAALEAHRTTPHFLQMGKKDLPKIADRTEGHLFEPLG |
Ga0302326_137384021 | 3300031525 | Palsa | QYNDDAALEAHRAAPHFLQHARKDLPKVADRVEGHLFEPLG |
Ga0318573_103232361 | 3300031564 | Soil | DDAGLEAHRAAAHFLQYAKKELPKIADRVEGNLYQPLD |
Ga0318561_106643851 | 3300031679 | Soil | YKDDAGLEAHRAAAHFLQYAKKELPKIADRVEGNLYQPLD |
Ga0310686_1063661491 | 3300031708 | Soil | DDAALEAHRAAPHFLQYARKDLPKVADRVEGHLYEALG |
Ga0307476_105742441 | 3300031715 | Hardwood Forest Soil | KDDAALEAHRTAPHFLQMAKKDLPKVAERTEGHLFEPLG |
Ga0310813_100521174 | 3300031716 | Soil | DAALEAHRAAPHFLQYAKKELPKVADRVDGNLFEPLG |
Ga0307474_100154269 | 3300031718 | Hardwood Forest Soil | ALEAHRTASHFLQLAKKDLPKIADRVEGHLFEPLG |
Ga0307474_100204701 | 3300031718 | Hardwood Forest Soil | DDAALEAHRTSPHFLQHARKDLLKVADRVEGHLYEALG |
Ga0307475_108490001 | 3300031754 | Hardwood Forest Soil | YEQYKDDAALEAHRAAPHFLQHARKDLPKVADRVEGHLFEPLG |
Ga0307478_105740263 | 3300031823 | Hardwood Forest Soil | EQYKDDAALEAHRAAPHFLKYARKELPKIADRVEGHLYEPLG |
Ga0307478_110478373 | 3300031823 | Hardwood Forest Soil | KDDAALEAHRNAPHFLQYARKDLPKIADRVEGNLYEPLG |
Ga0310917_109952313 | 3300031833 | Soil | YKDDAALEAHRAAPHFLRYARKELPKLGDRIEGQLYEPLG |
Ga0306921_112436061 | 3300031912 | Soil | DAALEAHRSAPHFLQFARKELPKIADRVEGNLYEPIA |
Ga0310909_106034321 | 3300031947 | Soil | KDDAALEAHRTAPHFLQHAKKDLPRIADRVEGHLFEPLG |
Ga0308176_125093981 | 3300031996 | Soil | FIYEQYKDDGGLEAHRVAKHFMQYAKKELPRIADRMEGHLYEPLG |
Ga0311301_110604633 | 3300032160 | Peatlands Soil | FIYEQYKDDAALEAHRTAAHFLQYARKDLLKVADRVEGHLFEPIG |
Ga0311301_129543561 | 3300032160 | Peatlands Soil | AALEAHRAAPHFLQYAKKDLPKIGERVEGHLFEPLG |
Ga0307471_1013362911 | 3300032180 | Hardwood Forest Soil | YQDDAALEGHRTAPHFLQFAKKDLPKIADRIEGHLYEPLG |
Ga0307471_1019503731 | 3300032180 | Hardwood Forest Soil | EQYKDDAALEAHRATPHFLQYARKELPRVADRVEGVVYEPLG |
Ga0307472_1005141231 | 3300032205 | Hardwood Forest Soil | EQYKDDAALEAHRAAPHFLQYAKKELPKIADRVEGNLFEPLG |
Ga0307472_1008364272 | 3300032205 | Hardwood Forest Soil | AALEAHRAAPHFLQFAKKDLPKVADRVEGNLFEPLG |
Ga0307472_1016567351 | 3300032205 | Hardwood Forest Soil | ELYQDDAALEAHRAAPHFLQYAKKELPRIADRVEGHLYEPLG |
Ga0335082_102246934 | 3300032782 | Soil | ALEAHRTAPHFLQHAKKDLPKIADRVEGHLFEPLG |
Ga0335079_112240373 | 3300032783 | Soil | YKDDAALEAHRAAPHFLQYAKKELPKLGERIDGQLYEPLG |
Ga0335078_118938101 | 3300032805 | Soil | ELYKDDAALEAHRAAPHFLQYARKDLPKIADRVEGHLYEPLG |
Ga0335080_100147121 | 3300032828 | Soil | KDDAGLEAHRATPHFLQYAKKELPKIAERVEGQLYDPLG |
Ga0335072_111959041 | 3300032898 | Soil | DDAALEAHRSAPHFLQHARKDLPKVADRVEGHLFEPLG |
Ga0335077_120027983 | 3300033158 | Soil | KDDAALEAHRAAPHFLQYAKKELPRHGDRVEGQLYEPLS |
Ga0314864_0001835_2_112 | 3300033805 | Peatland | AALEAHRTAPHFLQMAKKDLPKIADRTEGHLFEPLG |
Ga0314867_070249_699_815 | 3300033808 | Peatland | DDAALEAHRTAPHFLQFARKDLPKVADRVEGHLFEPLG |
Ga0370515_0184412_755_889 | 3300034163 | Untreated Peat Soil | IYEQYKDDAALEAHRASPHFMLYAKKELPKVADRIDGNLYDPLG |
⦗Top⦘ |