| Basic Information | |
|---|---|
| Family ID | F012481 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 280 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MLLVLDVGNTNTVLGVFARVAKVHPGGDSDETPRYERLLANWRV |
| Number of Associated Samples | 223 |
| Number of Associated Scaffolds | 280 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 52.86 % |
| % of genes near scaffold ends (potentially truncated) | 98.21 % |
| % of genes from short scaffolds (< 2000 bps) | 92.14 % |
| Associated GOLD sequencing projects | 209 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.143 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.786 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.857 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.429 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 29.17% Coil/Unstructured: 70.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 280 Family Scaffolds |
|---|---|---|
| PF03099 | BPL_LplA_LipB | 34.64 |
| PF02237 | BPL_C | 32.86 |
| PF08279 | HTH_11 | 18.21 |
| PF01729 | QRPTase_C | 2.14 |
| PF02749 | QRPTase_N | 1.43 |
| PF10458 | Val_tRNA-synt_C | 1.43 |
| PF03309 | Pan_kinase | 0.71 |
| PF02687 | FtsX | 0.36 |
| PF00365 | PFK | 0.36 |
| PF04337 | DUF480 | 0.36 |
| PF02224 | Cytidylate_kin | 0.36 |
| PF07676 | PD40 | 0.36 |
| PF01026 | TatD_DNase | 0.36 |
| PF01243 | Putative_PNPOx | 0.36 |
| PF12891 | Glyco_hydro_44 | 0.36 |
| COG ID | Name | Functional Category | % Frequency in 280 Family Scaffolds |
|---|---|---|---|
| COG0340 | Biotin-protein ligase | Coenzyme transport and metabolism [H] | 67.50 |
| COG0095 | Lipoate-protein ligase A | Coenzyme transport and metabolism [H] | 34.64 |
| COG0321 | Lipoate-protein ligase B | Coenzyme transport and metabolism [H] | 34.64 |
| COG0157 | Nicotinate-nucleotide pyrophosphorylase | Coenzyme transport and metabolism [H] | 3.57 |
| COG1488 | Nicotinic acid phosphoribosyltransferase | Coenzyme transport and metabolism [H] | 3.57 |
| COG1521 | Pantothenate kinase type III | Coenzyme transport and metabolism [H] | 0.71 |
| COG0205 | 6-phosphofructokinase | Carbohydrate transport and metabolism [G] | 0.36 |
| COG0283 | Cytidylate kinase | Nucleotide transport and metabolism [F] | 0.36 |
| COG3132 | Uncharacterized conserved protein YceH, UPF0502 family | Function unknown [S] | 0.36 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.14 % |
| Unclassified | root | N/A | 2.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps_contig98015.57703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2735 | Open in IMG/M |
| 3300000789|JGI1027J11758_11773731 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300001174|JGI12679J13547_1002006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1100 | Open in IMG/M |
| 3300001593|JGI12635J15846_10337560 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300001593|JGI12635J15846_10760421 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100295766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1503 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100509318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1081 | Open in IMG/M |
| 3300004080|Ga0062385_10485124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 759 | Open in IMG/M |
| 3300004082|Ga0062384_100948089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 612 | Open in IMG/M |
| 3300004092|Ga0062389_101930778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 768 | Open in IMG/M |
| 3300004152|Ga0062386_100811077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 771 | Open in IMG/M |
| 3300004471|Ga0068965_1182448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 559 | Open in IMG/M |
| 3300004617|Ga0068955_1225394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 504 | Open in IMG/M |
| 3300004635|Ga0062388_100338756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1276 | Open in IMG/M |
| 3300004635|Ga0062388_101076004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 787 | Open in IMG/M |
| 3300005171|Ga0066677_10107558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1484 | Open in IMG/M |
| 3300005176|Ga0066679_10861977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 573 | Open in IMG/M |
| 3300005435|Ga0070714_101234870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 729 | Open in IMG/M |
| 3300005468|Ga0070707_100342781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1452 | Open in IMG/M |
| 3300005534|Ga0070735_10289818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 988 | Open in IMG/M |
| 3300005538|Ga0070731_10570851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 753 | Open in IMG/M |
| 3300005538|Ga0070731_10617081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 721 | Open in IMG/M |
| 3300005541|Ga0070733_11029537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 553 | Open in IMG/M |
| 3300005541|Ga0070733_11138042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 523 | Open in IMG/M |
| 3300005542|Ga0070732_10043632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2580 | Open in IMG/M |
| 3300005542|Ga0070732_10664805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 634 | Open in IMG/M |
| 3300005560|Ga0066670_10686322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 621 | Open in IMG/M |
| 3300005575|Ga0066702_10678273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 615 | Open in IMG/M |
| 3300005903|Ga0075279_10035665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 782 | Open in IMG/M |
| 3300005921|Ga0070766_10267098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1090 | Open in IMG/M |
| 3300005950|Ga0066787_10105648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 604 | Open in IMG/M |
| 3300005994|Ga0066789_10236607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 767 | Open in IMG/M |
| 3300006041|Ga0075023_100502966 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300006050|Ga0075028_100833144 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300006052|Ga0075029_100433842 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300006052|Ga0075029_101276501 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300006086|Ga0075019_10396232 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300006175|Ga0070712_100300761 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300006176|Ga0070765_100138646 | All Organisms → cellular organisms → Bacteria | 2156 | Open in IMG/M |
| 3300006176|Ga0070765_101432314 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300006904|Ga0075424_101589823 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300009038|Ga0099829_11017007 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300009090|Ga0099827_10018640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4760 | Open in IMG/M |
| 3300009143|Ga0099792_10221101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1088 | Open in IMG/M |
| 3300009521|Ga0116222_1211101 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300009522|Ga0116218_1334540 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300009524|Ga0116225_1144533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1087 | Open in IMG/M |
| 3300009552|Ga0116138_1005398 | All Organisms → cellular organisms → Bacteria | 5096 | Open in IMG/M |
| 3300009624|Ga0116105_1133846 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300009635|Ga0116117_1100107 | Not Available | 726 | Open in IMG/M |
| 3300009637|Ga0116118_1010374 | All Organisms → cellular organisms → Bacteria | 3677 | Open in IMG/M |
| 3300009641|Ga0116120_1205566 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300009645|Ga0116106_1100502 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300009700|Ga0116217_10324838 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300009824|Ga0116219_10564968 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300010048|Ga0126373_11473678 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300010048|Ga0126373_13297649 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300010339|Ga0074046_10169938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1383 | Open in IMG/M |
| 3300010339|Ga0074046_10180107 | Not Available | 1336 | Open in IMG/M |
| 3300010341|Ga0074045_10208948 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300010358|Ga0126370_12209427 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300010361|Ga0126378_11322894 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300010371|Ga0134125_11877168 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300010376|Ga0126381_104123379 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300010398|Ga0126383_11295888 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300010398|Ga0126383_11848218 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300011089|Ga0138573_1310834 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300011120|Ga0150983_15646956 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300011120|Ga0150983_15698278 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300011120|Ga0150983_16385442 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300011269|Ga0137392_11256197 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300011271|Ga0137393_10940747 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300012096|Ga0137389_10325507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1304 | Open in IMG/M |
| 3300012189|Ga0137388_11008489 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300012205|Ga0137362_10026261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4562 | Open in IMG/M |
| 3300012210|Ga0137378_10856694 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300012354|Ga0137366_10864344 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300012493|Ga0157355_1036447 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300012922|Ga0137394_11399541 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300012971|Ga0126369_11836185 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300012971|Ga0126369_12766303 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300012989|Ga0164305_11849113 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300014159|Ga0181530_10111149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1621 | Open in IMG/M |
| 3300014164|Ga0181532_10562833 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300014164|Ga0181532_10646144 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300014169|Ga0181531_10852851 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300014489|Ga0182018_10621325 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300014490|Ga0182010_10474261 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300014492|Ga0182013_10089719 | All Organisms → cellular organisms → Bacteria | 2118 | Open in IMG/M |
| 3300014495|Ga0182015_10555961 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300014501|Ga0182024_10575252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1416 | Open in IMG/M |
| 3300014657|Ga0181522_10404122 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300014657|Ga0181522_10463633 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300014657|Ga0181522_10846415 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300014969|Ga0157376_10269876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1598 | Open in IMG/M |
| 3300015052|Ga0137411_1026435 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300015052|Ga0137411_1277965 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300015241|Ga0137418_10204647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1703 | Open in IMG/M |
| 3300016270|Ga0182036_10322470 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300016422|Ga0182039_11898602 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300016445|Ga0182038_11372143 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300016700|Ga0181513_1018749 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300017823|Ga0187818_10247240 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300017929|Ga0187849_1277930 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300017929|Ga0187849_1306333 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300017929|Ga0187849_1350988 | Not Available | 544 | Open in IMG/M |
| 3300017930|Ga0187825_10060698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 1285 | Open in IMG/M |
| 3300017930|Ga0187825_10109983 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300017938|Ga0187854_10304119 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300017938|Ga0187854_10347423 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300017938|Ga0187854_10452067 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300017943|Ga0187819_10689284 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300017961|Ga0187778_10079877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2017 | Open in IMG/M |
| 3300017961|Ga0187778_10119777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1645 | Open in IMG/M |
| 3300017966|Ga0187776_11486470 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300017966|Ga0187776_11605493 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300017970|Ga0187783_11189430 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300017972|Ga0187781_10394200 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300017995|Ga0187816_10394083 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300018002|Ga0187868_1083813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1266 | Open in IMG/M |
| 3300018003|Ga0187876_1235085 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300018007|Ga0187805_10150855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1057 | Open in IMG/M |
| 3300018019|Ga0187874_10298131 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300018020|Ga0187861_10414208 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300018023|Ga0187889_10510141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300018026|Ga0187857_10405466 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300018030|Ga0187869_10113937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1358 | Open in IMG/M |
| 3300018037|Ga0187883_10108261 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1441 | Open in IMG/M |
| 3300018038|Ga0187855_10519893 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300018042|Ga0187871_10254348 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300018042|Ga0187871_10795907 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300018043|Ga0187887_10824255 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300018044|Ga0187890_10431488 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300018047|Ga0187859_10611782 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300018057|Ga0187858_10599223 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300018062|Ga0187784_10273429 | Not Available | 1374 | Open in IMG/M |
| 3300018085|Ga0187772_10126232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1673 | Open in IMG/M |
| 3300018085|Ga0187772_11291510 | Not Available | 540 | Open in IMG/M |
| 3300018086|Ga0187769_10882086 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300018086|Ga0187769_10899636 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300018086|Ga0187769_11456383 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300018088|Ga0187771_10355945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1231 | Open in IMG/M |
| 3300018088|Ga0187771_11539869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300018090|Ga0187770_10341578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1169 | Open in IMG/M |
| 3300019278|Ga0187800_1222395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 525 | Open in IMG/M |
| 3300019787|Ga0182031_1409270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1745 | Open in IMG/M |
| 3300020170|Ga0179594_10317368 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300020199|Ga0179592_10273460 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300020580|Ga0210403_10109865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2239 | Open in IMG/M |
| 3300020580|Ga0210403_11284301 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300020581|Ga0210399_11286915 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300020583|Ga0210401_10014384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7664 | Open in IMG/M |
| 3300020583|Ga0210401_11637779 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300021168|Ga0210406_11323106 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300021170|Ga0210400_10697517 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300021171|Ga0210405_10220645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1502 | Open in IMG/M |
| 3300021171|Ga0210405_11255309 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300021171|Ga0210405_11300045 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300021178|Ga0210408_10180003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1679 | Open in IMG/M |
| 3300021178|Ga0210408_10655114 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300021180|Ga0210396_10388070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 1228 | Open in IMG/M |
| 3300021180|Ga0210396_11356581 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300021181|Ga0210388_10372626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1255 | Open in IMG/M |
| 3300021401|Ga0210393_10609231 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300021401|Ga0210393_11352855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 570 | Open in IMG/M |
| 3300021405|Ga0210387_10117339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2244 | Open in IMG/M |
| 3300021432|Ga0210384_10186037 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1867 | Open in IMG/M |
| 3300021433|Ga0210391_10279147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1311 | Open in IMG/M |
| 3300021477|Ga0210398_10069131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2874 | Open in IMG/M |
| 3300021477|Ga0210398_11007901 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300021479|Ga0210410_11402319 | Not Available | 591 | Open in IMG/M |
| 3300021479|Ga0210410_11533067 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300021559|Ga0210409_10698682 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300021559|Ga0210409_11486449 | Not Available | 553 | Open in IMG/M |
| 3300021560|Ga0126371_10751307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1122 | Open in IMG/M |
| 3300021861|Ga0213853_11349026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1543 | Open in IMG/M |
| 3300022515|Ga0224546_1032868 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300022521|Ga0224541_1002545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1870 | Open in IMG/M |
| 3300022722|Ga0242657_1049434 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300023090|Ga0224558_1169241 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300023101|Ga0224557_1220781 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300024251|Ga0247679_1043230 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300024295|Ga0224556_1178639 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300025412|Ga0208194_1002585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3547 | Open in IMG/M |
| 3300025454|Ga0208039_1035125 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300025457|Ga0208850_1074655 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300025527|Ga0208714_1005347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3460 | Open in IMG/M |
| 3300025915|Ga0207693_10051951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3215 | Open in IMG/M |
| 3300025915|Ga0207693_11064186 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300025922|Ga0207646_10294009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1467 | Open in IMG/M |
| 3300025922|Ga0207646_11667902 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300025928|Ga0207700_11020686 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300026354|Ga0257180_1062393 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300026499|Ga0257181_1022817 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300026532|Ga0209160_1337278 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300026552|Ga0209577_10282504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1243 | Open in IMG/M |
| 3300026557|Ga0179587_10082085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1919 | Open in IMG/M |
| 3300027535|Ga0209734_1027373 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300027537|Ga0209419_1050933 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300027591|Ga0209733_1044957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1175 | Open in IMG/M |
| 3300027625|Ga0208044_1165227 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300027629|Ga0209422_1127997 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300027641|Ga0208827_1031956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1871 | Open in IMG/M |
| 3300027641|Ga0208827_1127194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300027648|Ga0209420_1082074 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300027676|Ga0209333_1198256 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300027684|Ga0209626_1069551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 893 | Open in IMG/M |
| 3300027698|Ga0209446_1071605 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300027767|Ga0209655_10030801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1796 | Open in IMG/M |
| 3300027824|Ga0209040_10266684 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300027824|Ga0209040_10535314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 513 | Open in IMG/M |
| 3300027853|Ga0209274_10110247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1363 | Open in IMG/M |
| 3300027854|Ga0209517_10186077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1295 | Open in IMG/M |
| 3300027854|Ga0209517_10443680 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300027854|Ga0209517_10736506 | Not Available | 503 | Open in IMG/M |
| 3300027855|Ga0209693_10068227 | All Organisms → cellular organisms → Bacteria | 1753 | Open in IMG/M |
| 3300027884|Ga0209275_10010769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3908 | Open in IMG/M |
| 3300027889|Ga0209380_10663286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 601 | Open in IMG/M |
| 3300027898|Ga0209067_10757922 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300027903|Ga0209488_11122627 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 535 | Open in IMG/M |
| 3300028536|Ga0137415_10391598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1194 | Open in IMG/M |
| 3300028536|Ga0137415_10460809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1077 | Open in IMG/M |
| 3300028560|Ga0302144_10254678 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300028759|Ga0302224_10253582 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300028772|Ga0302209_10083616 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300028776|Ga0302303_10076537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1254 | Open in IMG/M |
| 3300028785|Ga0302201_10260069 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300028800|Ga0265338_10932062 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300028874|Ga0302155_10449328 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300028906|Ga0308309_10354542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1251 | Open in IMG/M |
| 3300029636|Ga0222749_10627450 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300029903|Ga0247271_100374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 12655 | Open in IMG/M |
| 3300029903|Ga0247271_116811 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300029915|Ga0311358_11172712 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300029917|Ga0311326_10443559 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300029945|Ga0311330_10877001 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300029982|Ga0302277_1175945 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300029982|Ga0302277_1361979 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300029993|Ga0302304_10276107 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300030002|Ga0311350_11455824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300030020|Ga0311344_10487302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1097 | Open in IMG/M |
| 3300030041|Ga0302274_10213659 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300030057|Ga0302176_10041992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1748 | Open in IMG/M |
| 3300030057|Ga0302176_10346060 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300030058|Ga0302179_10047290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1947 | Open in IMG/M |
| 3300030294|Ga0311349_11719204 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300030618|Ga0311354_10507859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1190 | Open in IMG/M |
| 3300030763|Ga0265763_1056594 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300030814|Ga0265741_108135 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300030879|Ga0265765_1026808 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300031090|Ga0265760_10326169 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300031234|Ga0302325_10909828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1219 | Open in IMG/M |
| 3300031236|Ga0302324_103118676 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300031244|Ga0302297_1063959 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300031708|Ga0310686_102012529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 954 | Open in IMG/M |
| 3300031708|Ga0310686_106647217 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300031708|Ga0310686_108397850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8395 | Open in IMG/M |
| 3300031708|Ga0310686_108521679 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300031715|Ga0307476_10082559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2245 | Open in IMG/M |
| 3300031719|Ga0306917_11173403 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300031740|Ga0307468_102099451 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300031753|Ga0307477_10588942 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300031754|Ga0307475_11229365 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300031754|Ga0307475_11494195 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300031820|Ga0307473_10555963 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300031823|Ga0307478_10200141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1607 | Open in IMG/M |
| 3300031823|Ga0307478_10234947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1485 | Open in IMG/M |
| 3300031942|Ga0310916_10673115 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300032067|Ga0318524_10056734 | All Organisms → cellular organisms → Bacteria | 1877 | Open in IMG/M |
| 3300032782|Ga0335082_10781998 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300032783|Ga0335079_10415957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1447 | Open in IMG/M |
| 3300032805|Ga0335078_10207387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2714 | Open in IMG/M |
| 3300032805|Ga0335078_11206584 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300032828|Ga0335080_11662744 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300032893|Ga0335069_10913358 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300032954|Ga0335083_10281630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1470 | Open in IMG/M |
| 3300033158|Ga0335077_10008666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 12613 | Open in IMG/M |
| 3300033158|Ga0335077_10889615 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300033547|Ga0316212_1021471 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300033823|Ga0334837_074093 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.79% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 7.86% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.14% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.36% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.36% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.57% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.21% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.21% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.21% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.86% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.14% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.14% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.14% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.50% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.43% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.07% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.07% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.71% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.71% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.71% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.36% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.36% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.36% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.36% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.36% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.36% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.36% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.36% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.36% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.36% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.36% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.36% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.36% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001174 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004471 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004617 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005903 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011089 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012493 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300016700 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022515 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 1-5 | Environmental | Open in IMG/M |
| 3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025454 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028772 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_1 | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028785 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028874 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029982 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030814 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031244 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_2 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| 3300033823 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S3 30-34 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_00831010 | 2199352024 | Soil | MLLVIDVGNTNTVLGVFARAAKVHPRSEAEDDARYERLMANWRVATSR |
| JGI1027J11758_117737312 | 3300000789 | Soil | MLLVIDVGNTNTVLGVFARVAKVHPGGDAEDEAGYERLV |
| JGI12679J13547_10020062 | 3300001174 | Forest Soil | MLLVIDVGNTNTVLGVFARVAKVHPAGEKDETPRYERLVANWRVATSR |
| JGI12635J15846_103375602 | 3300001593 | Forest Soil | MLFVLDVGNTNTVLGVFARSEKPHSGGDAGSNEAPRYERLVAN |
| JGI12635J15846_107604212 | 3300001593 | Forest Soil | MLLVLDVGNTNTVLGVFAPGTKAPSAADRGVEAESP |
| JGIcombinedJ26739_1002957663 | 3300002245 | Forest Soil | MLFVLDVGNTNTVLGVFARAPGVPPDQDSDTAPHYDHLVANWRVATRQGSTVD |
| JGIcombinedJ26739_1005093182 | 3300002245 | Forest Soil | MLFVLDVGNTNTVLGVFARAKAHSEDADRAPRYDQLVANWRVAT |
| Ga0062385_104851241 | 3300004080 | Bog Forest Soil | MLFVLDVGNTNTVLGVFDHAAKSHPVGDAGGTPRYERLVANWRVATRQG |
| Ga0062384_1009480891 | 3300004082 | Bog Forest Soil | MLFVLDVGNTNTVLGVFDHAAKSHPVGDAGGTPRYERLVANWRVATRQGS |
| Ga0062389_1019307782 | 3300004092 | Bog Forest Soil | MLFVLDVGNTNTVLGVFDHAAKSHPVGDAGGTPRYERLVANWRV |
| Ga0062386_1008110771 | 3300004152 | Bog Forest Soil | MLLVIDVGNTNTVLGVFARVAKVHPGGDLDDPPRYERLVANWRVATSRTS |
| Ga0068965_11824481 | 3300004471 | Peatlands Soil | MLFVLDVGNTNTVLGVFARVAKVHPDGDAEGSPRYERLVANWRVATR |
| Ga0068955_12253942 | 3300004617 | Peatlands Soil | MLLVLDVGNTNTVLGVFARVAKVAPAANRSAETESPRYELLVANWR |
| Ga0062388_1003387562 | 3300004635 | Bog Forest Soil | MLFVLDVGNTNTVLGVFARAAITSASDTDATPRYDRLVANWRVA |
| Ga0062388_1010760042 | 3300004635 | Bog Forest Soil | MLFVLDVGNTNTVLGVFDHAAKSHPVGDAGGTPRYERLVANWRVATRQGST |
| Ga0066677_101075583 | 3300005171 | Soil | MLLVLDVGNTNTVLGVFARVAKVNAAEAVLSPDAVRYERLV |
| Ga0066679_108619771 | 3300005176 | Soil | MLLVIDVGNTNTVLGVFARAGDAQRPSEVDDGSRYERLMANWRVATSRRS |
| Ga0070714_1012348701 | 3300005435 | Agricultural Soil | MLLVIDVGNTNTVLGVFARAAKVHPDGDADEERYERLLANWRVATSRRSTV |
| Ga0070707_1003427811 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLVIDVGNTNTVLGVFARVAHVHPGEDPSSEPVRYERLVANWRVGSH |
| Ga0070735_102898181 | 3300005534 | Surface Soil | MLLVIDVGNTNTVLGVYARVAKVPTGSDADGPGQYKRLLANWRVATSRTST |
| Ga0070731_105708511 | 3300005538 | Surface Soil | MLLVIDVGNTNTVLGVFARVAKVHPGGEADEPPRYERLLANWRVA |
| Ga0070731_106170812 | 3300005538 | Surface Soil | MLLVIDVGNTNTVLGVFAGVAKVHPGESAQHDPRYERLVAHWRVAT |
| Ga0070733_110295371 | 3300005541 | Surface Soil | MLLVIDVGNTNTVLGVFARVAGAPAESEEAPRYERLVANWR |
| Ga0070733_111380422 | 3300005541 | Surface Soil | MLLVIDVGNTNTVLGVFARVAKVHPGGDADELPRYERLLANW |
| Ga0070732_100436321 | 3300005542 | Surface Soil | MLLVIDVGNTNTVLGVFARVSKVHPGGEADDIPRYERLVANWR |
| Ga0070732_106648052 | 3300005542 | Surface Soil | MLLVVDVGNTNTVLGVFARVAKVHPGSEEASNGARYERLVAQWRVATVLN |
| Ga0066670_106863222 | 3300005560 | Soil | MLLVIDVGNTNTVLGVFARVAEAREHAETPRYERLVANWRVATS |
| Ga0066702_106782731 | 3300005575 | Soil | MLFVLDVGNTNTVLGVFARCEKADAGAESVDTPRYERLAAHWRVATRQS |
| Ga0075279_100356651 | 3300005903 | Rice Paddy Soil | MLLVVDVGNTNTVLGVFARVAKLPADATAAGSAPRYELLVANWRVA |
| Ga0070766_102670982 | 3300005921 | Soil | MLLVIDVGNTNTVLGVFARAEARPAGDHDETPRYERLVANW |
| Ga0066787_101056482 | 3300005950 | Soil | MLLVIDVGNTNTVLGVFERVAHRPGEDVTTETARYERLVANWRVGSHLNRTV |
| Ga0066789_102366071 | 3300005994 | Soil | MLLVIDVGNTNTVLGVFARVAKVNTPGDSDETPRYERLVANWRVATSRTST |
| Ga0075023_1005029662 | 3300006041 | Watersheds | MLLVIDVGNTNTVLGVFERVAHGAGEDVTTEAARYERLVANWRVG |
| Ga0075028_1008331441 | 3300006050 | Watersheds | MLLVIDVGNTNTVLGVFARVAKVHEGGDEHSPARYERLLANWRVATSR |
| Ga0075029_1004338422 | 3300006052 | Watersheds | MLLVIDVGNTNTVLGVFARVAHLHPGADASSPEPQRY |
| Ga0075029_1012765011 | 3300006052 | Watersheds | MLLVLDVGNTNTVLGVFARVAKVHAAEPTSGDVPRYELLVAN |
| Ga0075019_103962321 | 3300006086 | Watersheds | MLLVMDVGNTNTVLGVFERVPHRPGEDVTTEAARYEKLVANWRVGSHLA |
| Ga0070712_1003007612 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLVIDVGNTNTVLGVFAGVDKGRSGEEPRNGAHYQRLVAQWRVATALNHTV |
| Ga0070765_1001386464 | 3300006176 | Soil | MLFVLDVGNTNTVLGVFARVANPHPEGDANDPLRYERLVANWRVATKQGSTV |
| Ga0070765_1014323142 | 3300006176 | Soil | MLLVLDVGNTNTVLGVFAKAKVAPASSRSAEPESSHY |
| Ga0075424_1015898232 | 3300006904 | Populus Rhizosphere | MLLVLDVGNTNTVLGVFARVAKVQPGEHAAEGEPHYKLLVAQWRVGTSYTQ |
| Ga0099829_110170071 | 3300009038 | Vadose Zone Soil | MLLVIDVGNTNTVLGVFERVAHRPGDDVTTETVRYERLVANWRVGSH |
| Ga0099827_100186404 | 3300009090 | Vadose Zone Soil | MLSGEGSLAKDNAMLFVLDVGNTNTGLGVFARAENSDAVDTPRYQRLVANWRVATRQGS |
| Ga0099792_102211012 | 3300009143 | Vadose Zone Soil | MLFVLDVGNTNTVLGVFARAENIRAGEDGSAPRYERLVANWRVA |
| Ga0116222_12111011 | 3300009521 | Peatlands Soil | MLLVIDVGNTNTVLGVFARVAKVHPGGGSEDPTRYERLMANWRVATSQTGTVD |
| Ga0116218_13345401 | 3300009522 | Peatlands Soil | MLLVLDVGNTNTVLGVFARVAKVAPAASRGAEAESHGYE |
| Ga0116225_11445331 | 3300009524 | Peatlands Soil | MLLVIDVGNTNTVLGVFARVAKVHPAGDSDETPRYER |
| Ga0116138_10053981 | 3300009552 | Peatland | MLFVLDVGNTNTVLGVFARVAKVHPDGDADDPPRYERLVANWR |
| Ga0116105_11338462 | 3300009624 | Peatland | MLLVLDVGNTNTVLGVFGRVAKATSGGDPDDGPRYERLLANWRVATVQRSTV |
| Ga0116117_11001071 | 3300009635 | Peatland | MLLVIDVGNTNTVLGVFERVEHRPGEDVTGTETARYERLAANWR |
| Ga0116118_10103741 | 3300009637 | Peatland | MLLVIDVGNTNTVLGVFAQVERRPGEDVTGTEAVRYERLVANW |
| Ga0116120_12055662 | 3300009641 | Peatland | MLFVLDVGNTNTVLGVFARVAKVHPGGDTDDSPRYERLVANWRVATRQGSTV |
| Ga0116106_11005021 | 3300009645 | Peatland | MLLVIDVGNTNTVLGVFREAHRPGEDVTSEPARYEHLVANWRV |
| Ga0116217_103248381 | 3300009700 | Peatlands Soil | MLLVLDVGNTNTVLGVFAKVAKVAPSASRGADTESPRYEL |
| Ga0116219_105649682 | 3300009824 | Peatlands Soil | MLLVLDVGNTNTVLGVFAKVAKVAPVASHNVRVDAPRYELLVANWR |
| Ga0126373_114736781 | 3300010048 | Tropical Forest Soil | MLLVIDVGNTNTVLGVFARVAKVHPEPDDDEPAQFKRLLANWRVATS |
| Ga0126373_132976491 | 3300010048 | Tropical Forest Soil | MLLVIDVGNTNTVLGVFARVAKAPPGPDEEEPAQFKRLLA |
| Ga0074046_101699382 | 3300010339 | Bog Forest Soil | MLFVLDVGNTNTVLGVFARVAKARPDGEVNDPPRYER |
| Ga0074046_101801071 | 3300010339 | Bog Forest Soil | MLLVIDVGNTNTVLGVFEQTAHRPGEDVTTDPPRYER |
| Ga0074045_102089481 | 3300010341 | Bog Forest Soil | MLFVLDVGNTNTVLGVFARVAKVHPGGDADESPRYERLLA |
| Ga0126370_122094271 | 3300010358 | Tropical Forest Soil | MLLVLDVGNTNTVLGVFARVAKIRAGGDADDPRYEHLVANWRV |
| Ga0126378_113228941 | 3300010361 | Tropical Forest Soil | MLLVIDVGNTNTVLGVFARVEKVPPRTDADEQRYERLLANWR |
| Ga0134125_118771681 | 3300010371 | Terrestrial Soil | MLLVLDVGNTNAVLGVFARAEKLRGGSSAVDSSARYDLLVAHWRVSTNPT |
| Ga0126381_1041233792 | 3300010376 | Tropical Forest Soil | MLFVIDVGNTNTVLGVFARVAKVHAGENAQNDTHYERLVAHWRVA |
| Ga0126383_112958881 | 3300010398 | Tropical Forest Soil | MLLVIDVGNTNTVLGVFARVAKVHPGGDADAERYERLLANWRVATSRTST |
| Ga0126383_118482181 | 3300010398 | Tropical Forest Soil | MLLVIDVGNTNTVLGVFARVAKVHEGGEADEPARYDRLLANW |
| Ga0138573_13108342 | 3300011089 | Peatlands Soil | MLFVLDVGNTNTVLGVFARVAKVHPDGDAEGSPRYER |
| Ga0150983_156469562 | 3300011120 | Forest Soil | MLFVLDVGNTNTVLGVFARVASQHSDASPIDPPRYEKLV |
| Ga0150983_156982782 | 3300011120 | Forest Soil | MLFVLDVGNTNTVLGVFARAEKPHPGGDADSAPRYERLVANWRVATRQGSTV |
| Ga0150983_163854422 | 3300011120 | Forest Soil | MLLVIDVGNTNTVLGVFARASEVPAGAADETPRYERLVANWRVA |
| Ga0137392_112561972 | 3300011269 | Vadose Zone Soil | MLLVLDVGNTNTVLGVFARVAKAAGELDEPPPYDRLVAHWR |
| Ga0137393_109407471 | 3300011271 | Vadose Zone Soil | MLLVIDVGNTNTVLGVFERVAHRPGEDVTTETARYER |
| Ga0137389_103255071 | 3300012096 | Vadose Zone Soil | MLLVLDVGNTNTVLGVFARDANAQGGDAGDSPRNGRLVANWRVA |
| Ga0137388_110084891 | 3300012189 | Vadose Zone Soil | MLSGEGSLAKDNAMLFVLDVGNTNTVLGVFARAENSDAGDTPRYRRLVANWRVATRQ |
| Ga0137362_100262611 | 3300012205 | Vadose Zone Soil | MLLVIDVGNTNTVLGVFARVAKVHPADGAAETPHYERLVAHWR |
| Ga0137378_108566941 | 3300012210 | Vadose Zone Soil | MLLVIDVGNTNTVLGVFARVAKVHPAGEQDETPRYERLVANWRV |
| Ga0137366_108643441 | 3300012354 | Vadose Zone Soil | MLLVIDVGNTNTVLGVFARVVKAHSPGAQDEVPRYERLVANWRVATSRTS |
| Ga0157355_10364471 | 3300012493 | Unplanted Soil | MLLVIDVGNTNTVLGVFARVANVPAGGDADDPPRYE |
| Ga0137394_113995412 | 3300012922 | Vadose Zone Soil | MLFVLDVGNTNTVLGVFARLEETRLDGDNSAPRYQRLVANWRVA |
| Ga0126369_118361851 | 3300012971 | Tropical Forest Soil | MLLVIDVGNTNTVLGVYGRVEKLHAGDGEDASGQYKRLLANWRV |
| Ga0126369_127663032 | 3300012971 | Tropical Forest Soil | MLLVIDVGNTNTVLGVFAGMAKLHGAESTASDSARYERLVAQWRVATV |
| Ga0164305_118491132 | 3300012989 | Soil | MLLVIDVGNTNTVLGVFARVAKVQPGAEADDDARYE |
| Ga0181530_101111493 | 3300014159 | Bog | MLLVLDVGNTNTVLGVFARVAKVHAGGDLDEPSRYERLLANWRVATS |
| Ga0181532_105628332 | 3300014164 | Bog | MLLVLDVGNTNTVLGVFAKVARGAGAAHGVESAAPRYELLVAN |
| Ga0181532_106461441 | 3300014164 | Bog | MLLVIDVGNTHTVLGVFERVGHRPGEDVTGTEAARYERLVANWR |
| Ga0181531_108528511 | 3300014169 | Bog | MLLVLDVGNTNTVLGVFAKVARSAGAAHGVESAPPRYE |
| Ga0182018_106213251 | 3300014489 | Palsa | MLFVLDVGNTNTVLGVFACAEKPHPDPDDKAPYYEHLVANWRVA |
| Ga0182010_104742611 | 3300014490 | Fen | MLLVIDVGNTNTVLGVFARVTHRPGGDAATKTEEARYELPV |
| Ga0182013_100897191 | 3300014492 | Bog | MLLVLDVGNTNTVLGVFAKVAKVAAAASRSDQSTSPHYELLVANWRVAT |
| Ga0182015_105559612 | 3300014495 | Palsa | MLLVLDVGNTNTVLGVFARVVDVRRGGAPTETPDEM |
| Ga0182024_105752521 | 3300014501 | Permafrost | MLLVIDVGNTNTVLGVFARAGEGHAPGSANETQRYERLVANWRVATS |
| Ga0181522_104041221 | 3300014657 | Bog | MLLVIDVGNTNTVLGVFARVAKVHPTGDKDGTAHEATHDAHNEAQHYERLVANWRVATSRTST |
| Ga0181522_104636331 | 3300014657 | Bog | MLFVLDVGNTNTVLGVFARAKTPAGDANDATRYERLVANWRVATRQGSTV |
| Ga0181522_108464152 | 3300014657 | Bog | MLLVLDVGNTNAVLGVFARVAKVGSAEASSGEGRYELLV |
| Ga0157376_102698763 | 3300014969 | Miscanthus Rhizosphere | MLFVIDVGNTNTVLGVFARVAKASAAGEQDEAPHYERLVANWRVA |
| Ga0137411_10264351 | 3300015052 | Vadose Zone Soil | MLLVIDVGNTNTVLGVFARAAEDGAGDNLSDGTHPTMDTW |
| Ga0137411_12779651 | 3300015052 | Vadose Zone Soil | FLMLLVIDVGNTNTVLGVFARVANLQPGDRMAETPHL* |
| Ga0137418_102046472 | 3300015241 | Vadose Zone Soil | MLLVLDVGNTNTVLGVFAKAAKDGGTGSLQYEHLVANWRVAQASKSASSAATIRS* |
| Ga0182036_103224701 | 3300016270 | Soil | MLLVIDVGNTNTVLGVFAPLVKVHPSNAGDVPRYQRLVAHWRVAT |
| Ga0182039_118986021 | 3300016422 | Soil | MLLVIDVGNTNTVLGVFARVAKVHPGDASNDSARYERRVAHWRVAT |
| Ga0182038_113721432 | 3300016445 | Soil | MLLVIDVGNTNTVLGVFARSAKPQPGGDANDQARYERLLANWRVATSRTS |
| Ga0181513_10187491 | 3300016700 | Peatland | MLFVLDVGNTNTVLGVFARLAKAHSDGDANDPPRYER |
| Ga0187818_102472402 | 3300017823 | Freshwater Sediment | MLLVLDVGNTNTVLGVFAKVAKVAPAESRMTETESPRYELLVANWRVA |
| Ga0187849_12779302 | 3300017929 | Peatland | MLLVIDIGNTNTVLGVFARVAHRSGEDVTTETARYERLVANWRVGSHL |
| Ga0187849_13063332 | 3300017929 | Peatland | MLLVIDVGNTNTVLGVFGQVEHRPGEDVTGTEAVRYERLVA |
| Ga0187849_13509882 | 3300017929 | Peatland | MLFVLDVGNTNTVLGVFARVAKVHPDGDADDPPRYER |
| Ga0187825_100606981 | 3300017930 | Freshwater Sediment | MLLVIDVGNTNTVLGVFARVAKLHAGEAASEPARYERLVAHWRVATALNHT |
| Ga0187825_101099832 | 3300017930 | Freshwater Sediment | MLLVLDVGNTNAVLGVFARVKKVGAEETRASESGRY |
| Ga0187854_103041192 | 3300017938 | Peatland | MLFVLDVGNTNTVLGVFARLAKAHSDGDANDPPRYERLVANWRVATRQGST |
| Ga0187854_103474232 | 3300017938 | Peatland | MLLVIDVGNTHTVLGVFERAAHPPGEDVTGTEAARYDRLVANWRVGS |
| Ga0187854_104520672 | 3300017938 | Peatland | MLLVIDVGNTNTVLGVFEQMAHRPGEDVTTDPVRY |
| Ga0187819_106892842 | 3300017943 | Freshwater Sediment | MLLVLDVGNTNTVLGVFAREAKPRPAPNRDAGEPPHYGHLLANW |
| Ga0187778_100798771 | 3300017961 | Tropical Peatland | MLLVIDVGNTNTVLGVFARVAKVHPGGDADDSTRYERLVANWRV |
| Ga0187778_101197771 | 3300017961 | Tropical Peatland | MLLVLDVGNTNTVLGVFARVAKANQSKSGASGDARYERLVADWR |
| Ga0187776_114864702 | 3300017966 | Tropical Peatland | MLLVLDVGNTNTVLGVFARVTKVGSSKAHGAGETGRYELL |
| Ga0187776_116054931 | 3300017966 | Tropical Peatland | MLLVLDVGNTNTVLGVFARDAKAKPGEDTPGEEHYERLV |
| Ga0187783_111894301 | 3300017970 | Tropical Peatland | MLLVLDVGNTNTVLGVFSGAEHTDAGGDATSYERLLA |
| Ga0187781_103942001 | 3300017972 | Tropical Peatland | MLLVVDVGNTNTVLGVFARVAKVQTSGDLDAPPHYERLVAHWRVATSR |
| Ga0187816_103940832 | 3300017995 | Freshwater Sediment | MLLVLDVGNTNTVLGVFARGTKADGGLTKLASAPEPYGLLVANWRVATSAT |
| Ga0187868_10838132 | 3300018002 | Peatland | MLFVLDVGNTNTVLGVFARVAKVHPDGDADDPPRYERLVAN |
| Ga0187876_12350852 | 3300018003 | Peatland | MLLVIDVGNTNTVLGVFAQVEHRPGEDVTGTEAVRYERLVANW |
| Ga0187805_101508552 | 3300018007 | Freshwater Sediment | MLLVIDVGNTNTVLGVFARVAKVHAGGDSEEPPRYERLVANWRVAT |
| Ga0187874_102981312 | 3300018019 | Peatland | MLLVIDVGNTNTVLGVFAQVEHRPGEDVTGTEAVRYERLVANWRVGS |
| Ga0187861_104142082 | 3300018020 | Peatland | MLLVIDVGNTHTVLGVFEQVAHRPGEDVTGTEAARYDRLVANWRVGSHLTRTV |
| Ga0187889_105101412 | 3300018023 | Peatland | MLFVLDVGNTNTVLGVFARVAKVRPDGDDEVPRYERLLANWRV |
| Ga0187857_104054661 | 3300018026 | Peatland | MLLVIDVGNTNTVLGVFERVAHRPGEDVTTETARYERLVANWRVGSH |
| Ga0187869_101139372 | 3300018030 | Peatland | MLFVLDVGNTNTVLGVFARVAKVHPDGDADDPPRYERLVANW |
| Ga0187883_101082611 | 3300018037 | Peatland | MLFVIDVGNTNTVLGVFGRAAKIDPDGGADTPPRYERL |
| Ga0187855_105198932 | 3300018038 | Peatland | MLLVIDVGNTNTVLGIFERVPHRPGEDVTSEAPRYEHLV |
| Ga0187871_102543482 | 3300018042 | Peatland | MLLVIDVGNTNTVLGVFERVAHRPGEDVTGTEAARYERLVANWRVGSHLG |
| Ga0187871_107959071 | 3300018042 | Peatland | MLLVIDVGNTNTVLGVFAQVEHPPGEDVTGTEEVRYER |
| Ga0187887_108242552 | 3300018043 | Peatland | MLLVIDVGNTNTVLGVFARVAKVPATGDEDETPHDIPKYDRLVANWRVATSRTSTVD |
| Ga0187890_104314882 | 3300018044 | Peatland | MLLVIDVGNTNTVLGVFREAHRPGEDVTSEPARYEHLVANWRVGSHLARTV |
| Ga0187859_106117821 | 3300018047 | Peatland | MLLVIDVGNTNTVLGVFAPVEHRSGEDVTTEAARYER |
| Ga0187858_105992232 | 3300018057 | Peatland | MLLVIDVGNTNTVLGVFERVAHRPGEDVTTETARYERLVANWRVGSHLT |
| Ga0187784_102734291 | 3300018062 | Tropical Peatland | MLLVIDIGNTNTVLGVFEPAVDAHSGEDAGSEAVRYG |
| Ga0187772_101262323 | 3300018085 | Tropical Peatland | MLFVLDVGNTNTVLGVFAQIARPRSDGDAGEPPRYERLLAHWRVAT |
| Ga0187772_112915102 | 3300018085 | Tropical Peatland | MLLVLDVGNTNTVLGVFARVAKVHPGGDADETPCYERLLAH |
| Ga0187769_108820862 | 3300018086 | Tropical Peatland | MLLVLDVGNTNTVLGVFARVAKVHPGGDSDETPRYERLLANWRV |
| Ga0187769_108996361 | 3300018086 | Tropical Peatland | MLLVIDVGNTNTVLGVFAKVAKVPPGKPPAAQSSPHYELLVANWRVATI |
| Ga0187769_114563831 | 3300018086 | Tropical Peatland | MLLAIDVGNTNTVLGVFARVAHVHPGDDASSEPVRYERL |
| Ga0187771_103559452 | 3300018088 | Tropical Peatland | MLLVLDVGNTNTVLGVFARVAKVDPAKSGDREDGGRYELLVAN |
| Ga0187771_115398691 | 3300018088 | Tropical Peatland | MLLVIDVGNTNTVLGVFAKVAKLPPGKPPATQPTPQYELLVANW |
| Ga0187770_103415782 | 3300018090 | Tropical Peatland | MLFVLDVGNTNTVLGVFARVAKLHPDGEAEAAPRYE |
| Ga0187800_12223952 | 3300019278 | Peatland | MLFVLDVGNTNTVLGVFARVAKLHPDGEAEAAPRYERLLAHWRVA |
| Ga0182031_14092704 | 3300019787 | Bog | MLLVIDVGNTNTVLGVFERVAHRPGEDVTGTEAARYERLVANWRVGSHL |
| Ga0179594_103173682 | 3300020170 | Vadose Zone Soil | MLLVIDVGNTNTVLGVFARVANLQPGDRMAETPHYERLVA |
| Ga0179592_102734602 | 3300020199 | Vadose Zone Soil | MLLVMDVGNTNTVLGVFERVAHRPGEDVTTEAVRYEHLVANWRVGSH |
| Ga0210403_101098651 | 3300020580 | Soil | MLLVIDVGNTNTVLGVFERVPHRAGEDVTTETARYERLVA |
| Ga0210403_112843011 | 3300020580 | Soil | MLLVIDVGNTNTVLGVFARVAKLHPGDSSNDSPSYERRVAHW |
| Ga0210399_112869151 | 3300020581 | Soil | MLLVIDVGNTNTVLGVFARVAKVKTAGDSDETPRYERL |
| Ga0210401_100143845 | 3300020583 | Soil | MLFVLDVGNTNTVLGVFAGAAHPHPEKDRDDAPRYDHLVANWRVAT |
| Ga0210401_116377791 | 3300020583 | Soil | MLLVLDVGNTNTVLGVFAKGERVASGANRSSEVDSPRYESLVANWRVAT |
| Ga0210406_113231062 | 3300021168 | Soil | MLLVIDVGNTNTVLGVFERVAHRPGEDVTTDPARYERLVANWRVGSHL |
| Ga0210400_106975172 | 3300021170 | Soil | MLLVIDVGNTNTVLGVFAGVAKVNTAGDSDETPRYERLVAN |
| Ga0210405_102206451 | 3300021171 | Soil | MLLVLDVGNTNTVLGVFAKAKVAPASSRSAEPESS |
| Ga0210405_112553091 | 3300021171 | Soil | MLLVLDVGNTNTVLGVFAKAAKAAPAASRAVESGSSPYELLVANWRVAT |
| Ga0210405_113000452 | 3300021171 | Soil | MLFVLDVGNTNTVLGVFARVAKVHPVEDDEAAPSY |
| Ga0210408_101800034 | 3300021178 | Soil | MLLVLDVGNTNTVLGVFARVAKADAGGDHDESGHYEQLLANW |
| Ga0210408_106551142 | 3300021178 | Soil | MLLVLDVGNTNTVLGVFAKAAKTAPGANRSGEAVSARYESLV |
| Ga0210396_103880701 | 3300021180 | Soil | MLLVIDVGNTNTVLGVFARVAKVHADATSETPGYERLVAQWRVA |
| Ga0210396_113565812 | 3300021180 | Soil | MLLVIDVGNTNTVLGVFAAVPNERAGDDLTAEPARYERLVANWRV |
| Ga0210388_103726262 | 3300021181 | Soil | MLLVIDVGNTNTVLGVFAPVAKVNLAGDSDETPRYERLVANW |
| Ga0210393_106092312 | 3300021401 | Soil | MLLVIDVGNTNTVLGVFAKVAKVAPGKSVPPASAHSRYELLV |
| Ga0210393_113528551 | 3300021401 | Soil | MLFVLDVGNTNTVLGVFARVEKPHPDGGGDDSPRYDRLVANWRVATRQG |
| Ga0210387_101173393 | 3300021405 | Soil | MLLVLDVGNTNTVLGVFARPAKGDAGGSRDDGSGYERLLANWRV |
| Ga0210384_101860373 | 3300021432 | Soil | MLFVLDVGNTNTVLGVFARAPGVPPDQDSDTARHYDHLVANWRVA |
| Ga0210391_102791472 | 3300021433 | Soil | MLLVIDVGNTNTVLGVFARVAKVQAGGEADDPPRYEK |
| Ga0210398_100691311 | 3300021477 | Soil | MLLVLDVGNTNTVLGVFARPAKGDAGGGRDDGSGYERLLA |
| Ga0210398_110079012 | 3300021477 | Soil | MLLVLDVGNTNTVLGVFAHAEKPSPNEGDGELLHHERLLAHWRVATRQGST |
| Ga0210410_114023191 | 3300021479 | Soil | MLLVIDVGNTNTVLGVFARGAKVHPGGDADEPPRY |
| Ga0210410_115330671 | 3300021479 | Soil | MLLVLDVGNTNTVLGVFAKAARAASRAVESGSSHYELLVA |
| Ga0210409_106986821 | 3300021559 | Soil | MLLVLDVGNTNTVLGVFAKAARAASRAVESGSSHY |
| Ga0210409_114864491 | 3300021559 | Soil | MLFVIDVGNSNTVLGVFARGAKPHSDGDADARTRD |
| Ga0126371_107513071 | 3300021560 | Tropical Forest Soil | MLLVIDVGNTNTVLGVFARAARAHSGDPDDQPRYE |
| Ga0213853_113490261 | 3300021861 | Watersheds | MLLVIDVGNTNTVLGVFARVVHVHPGDDASAPEPVRYERLVANWRVGSHL |
| Ga0224546_10328681 | 3300022515 | Soil | MLLVIDVGNTNTVLGVFERVAHRQGDDVTIDPARYERLVANWRVGSHLTRT |
| Ga0224541_10025451 | 3300022521 | Soil | MLFVLDVGNTNTVLGVFAHAEKPRPNEVDGEPLHYERLLAHWRVA |
| Ga0242657_10494342 | 3300022722 | Soil | MLLVIDVGNTNTVLGVFARAGEGHAPGSANDIQRYERLVANWRVAT |
| Ga0224558_11692412 | 3300023090 | Soil | MLLVIDVGNTHTVLGVFEQVAHRPGEDVTGTEAARYDRLVANWRVGSHLTRT |
| Ga0224557_12207811 | 3300023101 | Soil | MLLVLDVGNTNTVLGVFAKVAKVAAAASRSDQSTSPHYELL |
| Ga0247679_10432301 | 3300024251 | Soil | MLLTMLLVIDVGNTNTVLGVYAREVKAAASDDEDSGQYTRLLANWRVATSRTS |
| Ga0224556_11786391 | 3300024295 | Soil | MLFVLDVGNTNTVLGVFARVAKVRPDGDDEVPRYERLLANWRVATRQGSTV |
| Ga0208194_10025854 | 3300025412 | Peatland | MLLVIDVGNTNTVLGVFERVAHRPGEDVTGTEAARYERLVANWRVGS |
| Ga0208039_10351251 | 3300025454 | Peatland | MLLVIDVGNTHTVLGVFEEVAHRPGEDVTGTEAARYQR |
| Ga0208850_10746552 | 3300025457 | Arctic Peat Soil | MLLVIDIGNTNTVLGVFAPVAHRPGEDVTTEAARYGRLV |
| Ga0208714_10053474 | 3300025527 | Arctic Peat Soil | MLLVIDVGNTNTVLGVFERVPHRPGEDVTTEAARYERL |
| Ga0207693_100519514 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLTMLLVIDVGNTNTVLGVYAREVKAAASDDACASR |
| Ga0207693_110641861 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLVIDVGNTNTVLGVFAGVEKGHSGEEPRNGAHYQRLVAQWRVAT |
| Ga0207646_102940091 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLVIDVGNTNTVLGVFARVAHVHPGEDPSSEPVRYERLVANWRVGSHLT |
| Ga0207646_116679021 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTMLLVLDVGNTNTVLGVFAQAAEAGGTTGESLRYE |
| Ga0207700_110206862 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLVIDVGNTNTVLGVYARVAKVQAGDDSEESDQYKRLLA |
| Ga0257180_10623932 | 3300026354 | Soil | MLLVIDVGNTNTVLGVFERVAHRPGDDVTTETARYERLVANWRV |
| Ga0257181_10228171 | 3300026499 | Soil | MLLVIDVGNTNTVLGVFERVAHRPGDDVTTETARYERL |
| Ga0209160_13372782 | 3300026532 | Soil | MLLVIDVGNTNTVLGVFARVATVQPGGDAEDPPRYEHLVANWRVATS |
| Ga0209577_102825041 | 3300026552 | Soil | MLLVLDVGNTNTVLGVFARVAKVNPAEAVSSPEAIRY |
| Ga0179587_100820851 | 3300026557 | Vadose Zone Soil | MLLVMDVGNTNTVLGVFERVAHRPGEDVTTEAVRYEHLVANWRVGSHL |
| Ga0209734_10273731 | 3300027535 | Forest Soil | MLLVIDVGNTNTVLGVFERVAHRAGEDVTTDPARYERLVANW |
| Ga0209419_10509332 | 3300027537 | Forest Soil | MLLVIDVGNTNTVLGVFERVAHRPGEDVTTETARYE |
| Ga0209733_10449571 | 3300027591 | Forest Soil | MLLVIDVGNTNTVLGVFERVAHRAGEDVTTDPARYERLVANWRVGSHLNR |
| Ga0208044_11652271 | 3300027625 | Peatlands Soil | MLLVIDVGNTNTVLGVFARVAKVHPAGDSDETPRYERLVANW |
| Ga0209422_11279971 | 3300027629 | Forest Soil | MKRFTPMLLVIDVGNTNTVLGVFAPIEHGPGEDVTAESERYERLA |
| Ga0208827_10319563 | 3300027641 | Peatlands Soil | MLLVIDVGNTNTVLGVFARVAKVHPGGGSEDPTRYERLMANWRVATSQTGT |
| Ga0208827_11271941 | 3300027641 | Peatlands Soil | MLLVIDVGNTNTVLGVFARVAKVNTAGDSDETPRYERLVANWRV |
| Ga0209420_10820741 | 3300027648 | Forest Soil | MLLVIDVGNTNTVLGVFERVPHRAGEDLTTDPPRYERLV |
| Ga0209333_11982562 | 3300027676 | Forest Soil | MLLVIDVGNTNTVLGVFERVAHRQGDDVTTDPDRYERLVANWRVGSH |
| Ga0209626_10695512 | 3300027684 | Forest Soil | MLLTIDVGNTNTVLGVYARVEHRPGDDVTTETERYERLAANWRVG |
| Ga0209446_10716052 | 3300027698 | Bog Forest Soil | MLLVLDVGNTNTVLGVFAKVAKVTPGANRSTGAASPHYELLAANWRV |
| Ga0209655_100308011 | 3300027767 | Bog Forest Soil | MLFVLDVGNTNTVLGVFARAEKPHPGGDANDAPRYERLVANWRVATRQ |
| Ga0209040_102666842 | 3300027824 | Bog Forest Soil | MLFVLDVGNTNTVLGVFDCVAKAHPAGDADDSPRYE |
| Ga0209040_105353141 | 3300027824 | Bog Forest Soil | MLLVIDVGNTNTVLGVFARVAKVHPGGDLDDPPRYERLVANWRVATSR |
| Ga0209274_101102471 | 3300027853 | Soil | MLLVLDVGNTNTVLGVFARPAKGDAGGGRDDVSGYERLLANWRV |
| Ga0209517_101860772 | 3300027854 | Peatlands Soil | MLLVIDVGNTHTVLGVFEQVAHRPGEDVTGTEAARYDRLVANW |
| Ga0209517_104436802 | 3300027854 | Peatlands Soil | MLLVIDVGNTNTVLGVFARVAKVHPAGDADETPRYERLVA |
| Ga0209517_107365062 | 3300027854 | Peatlands Soil | MLLVIDVGNTNTVLGVFARVAKVNTAGDSDETPRYERLVANWRVATSRTST |
| Ga0209693_100682274 | 3300027855 | Soil | MLLVIDVGNTNTVLGVFARAEARPAGDHDETPRYERLVA |
| Ga0209275_100107694 | 3300027884 | Soil | MLLVLDVGNTNTVLGVFARASKANPGSDPDDGPGYDRL |
| Ga0209380_106632861 | 3300027889 | Soil | MLLVIDVGNTNTVLGVFARVDKAQPGADADDPPRYERLV |
| Ga0209067_107579222 | 3300027898 | Watersheds | MLLVIDVGNTNTVLGVFARVAKVHPGGDTDEEPRYERLLA |
| Ga0209488_111226271 | 3300027903 | Vadose Zone Soil | MLLVLDVGNTNTVLGVFARAAQSADEPPRYEQLVAQLNKLFPQT |
| Ga0137415_103915982 | 3300028536 | Vadose Zone Soil | MLLVLDVGNTNTVLGVFAPGAKANPGSQPDDETPGYGRLVANWR |
| Ga0137415_104608092 | 3300028536 | Vadose Zone Soil | MLLVIDVGNTNTVLGVFERVAHRAGEDVTTETARY |
| Ga0302144_102546781 | 3300028560 | Bog | MLFVLDVGNTNTVLGVFGQDVKPLPGAEAGEVPRYERLVANWRVAT |
| Ga0302224_102535821 | 3300028759 | Palsa | MLFVLDVGNTNTVLGVFARVAKVLPDGDAGAAARYERL |
| Ga0302209_100836162 | 3300028772 | Fen | MLLVIDVGNTNTVLGVFARVAHVVTGESPEAESARYELLVAN |
| Ga0302303_100765372 | 3300028776 | Palsa | MLSLSSADDMLFVLDVGNTNTVLGVFAHAEKPRPNEVDGEPLHYERLLAHW |
| Ga0302201_102600691 | 3300028785 | Bog | MLFVLDVGNTNTVLGVFARVAKVRPEGDASFDDDAPRYERLLAN |
| Ga0265338_109320622 | 3300028800 | Rhizosphere | MLLVIDVGNTNTVLGVFARVAKVQPGGDAEDPPRYERLLANWRVATSRTS |
| Ga0302155_104493282 | 3300028874 | Bog | MLFVLDVGNTNTVLGVFARVAKVRPEGDASFDDDAPRYERLLANWRVATRQGSTVDE |
| Ga0308309_103545422 | 3300028906 | Soil | MLIPECWLLRQDDMLLVLDVGNTNTVLGVFARASKANPGSDPDDGPGYDRLLANWRVATV |
| Ga0222749_106274501 | 3300029636 | Soil | MLFVLDVGNTNTVLGVFARAEKSPPGEVPRYERLVANWRVA |
| Ga0247271_1003742 | 3300029903 | Soil | MLLVIDVGNTNTVLGVFARVAKVPATGDEDETPHDIPKYDRLVANWRVATSRTSTVDXXX |
| Ga0247271_1168111 | 3300029903 | Soil | MLFVIDVGNTNTVLGVFGRAAKIDPDGGADTPPRYERLVANWRVATRQG |
| Ga0311358_111727121 | 3300029915 | Bog | MLFVLDVGNTNTVLGVFARVAKVRPEGDASFDDDAPRYERL |
| Ga0311326_104435592 | 3300029917 | Bog | MLFVLDVGNTNTVLGVFAHAEKSRPNEVGGEPLHYERLLAHWRVAT |
| Ga0311330_108770012 | 3300029945 | Bog | MLLVMDVGNTNTVLGVFERVPNRSGDDVTSEVARYEKLV |
| Ga0302277_11759452 | 3300029982 | Bog | MLLVMDVGNTNTVLGVFERVAHRPGEDVTSEGVRYER |
| Ga0302277_13619792 | 3300029982 | Bog | MLFVLDVGNTNTVLGVFAHAEKSRPNEVGGEPLHYERLL |
| Ga0302304_102761072 | 3300029993 | Palsa | MLLVIDVGNTNTVLGVFERVAHRQGDDVTTDPDRYERLVAN |
| Ga0311350_114558241 | 3300030002 | Fen | MLLVLDVGNTNTVLGVFAKVAKVHAGEGAADTAPPRYELLVANWRVATVQTQTV |
| Ga0311344_104873022 | 3300030020 | Bog | MLFVLDVGNTNTVLGVFARVAKVRPEGDASFDDDAPRYERLLANWRVATRQGST |
| Ga0302274_102136592 | 3300030041 | Bog | MLLVLDVGNTNTVLGVFAPVAKVHVASTHPEAETDPPRYERLVANWRVATRQGSTV |
| Ga0302176_100419923 | 3300030057 | Palsa | MLFVLDVGNTNTVLGVFACAEKPHPDPDDKAPYYEHL |
| Ga0302176_103460601 | 3300030057 | Palsa | MLLVLDVGNTNTVLGVFARVAKESPGGDPGDGPRYE |
| Ga0302179_100472901 | 3300030058 | Palsa | MLLVIDVGNTNTVLGVFERVAHRQGEDVTIDPARYER |
| Ga0311349_117192041 | 3300030294 | Fen | MLLVIDVGNTNTVLGVFERVAHRPGEDVTTEAVRYERLAANWRVGSH |
| Ga0311354_105078592 | 3300030618 | Palsa | MLLVLDVGNTNTVLGVFDRVVKVHPDGDAKVDEAPRY |
| Ga0265763_10565941 | 3300030763 | Soil | MLFVLDVGNTNTVLGVFARVAKTQPDEGLSAHDGPRYERLVANWRVAT |
| Ga0265741_1081352 | 3300030814 | Soil | MLLVLDVGNTNTVLGVFARAAKANPGGDPDERPHYER |
| Ga0265765_10268081 | 3300030879 | Soil | MLFVLDVGNTNTVLGVFARAPSVPPDQDSDTAPHYDH |
| Ga0265760_103261691 | 3300031090 | Soil | MLLVLDVGNTNTVLGVFAKVARSAGAAHGVESAPPRYELLVANW |
| Ga0302325_109098282 | 3300031234 | Palsa | MLLVIDVGNTNTVLGVFERAAHRPGEDVTTEPARYERLVANWRV |
| Ga0302324_1031186762 | 3300031236 | Palsa | MLLVIDVGNTNTVLGVFAPVVHRPGEDVTTEATRYERLVAN |
| Ga0302297_10639592 | 3300031244 | Fen | MLLVIDIGNTNTVLGVFERVAHRPGEDVTAEAPRYEKLVANWRVGSHLGRTVD |
| Ga0310686_1020125292 | 3300031708 | Soil | MLLVVDVGNTNTVLGVFARAGDRNAEDAPRYERLVAN |
| Ga0310686_1066472171 | 3300031708 | Soil | MLLVLDVGNSNTVLGVFAKAKVAPASSRSAEPESSHYEVLVANWRVA |
| Ga0310686_1083978505 | 3300031708 | Soil | MLLVIDVGNTNTVLGVFARAEAHPAGDHDGTPRYEQLV |
| Ga0310686_1085216792 | 3300031708 | Soil | MLLVLDVGNTNTVLGVFAKAKVAPASSRSAEPEFSHYE |
| Ga0307476_100825591 | 3300031715 | Hardwood Forest Soil | MLFVLDVGNTNTVLGVFARAETPHPGGDADSAPRYERLV |
| Ga0306917_111734031 | 3300031719 | Soil | MLLVIDVGNTNTVLGVFARVAKVHPGGDADDEPRYERLLANWRVATSRTST |
| Ga0307468_1020994512 | 3300031740 | Hardwood Forest Soil | MLFVIDVGNTNTVLGVFARVAKASAAGEQDEPPHYERLVANWRV |
| Ga0307477_105889422 | 3300031753 | Hardwood Forest Soil | MLFVLDVGNTNTVLGVFARVANVRPGEEAGDDHRYERLLANWRVATSR |
| Ga0307475_112293651 | 3300031754 | Hardwood Forest Soil | MLFVLDVGNTNTVLGVFARDANLAAGAGGDEPPRYERLAAHWRVETRQGSTVD |
| Ga0307475_114941952 | 3300031754 | Hardwood Forest Soil | MLLVIDVGNTNTVLGVFARVAKVQPGGDAEDPPRYERLVANWRVATSRTS |
| Ga0307473_105559631 | 3300031820 | Hardwood Forest Soil | MLLVIDVGNTNTVLGVFARVAKVHASDDVTAPARY |
| Ga0307478_102001413 | 3300031823 | Hardwood Forest Soil | MLLVIDVGNTNTVLGVFARAAVARPVDETPRYERLV |
| Ga0307478_102349472 | 3300031823 | Hardwood Forest Soil | MLLVIDVGNTNTVLGVFARVAKVNPAGDSDETPRYERLVANW |
| Ga0310916_106731152 | 3300031942 | Soil | MLLVIDVGNTNTVLGVFARVEKVPPRTDADEQRYERLLANWRVAT |
| Ga0318524_100567341 | 3300032067 | Soil | MLLVIDVGNTNTVLGVFARVAKVHPGDASNDSARYER |
| Ga0335082_107819982 | 3300032782 | Soil | MLLVLDVGNTNTVLGVFARVAKVHGGEATAAEAPHYELLVANWRVGTD |
| Ga0335079_104159572 | 3300032783 | Soil | MLLVLDVGNTNTVLGVFARTAKASSSEAAQQANATPNYDLLVA |
| Ga0335078_102073874 | 3300032805 | Soil | MLLVLDVGNTNTVLGVFARVAKVQAGAASSETPRYGRLLAHW |
| Ga0335078_112065841 | 3300032805 | Soil | MLLVIDVGNTNTVLGVFARVAKVHPGGDADEECYERLLANWRVATS |
| Ga0335080_116627441 | 3300032828 | Soil | MLLVIDVGNTNTVLGVFARVAKVHPGGDADEECYERLLANWRVATSRTST |
| Ga0335069_109133582 | 3300032893 | Soil | MLLVIDVGNTNTVLGVYAREAKVPAGDHEDPHQFKRLLANWRVAT |
| Ga0335083_102816303 | 3300032954 | Soil | MLLVLDVGNTNTVLGVFARVNKIASAKAQASNGAGRYEILAANWRVATIATQ |
| Ga0335077_100086669 | 3300033158 | Soil | MLLVLDVGNTNTVLGVFARVAKLHPGEGEGGDEAPRYGL |
| Ga0335077_108896151 | 3300033158 | Soil | MLLVLDVGNTNTVLGVFARVAKVPAAAGNAAEETPSYELLVANWRV |
| Ga0316212_10214711 | 3300033547 | Roots | MLLVIDVGNTNTVLGVFERVAHRPGEDVTTDPARYE |
| Ga0334837_074093_2_127 | 3300033823 | Soil | MLLVIDVGNTNTVLGIFAQVAHRPGEDVTGTEAARYERLVAN |
| ⦗Top⦘ |