| Basic Information | |
|---|---|
| Family ID | F012291 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 282 |
| Average Sequence Length | 41 residues |
| Representative Sequence | NLIYRKEQMLAPRPAHMGANAVFNQADVDGGAPAEMVPGS |
| Number of Associated Samples | 221 |
| Number of Associated Scaffolds | 282 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.71 % |
| % of genes near scaffold ends (potentially truncated) | 98.94 % |
| % of genes from short scaffolds (< 2000 bps) | 88.30 % |
| Associated GOLD sequencing projects | 204 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (59.220 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (12.766 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.922 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.24% β-sheet: 0.00% Coil/Unstructured: 86.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 282 Family Scaffolds |
|---|---|---|
| PF02574 | S-methyl_trans | 68.09 |
| PF02965 | Met_synt_B12 | 2.84 |
| PF02607 | B12-binding_2 | 1.77 |
| PF00180 | Iso_dh | 1.42 |
| PF03477 | ATP-cone | 1.42 |
| PF01070 | FMN_dh | 1.06 |
| PF00593 | TonB_dep_Rec | 0.71 |
| PF13522 | GATase_6 | 0.35 |
| PF02577 | BFN_dom | 0.35 |
| PF01715 | IPPT | 0.35 |
| PF13631 | Cytochrom_B_N_2 | 0.35 |
| PF01551 | Peptidase_M23 | 0.35 |
| PF14748 | P5CR_dimer | 0.35 |
| PF00809 | Pterin_bind | 0.35 |
| PF00037 | Fer4 | 0.35 |
| PF00691 | OmpA | 0.35 |
| PF01613 | Flavin_Reduct | 0.35 |
| PF01625 | PMSR | 0.35 |
| PF00160 | Pro_isomerase | 0.35 |
| PF00563 | EAL | 0.35 |
| PF01850 | PIN | 0.35 |
| PF08450 | SGL | 0.35 |
| PF02954 | HTH_8 | 0.35 |
| PF01494 | FAD_binding_3 | 0.35 |
| PF05050 | Methyltransf_21 | 0.35 |
| PF01040 | UbiA | 0.35 |
| PF08281 | Sigma70_r4_2 | 0.35 |
| PF00583 | Acetyltransf_1 | 0.35 |
| PF09957 | VapB_antitoxin | 0.35 |
| COG ID | Name | Functional Category | % Frequency in 282 Family Scaffolds |
|---|---|---|---|
| COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 68.09 |
| COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 68.09 |
| COG1410 | Methionine synthase I, cobalamin-binding domain | Amino acid transport and metabolism [E] | 2.84 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 1.06 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 1.06 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.71 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.35 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.35 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.35 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.35 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.35 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.35 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.35 |
| COG1259 | Bifunctional DNase/RNase | General function prediction only [R] | 0.35 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.35 |
| COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 0.35 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.35 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.35 |
| COG0324 | tRNA A37 N6-isopentenylltransferase MiaA | Translation, ribosomal structure and biogenesis [J] | 0.35 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.35 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 59.22 % |
| All Organisms | root | All Organisms | 40.78 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps_contig33840.21578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1222 | Open in IMG/M |
| 3300000567|JGI12270J11330_10083419 | Not Available | 1493 | Open in IMG/M |
| 3300000789|JGI1027J11758_12332316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300000955|JGI1027J12803_100261411 | Not Available | 632 | Open in IMG/M |
| 3300000955|JGI1027J12803_100277393 | Not Available | 1830 | Open in IMG/M |
| 3300001593|JGI12635J15846_10039517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3687 | Open in IMG/M |
| 3300001989|JGI24739J22299_10053133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1301 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101109714 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101161391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 660 | Open in IMG/M |
| 3300002557|JGI25381J37097_1073102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 557 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10327907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 623 | Open in IMG/M |
| 3300004091|Ga0062387_101148271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 605 | Open in IMG/M |
| 3300004114|Ga0062593_100525659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1105 | Open in IMG/M |
| 3300004152|Ga0062386_100397049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1110 | Open in IMG/M |
| 3300004153|Ga0063455_100340267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 849 | Open in IMG/M |
| 3300005329|Ga0070683_101188768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 733 | Open in IMG/M |
| 3300005435|Ga0070714_101171118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 750 | Open in IMG/M |
| 3300005435|Ga0070714_101774481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 602 | Open in IMG/M |
| 3300005439|Ga0070711_100555529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 953 | Open in IMG/M |
| 3300005454|Ga0066687_10468919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 740 | Open in IMG/M |
| 3300005458|Ga0070681_10361498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1362 | Open in IMG/M |
| 3300005468|Ga0070707_100814628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 898 | Open in IMG/M |
| 3300005532|Ga0070739_10549546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 515 | Open in IMG/M |
| 3300005534|Ga0070735_10615809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 644 | Open in IMG/M |
| 3300005538|Ga0070731_10108983 | Not Available | 1834 | Open in IMG/M |
| 3300005538|Ga0070731_10186150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1379 | Open in IMG/M |
| 3300005541|Ga0070733_10119681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1692 | Open in IMG/M |
| 3300005541|Ga0070733_11147627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 521 | Open in IMG/M |
| 3300005542|Ga0070732_10344509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 897 | Open in IMG/M |
| 3300005542|Ga0070732_10523079 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300005545|Ga0070695_101786349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 516 | Open in IMG/M |
| 3300005575|Ga0066702_10169061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1306 | Open in IMG/M |
| 3300005591|Ga0070761_10120690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1521 | Open in IMG/M |
| 3300005602|Ga0070762_10037883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2613 | Open in IMG/M |
| 3300005602|Ga0070762_10821070 | Not Available | 630 | Open in IMG/M |
| 3300005764|Ga0066903_101008301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1523 | Open in IMG/M |
| 3300005764|Ga0066903_106568228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300005921|Ga0070766_10693897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
| 3300006028|Ga0070717_11569341 | Not Available | 597 | Open in IMG/M |
| 3300006028|Ga0070717_11578117 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300006052|Ga0075029_100715273 | Not Available | 676 | Open in IMG/M |
| 3300006052|Ga0075029_100742261 | Not Available | 665 | Open in IMG/M |
| 3300006102|Ga0075015_100190331 | Not Available | 1088 | Open in IMG/M |
| 3300006162|Ga0075030_100867590 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300006163|Ga0070715_10809015 | Not Available | 569 | Open in IMG/M |
| 3300006173|Ga0070716_101066306 | Not Available | 643 | Open in IMG/M |
| 3300006175|Ga0070712_101529005 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300006176|Ga0070765_100236044 | Not Available | 1672 | Open in IMG/M |
| 3300006640|Ga0075527_10187750 | Not Available | 592 | Open in IMG/M |
| 3300006755|Ga0079222_12175870 | Not Available | 551 | Open in IMG/M |
| 3300006796|Ga0066665_10495200 | Not Available | 1002 | Open in IMG/M |
| 3300006800|Ga0066660_10375639 | Not Available | 1164 | Open in IMG/M |
| 3300006806|Ga0079220_11720532 | Not Available | 549 | Open in IMG/M |
| 3300006871|Ga0075434_100601989 | Not Available | 1118 | Open in IMG/M |
| 3300006893|Ga0073928_10022833 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 6334 | Open in IMG/M |
| 3300007788|Ga0099795_10235346 | Not Available | 784 | Open in IMG/M |
| 3300009088|Ga0099830_10612622 | Not Available | 893 | Open in IMG/M |
| 3300009088|Ga0099830_11591203 | Not Available | 544 | Open in IMG/M |
| 3300009088|Ga0099830_11790821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300009089|Ga0099828_10806922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 840 | Open in IMG/M |
| 3300009090|Ga0099827_11955454 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300009101|Ga0105247_10490134 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300009137|Ga0066709_100334308 | Not Available | 2074 | Open in IMG/M |
| 3300009143|Ga0099792_11093260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300009174|Ga0105241_12569937 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300009520|Ga0116214_1059327 | Not Available | 1391 | Open in IMG/M |
| 3300009551|Ga0105238_12489925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300009623|Ga0116133_1041128 | Not Available | 1144 | Open in IMG/M |
| 3300009624|Ga0116105_1046563 | Not Available | 985 | Open in IMG/M |
| 3300009638|Ga0116113_1088806 | Not Available | 739 | Open in IMG/M |
| 3300009639|Ga0116122_1290753 | Not Available | 502 | Open in IMG/M |
| 3300009665|Ga0116135_1149483 | Not Available | 872 | Open in IMG/M |
| 3300009683|Ga0116224_10235142 | Not Available | 875 | Open in IMG/M |
| 3300009824|Ga0116219_10234646 | Not Available | 1044 | Open in IMG/M |
| 3300009826|Ga0123355_10001764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 30272 | Open in IMG/M |
| 3300010043|Ga0126380_12088988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300010043|Ga0126380_12226968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300010048|Ga0126373_12990207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300010303|Ga0134082_10352089 | Not Available | 624 | Open in IMG/M |
| 3300010339|Ga0074046_10049057 | Not Available | 2810 | Open in IMG/M |
| 3300010358|Ga0126370_10538424 | Not Available | 995 | Open in IMG/M |
| 3300010358|Ga0126370_11382677 | Not Available | 664 | Open in IMG/M |
| 3300010358|Ga0126370_11385385 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300010359|Ga0126376_10096612 | Not Available | 2241 | Open in IMG/M |
| 3300010360|Ga0126372_10158087 | Not Available | 1823 | Open in IMG/M |
| 3300010361|Ga0126378_10376716 | Not Available | 1530 | Open in IMG/M |
| 3300010361|Ga0126378_11101508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 895 | Open in IMG/M |
| 3300010373|Ga0134128_10115211 | All Organisms → cellular organisms → Bacteria | 3050 | Open in IMG/M |
| 3300010396|Ga0134126_13020838 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300010400|Ga0134122_10867027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 870 | Open in IMG/M |
| 3300011120|Ga0150983_12195167 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
| 3300011120|Ga0150983_15599275 | Not Available | 639 | Open in IMG/M |
| 3300011269|Ga0137392_10789664 | Not Available | 784 | Open in IMG/M |
| 3300011271|Ga0137393_11022477 | Not Available | 703 | Open in IMG/M |
| 3300012189|Ga0137388_11667782 | Not Available | 572 | Open in IMG/M |
| 3300012199|Ga0137383_10712976 | Not Available | 733 | Open in IMG/M |
| 3300012205|Ga0137362_10676317 | Not Available | 888 | Open in IMG/M |
| 3300012205|Ga0137362_11409318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300012206|Ga0137380_11619967 | Not Available | 532 | Open in IMG/M |
| 3300012207|Ga0137381_11206929 | Not Available | 650 | Open in IMG/M |
| 3300012208|Ga0137376_11699862 | Not Available | 522 | Open in IMG/M |
| 3300012210|Ga0137378_10195548 | Not Available | 1882 | Open in IMG/M |
| 3300012210|Ga0137378_10647699 | Not Available | 967 | Open in IMG/M |
| 3300012285|Ga0137370_10474792 | Not Available | 764 | Open in IMG/M |
| 3300012353|Ga0137367_10361147 | Not Available | 1033 | Open in IMG/M |
| 3300012359|Ga0137385_10712568 | Not Available | 838 | Open in IMG/M |
| 3300012359|Ga0137385_10866703 | Not Available | 748 | Open in IMG/M |
| 3300012362|Ga0137361_11290767 | Not Available | 654 | Open in IMG/M |
| 3300012362|Ga0137361_11623917 | Not Available | 567 | Open in IMG/M |
| 3300012683|Ga0137398_10481025 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300012923|Ga0137359_11059519 | Not Available | 694 | Open in IMG/M |
| 3300012930|Ga0137407_10730699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 933 | Open in IMG/M |
| 3300012930|Ga0137407_10881769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 846 | Open in IMG/M |
| 3300012960|Ga0164301_11001257 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300012961|Ga0164302_10096692 | Not Available | 1620 | Open in IMG/M |
| 3300012971|Ga0126369_11913889 | Not Available | 681 | Open in IMG/M |
| 3300013307|Ga0157372_12911202 | Not Available | 548 | Open in IMG/M |
| 3300014165|Ga0181523_10002946 | All Organisms → cellular organisms → Bacteria | 15910 | Open in IMG/M |
| 3300014169|Ga0181531_10717651 | Not Available | 622 | Open in IMG/M |
| 3300014201|Ga0181537_10743501 | Not Available | 666 | Open in IMG/M |
| 3300014201|Ga0181537_10765541 | Not Available | 655 | Open in IMG/M |
| 3300014501|Ga0182024_12007972 | Not Available | 639 | Open in IMG/M |
| 3300014969|Ga0157376_11875239 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300015241|Ga0137418_10753409 | Not Available | 738 | Open in IMG/M |
| 3300015241|Ga0137418_10866162 | Not Available | 668 | Open in IMG/M |
| 3300015245|Ga0137409_10295640 | Not Available | 1425 | Open in IMG/M |
| 3300015372|Ga0132256_102541915 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300016404|Ga0182037_10870171 | Not Available | 780 | Open in IMG/M |
| 3300017821|Ga0187812_1176033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 686 | Open in IMG/M |
| 3300017927|Ga0187824_10254209 | Not Available | 611 | Open in IMG/M |
| 3300017927|Ga0187824_10283327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 583 | Open in IMG/M |
| 3300017934|Ga0187803_10447683 | Not Available | 527 | Open in IMG/M |
| 3300017935|Ga0187848_10235357 | Not Available | 777 | Open in IMG/M |
| 3300017939|Ga0187775_10092269 | Not Available | 1004 | Open in IMG/M |
| 3300017955|Ga0187817_10498999 | Not Available | 777 | Open in IMG/M |
| 3300017961|Ga0187778_10965366 | Not Available | 588 | Open in IMG/M |
| 3300017970|Ga0187783_10183361 | Not Available | 1540 | Open in IMG/M |
| 3300017970|Ga0187783_10505587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 876 | Open in IMG/M |
| 3300017972|Ga0187781_10290797 | Not Available | 1159 | Open in IMG/M |
| 3300017972|Ga0187781_10904036 | Not Available | 643 | Open in IMG/M |
| 3300017974|Ga0187777_10258258 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300017975|Ga0187782_11293834 | Not Available | 572 | Open in IMG/M |
| 3300017975|Ga0187782_11453202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300017995|Ga0187816_10086525 | Not Available | 1338 | Open in IMG/M |
| 3300018006|Ga0187804_10136223 | Not Available | 1028 | Open in IMG/M |
| 3300018018|Ga0187886_1358865 | Not Available | 537 | Open in IMG/M |
| 3300018035|Ga0187875_10056586 | Not Available | 2278 | Open in IMG/M |
| 3300018042|Ga0187871_10245268 | Not Available | 995 | Open in IMG/M |
| 3300018047|Ga0187859_10889585 | Not Available | 513 | Open in IMG/M |
| 3300018062|Ga0187784_10237433 | Not Available | 1484 | Open in IMG/M |
| 3300018062|Ga0187784_10908982 | Not Available | 701 | Open in IMG/M |
| 3300018062|Ga0187784_10942916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
| 3300018062|Ga0187784_11374226 | Not Available | 560 | Open in IMG/M |
| 3300018085|Ga0187772_10069196 | All Organisms → cellular organisms → Bacteria | 2214 | Open in IMG/M |
| 3300018085|Ga0187772_10082433 | Not Available | 2041 | Open in IMG/M |
| 3300018085|Ga0187772_11110589 | Not Available | 580 | Open in IMG/M |
| 3300018085|Ga0187772_11297474 | Not Available | 538 | Open in IMG/M |
| 3300018085|Ga0187772_11471475 | Not Available | 506 | Open in IMG/M |
| 3300018086|Ga0187769_11147431 | Not Available | 588 | Open in IMG/M |
| 3300018088|Ga0187771_10889350 | Not Available | 755 | Open in IMG/M |
| 3300018088|Ga0187771_11017309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 703 | Open in IMG/M |
| 3300018089|Ga0187774_10224875 | Not Available | 1045 | Open in IMG/M |
| 3300018090|Ga0187770_10227759 | Not Available | 1440 | Open in IMG/M |
| 3300018090|Ga0187770_11093042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300018431|Ga0066655_10359560 | Not Available | 957 | Open in IMG/M |
| 3300018468|Ga0066662_10116155 | Not Available | 1940 | Open in IMG/M |
| 3300019275|Ga0187798_1876619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 626 | Open in IMG/M |
| 3300019881|Ga0193707_1119105 | Not Available | 771 | Open in IMG/M |
| 3300019887|Ga0193729_1263257 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300019999|Ga0193718_1052574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 885 | Open in IMG/M |
| 3300020199|Ga0179592_10240787 | Not Available | 814 | Open in IMG/M |
| 3300020580|Ga0210403_10565543 | Not Available | 920 | Open in IMG/M |
| 3300020583|Ga0210401_10157801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2119 | Open in IMG/M |
| 3300020583|Ga0210401_10194624 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1885 | Open in IMG/M |
| 3300020583|Ga0210401_10536456 | Not Available | 1032 | Open in IMG/M |
| 3300021088|Ga0210404_10144142 | Not Available | 1243 | Open in IMG/M |
| 3300021168|Ga0210406_10154479 | Not Available | 1925 | Open in IMG/M |
| 3300021171|Ga0210405_11127986 | Not Available | 585 | Open in IMG/M |
| 3300021178|Ga0210408_10259890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1383 | Open in IMG/M |
| 3300021180|Ga0210396_10905772 | Not Available | 751 | Open in IMG/M |
| 3300021181|Ga0210388_10476356 | Not Available | 1096 | Open in IMG/M |
| 3300021344|Ga0193719_10278462 | Not Available | 704 | Open in IMG/M |
| 3300021402|Ga0210385_10157024 | Not Available | 1631 | Open in IMG/M |
| 3300021405|Ga0210387_10212571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1682 | Open in IMG/M |
| 3300021420|Ga0210394_10132194 | Not Available | 2163 | Open in IMG/M |
| 3300021420|Ga0210394_11354995 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300021445|Ga0182009_10291140 | Not Available | 820 | Open in IMG/M |
| 3300021474|Ga0210390_10374156 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300021476|Ga0187846_10466483 | Not Available | 517 | Open in IMG/M |
| 3300021478|Ga0210402_10630784 | Not Available | 992 | Open in IMG/M |
| 3300021478|Ga0210402_11393670 | Not Available | 628 | Open in IMG/M |
| 3300021479|Ga0210410_11559659 | Not Available | 553 | Open in IMG/M |
| 3300021559|Ga0210409_10034760 | All Organisms → cellular organisms → Bacteria | 4815 | Open in IMG/M |
| 3300021559|Ga0210409_10087705 | Not Available | 2876 | Open in IMG/M |
| 3300021559|Ga0210409_10944377 | Not Available | 736 | Open in IMG/M |
| 3300021560|Ga0126371_10012413 | All Organisms → cellular organisms → Bacteria | 7722 | Open in IMG/M |
| 3300021560|Ga0126371_11092121 | Not Available | 937 | Open in IMG/M |
| 3300022724|Ga0242665_10015639 | Not Available | 1659 | Open in IMG/M |
| 3300024271|Ga0224564_1039971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 900 | Open in IMG/M |
| 3300025432|Ga0208821_1003800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4950 | Open in IMG/M |
| 3300025434|Ga0208690_1033313 | Not Available | 832 | Open in IMG/M |
| 3300025910|Ga0207684_11036788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 685 | Open in IMG/M |
| 3300025916|Ga0207663_10168765 | All Organisms → cellular organisms → Bacteria | 1552 | Open in IMG/M |
| 3300025922|Ga0207646_10933781 | Not Available | 769 | Open in IMG/M |
| 3300025922|Ga0207646_11939106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 501 | Open in IMG/M |
| 3300025928|Ga0207700_10226941 | Not Available | 1586 | Open in IMG/M |
| 3300025929|Ga0207664_10486696 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300025939|Ga0207665_10090879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2116 | Open in IMG/M |
| 3300025939|Ga0207665_10572224 | Not Available | 880 | Open in IMG/M |
| 3300026089|Ga0207648_10487671 | Not Available | 1126 | Open in IMG/M |
| 3300026298|Ga0209236_1268224 | Not Available | 555 | Open in IMG/M |
| 3300026318|Ga0209471_1218311 | Not Available | 706 | Open in IMG/M |
| 3300026328|Ga0209802_1264388 | Not Available | 581 | Open in IMG/M |
| 3300026360|Ga0257173_1075921 | Not Available | 501 | Open in IMG/M |
| 3300026361|Ga0257176_1088348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300026524|Ga0209690_1116799 | Not Available | 1059 | Open in IMG/M |
| 3300026527|Ga0209059_1083526 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300026941|Ga0207741_1008713 | Not Available | 1195 | Open in IMG/M |
| 3300027066|Ga0208236_1014323 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300027168|Ga0208239_1020130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300027371|Ga0209418_1049416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300027376|Ga0209004_1057393 | Not Available | 655 | Open in IMG/M |
| 3300027505|Ga0209218_1092873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300027829|Ga0209773_10354394 | Not Available | 611 | Open in IMG/M |
| 3300027829|Ga0209773_10433467 | Not Available | 544 | Open in IMG/M |
| 3300027854|Ga0209517_10296113 | Not Available | 948 | Open in IMG/M |
| 3300027862|Ga0209701_10148205 | Not Available | 1434 | Open in IMG/M |
| 3300027867|Ga0209167_10237855 | Not Available | 976 | Open in IMG/M |
| 3300027869|Ga0209579_10186103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1111 | Open in IMG/M |
| 3300027875|Ga0209283_10194222 | Not Available | 1348 | Open in IMG/M |
| 3300027882|Ga0209590_10011433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4182 | Open in IMG/M |
| 3300027889|Ga0209380_10004740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8284 | Open in IMG/M |
| 3300027986|Ga0209168_10098553 | Not Available | 1509 | Open in IMG/M |
| 3300028536|Ga0137415_10288359 | Not Available | 1446 | Open in IMG/M |
| 3300028652|Ga0302166_10062196 | Not Available | 795 | Open in IMG/M |
| 3300028759|Ga0302224_10140810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 942 | Open in IMG/M |
| 3300029918|Ga0302143_1113098 | Not Available | 642 | Open in IMG/M |
| 3300030339|Ga0311360_10900542 | Not Available | 700 | Open in IMG/M |
| 3300030490|Ga0302184_10178263 | Not Available | 905 | Open in IMG/M |
| 3300030659|Ga0316363_10004454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9589 | Open in IMG/M |
| 3300030707|Ga0310038_10499574 | Not Available | 514 | Open in IMG/M |
| 3300030991|Ga0073994_10057140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1048088 | Not Available | 899 | Open in IMG/M |
| 3300031231|Ga0170824_119612306 | Not Available | 935 | Open in IMG/M |
| 3300031236|Ga0302324_100406267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2029 | Open in IMG/M |
| 3300031236|Ga0302324_101730710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 798 | Open in IMG/M |
| 3300031249|Ga0265339_10048458 | Not Available | 2329 | Open in IMG/M |
| 3300031446|Ga0170820_15391046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300031469|Ga0170819_13513265 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300031474|Ga0170818_102539183 | Not Available | 934 | Open in IMG/M |
| 3300031474|Ga0170818_103675256 | Not Available | 515 | Open in IMG/M |
| 3300031474|Ga0170818_111267257 | Not Available | 923 | Open in IMG/M |
| 3300031708|Ga0310686_110109024 | Not Available | 3937 | Open in IMG/M |
| 3300031708|Ga0310686_117847179 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300031715|Ga0307476_10160050 | Not Available | 1621 | Open in IMG/M |
| 3300031715|Ga0307476_10924203 | Not Available | 643 | Open in IMG/M |
| 3300031715|Ga0307476_11121230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300031716|Ga0310813_11668233 | Not Available | 596 | Open in IMG/M |
| 3300031716|Ga0310813_12196016 | Not Available | 522 | Open in IMG/M |
| 3300031718|Ga0307474_10101607 | All Organisms → cellular organisms → Bacteria | 2149 | Open in IMG/M |
| 3300031754|Ga0307475_10341264 | Not Available | 1203 | Open in IMG/M |
| 3300031823|Ga0307478_10757577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300031823|Ga0307478_11094802 | Not Available | 665 | Open in IMG/M |
| 3300031880|Ga0318544_10368032 | Not Available | 559 | Open in IMG/M |
| 3300031910|Ga0306923_10342648 | Not Available | 1705 | Open in IMG/M |
| 3300031941|Ga0310912_10150182 | Not Available | 1757 | Open in IMG/M |
| 3300031941|Ga0310912_11340909 | Not Available | 541 | Open in IMG/M |
| 3300031962|Ga0307479_10220393 | Not Available | 1870 | Open in IMG/M |
| 3300031962|Ga0307479_10256991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1725 | Open in IMG/M |
| 3300032035|Ga0310911_10041952 | Not Available | 2346 | Open in IMG/M |
| 3300032059|Ga0318533_10195776 | Not Available | 1446 | Open in IMG/M |
| 3300032180|Ga0307471_101199644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 923 | Open in IMG/M |
| 3300032180|Ga0307471_101895316 | Not Available | 745 | Open in IMG/M |
| 3300032180|Ga0307471_103882108 | Not Available | 528 | Open in IMG/M |
| 3300032205|Ga0307472_101863184 | Not Available | 599 | Open in IMG/M |
| 3300032805|Ga0335078_10060297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5575 | Open in IMG/M |
| 3300032805|Ga0335078_10196552 | Not Available | 2806 | Open in IMG/M |
| 3300032805|Ga0335078_11086344 | Not Available | 937 | Open in IMG/M |
| 3300032893|Ga0335069_10253515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2115 | Open in IMG/M |
| 3300032897|Ga0335071_10095758 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 2910 | Open in IMG/M |
| 3300033004|Ga0335084_10204607 | Not Available | 2049 | Open in IMG/M |
| 3300033158|Ga0335077_10007953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 13151 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.64% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 8.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.32% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.90% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.90% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.48% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.48% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.48% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.48% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.13% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.13% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.42% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.42% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.42% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.42% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.77% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.06% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.06% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.71% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.71% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.71% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.35% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.35% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.35% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.35% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.35% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.35% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.35% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.35% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.35% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.35% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.35% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.35% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.35% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.35% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.35% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.35% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.35% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Host-Associated | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025432 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026941 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 39 (SPAdes) | Environmental | Open in IMG/M |
| 3300027066 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF005 (SPAdes) | Environmental | Open in IMG/M |
| 3300027168 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF037 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028652 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_3 | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300029918 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1 | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_03899210 | 2199352024 | Soil | ATFNATNLVYRKEQMLAAAPAHMGANAVFNQTEVHGGAPAGPVPGA |
| JGI12270J11330_100834192 | 3300000567 | Peatlands Soil | EQMLAPRPAHMGANAIFNQADVDAGAPAQLVPGS* |
| JGI1027J11758_123323162 | 3300000789 | Soil | YRKEQMLAPAPAHMGANAVFNQSEIIGGAPSLPVQRS* |
| JGI1027J12803_1002614112 | 3300000955 | Soil | RKEMMLAPRPAHMGANVVFNQADVNGGAPAEMVPGS* |
| JGI1027J12803_1002773931 | 3300000955 | Soil | RKEMMLAPRPAHMGANIVFNQADVNGGAPAEMVPGS* |
| JGI12635J15846_100395174 | 3300001593 | Forest Soil | NLVYRKEQMLAPRPAHMGANVVFNQSDVDGGAPAQFVAGS* |
| JGI24739J22299_100531332 | 3300001989 | Corn Rhizosphere | IYRKEQLLAPKPAHLGANPVFNAAEVAGGAPSEVAPGE* |
| JGIcombinedJ26739_1011097141 | 3300002245 | Forest Soil | ELATFSASNLIYRKEQMLAPRPAHMGANAVFNQADVDGGAPTEMVPGS* |
| JGIcombinedJ26739_1011613911 | 3300002245 | Forest Soil | ASNLVYRKEQMLAPMPAHMGANAVFNRDEVAAGAPSLPVQGS* |
| JGI25381J37097_10731021 | 3300002557 | Grasslands Soil | FNAGDLIYRKEQMLAAVPAHMGANAVFNRAEVAAGAPAAPVPGS* |
| JGIcombinedJ51221_103279071 | 3300003505 | Forest Soil | LIYRKEQMLAAAPAHMGANAVFNSADVAEGAPALPVQGS* |
| Ga0062387_1011482712 | 3300004091 | Bog Forest Soil | TFNASNLVYRKEQMLAPRPAHMGANVVFNQADVDGGAPKEMVAGS* |
| Ga0062593_1005256591 | 3300004114 | Soil | STLVYRKEQMLAATPAHMGANAVFGASEVAAGAPANTLPGS* |
| Ga0062386_1003970491 | 3300004152 | Bog Forest Soil | LVYRKEQMLAPRPAHMGANVVFNQADVDGGAPKEMVAGS* |
| Ga0063455_1003402671 | 3300004153 | Soil | FNATNLIYRKEMMLAPRPAHMGANIVFNQADVNGGAPAEMVPGS* |
| Ga0070683_1011887681 | 3300005329 | Corn Rhizosphere | ELATFNATNLVMRKEQMLAPRPAHMGANIVFNQADVNGGAPAEMVPGS* |
| Ga0070714_1011711181 | 3300005435 | Agricultural Soil | NATNLVYRKEMMLAPRPAHMGANAVFNQADVNGGAPAEMVPGS* |
| Ga0070714_1017744812 | 3300005435 | Agricultural Soil | TNLIMRKEQMLAPRPAHMGANIVFNQADVNGGAPAEMVPGS* |
| Ga0070711_1005555291 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | TNLIYRKEQMLAAAPAHMGANAVFNSADVAGGAPALPVQGS* |
| Ga0066687_104689192 | 3300005454 | Soil | TSLVYRKEQMLSPLPAHMGANAVFNEAEVEAGTPPMRSEQPDANV* |
| Ga0070681_103614981 | 3300005458 | Corn Rhizosphere | SFNASNLVYRKEQMLAPRPAHMGANAIFNRDEVGAGAPSLPEQGS* |
| Ga0070707_1008146281 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | SFNVSNLIYRKEQLLAPGPAHLGANAVFNRADVESGAPALPVRGS* |
| Ga0070739_105495462 | 3300005532 | Surface Soil | TFNATNLIYRKEQLLAPRPAHLGANPVFNTAEVIGGAPAEVAPGE* |
| Ga0070735_106158092 | 3300005534 | Surface Soil | ASLNATSLVYRKEQMLAPLPAHLGSNAVFNKSETEKGTPAVRS* |
| Ga0070731_101089831 | 3300005538 | Surface Soil | YRKEMMLAPRPAHMGANIVFNQADVNGGAPAEMVPGS* |
| Ga0070731_101861502 | 3300005538 | Surface Soil | ELASFNVSSLVYRKEQMLAPQPAHMGANAVFNQAEVADGAPPVPVQGV* |
| Ga0070733_101196812 | 3300005541 | Surface Soil | LVYRKEQMLAPRPAHMGANIIFNQADVDGGAPAQLVPGS* |
| Ga0070733_111476271 | 3300005541 | Surface Soil | LVYRKEQMLAPRPAHMGANAIFNQADVDAGAPAQMVPGS* |
| Ga0070732_103445091 | 3300005542 | Surface Soil | ATSLVYRKEQMLAPLPAHLGSNAVFNQAEAEKGTPAVRS* |
| Ga0070732_105230791 | 3300005542 | Surface Soil | LIYRKEQMLAAAPAHMGANAVFNSADVAGGAPASMIQGS* |
| Ga0070695_1017863492 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | GFELASFNATNLVMRKEQMLAPRPAHMGANIVFNQADVNGGAPTEMVPGS* |
| Ga0066702_101690612 | 3300005575 | Soil | NLIYRKEQLLAAKPAHLGANPVFNTAEVIGGAPAEAAPGE* |
| Ga0070761_101206902 | 3300005591 | Soil | ASFNASNLVYRKEQMLAPRPAHMGANVVFNQSDVDGGAPAQFVAGS* |
| Ga0070762_100378833 | 3300005602 | Soil | ASNLVYRKEQMLAPRPAHMGANVVFNQSDVDGGAPAQFVAGS* |
| Ga0070762_108210701 | 3300005602 | Soil | VYRKEQMLAPRSAHMGANVVFNQADVDGGAPKEMVAGS* |
| Ga0066903_1010083012 | 3300005764 | Tropical Forest Soil | ATFNASGLIFRKEQLLAAAPAHLGANAVFNAEEVAVGAPPVAAPGE* |
| Ga0066903_1065682281 | 3300005764 | Tropical Forest Soil | YRKEQMLAPRPAHMGANIVFNQADVNGGAPAEMVPGS* |
| Ga0070766_106938972 | 3300005921 | Soil | LVYRKEQMLAPRPAHMGANVVFNQSDVDGGAPAQFVAGS* |
| Ga0070717_115693412 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VYRKEQMLAPRPAHMGANVVFNQADVDGGAPAEMVPGS* |
| Ga0070717_115781172 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | FNATNLIYRKEQLLAAGPAHLGANPVFNSAEVAGGAPAQVAPGE* |
| Ga0075029_1007152731 | 3300006052 | Watersheds | LIYRKEQMLAPRPAHMGANVVFNQADVDGGAPVQMVPGS* |
| Ga0075029_1007422612 | 3300006052 | Watersheds | NLVYRKEQMLAPRPAHMGANVVFNQADVNGGAPAEMVPGS* |
| Ga0075015_1001903312 | 3300006102 | Watersheds | EQMLAAAPAHMGANAVFGKADTDVGAPASMLPGT* |
| Ga0075030_1008675902 | 3300006162 | Watersheds | LVYRKEQMLASRPAHMGANVVFNQADVDGGAPAQMVPGS* |
| Ga0070715_108090152 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | RKEQMLAAAPAHMGANAVFNQSEVAGGAPSLPEQGS* |
| Ga0070716_1010663061 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | RKEQMLAPRPAHMGANIVFNQADVNGGAPSEMVPGS* |
| Ga0070712_1015290051 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | IASFNASNLVYRKEQMLAPMPAHMGAGAIFNRDEVAAGAPSLPVQGS* |
| Ga0070765_1002360441 | 3300006176 | Soil | YRKEQMLAPRPAHMGANAVFNQAEVAEGAPAVPVPGS* |
| Ga0075527_101877502 | 3300006640 | Arctic Peat Soil | LPCVLAGGPAHMGANVIFNQADVDGGAPAQMVPGS* |
| Ga0079222_121758701 | 3300006755 | Agricultural Soil | YRKEQMLAPVSAHLGANVVFNNDDVAAGTAALAAVNSLRG* |
| Ga0066665_104952001 | 3300006796 | Soil | TNLIYRKEQLLAPKPAHLGANPVFNAAEVSGGAPAEVAPGE* |
| Ga0066660_103756391 | 3300006800 | Soil | MRKEQMLAPRPAHMGANIVFNQADVNGGAPAEMVPGS* |
| Ga0079220_117205321 | 3300006806 | Agricultural Soil | ASLNATSLVYRKEQMLAPLPAHLGSNAVFNQAEAEKGTPAVRS* |
| Ga0075434_1006019891 | 3300006871 | Populus Rhizosphere | SALIYRKEQMLAPTPAHIGANVVFNQAEVAGGAPAVPAPGE* |
| Ga0073928_100228331 | 3300006893 | Iron-Sulfur Acid Spring | KEQMLATRPAHLGANVVFNHADVEGGAPAQMVSGS* |
| Ga0099795_102353461 | 3300007788 | Vadose Zone Soil | NLIYRKEQLLAIAPAHLGANAVFTGADTEGGEPTQMVPGS* |
| Ga0099830_106126222 | 3300009088 | Vadose Zone Soil | RKEQMLAPRPAHMGANVVFNQADVDGGAPAEMVPGS* |
| Ga0099830_115912031 | 3300009088 | Vadose Zone Soil | KEQMLAPMPAHMGANAVFNQEEVAAGAPAEIMPGE* |
| Ga0099830_117908212 | 3300009088 | Vadose Zone Soil | SFSASNLVYRKEQMLAPRPAHMGANVIFNQADVDGGAPARMVPGS* |
| Ga0099828_108069221 | 3300009089 | Vadose Zone Soil | EQMLAPMPAHMGANAVFNQEEVGAGAPAQIMPGE* |
| Ga0099827_119554541 | 3300009090 | Vadose Zone Soil | KEQLLAAVPAHIGANAVFNRAEVEGGAPAVPLPGS* |
| Ga0105247_104901341 | 3300009101 | Switchgrass Rhizosphere | KEQMLAPAPAHMGDNSVFNQAEVESGAPALPVQGS* |
| Ga0066709_1003343081 | 3300009137 | Grasslands Soil | NLIMRKEQMLASMPAHMGANAVFNQAEVAGGAPVDVLPGS* |
| Ga0099792_110932601 | 3300009143 | Vadose Zone Soil | RKEQLLAARPAHLGANPVFNVAEVIGGAPGEVAPGE* |
| Ga0105241_125699371 | 3300009174 | Corn Rhizosphere | KEQLLAAKPAHLGSNPVFNTAEVIGGAPAEAAPGE* |
| Ga0116214_10593272 | 3300009520 | Peatlands Soil | KEQLLAIAPAHQGANAVFNGAENAGGAPMEMTPGS* |
| Ga0105238_124899251 | 3300009551 | Corn Rhizosphere | KEQMLAAKPAHLGANSVFNQVEVLGGAPAEVAPGE* |
| Ga0116133_10411282 | 3300009623 | Peatland | FNASNLVYRKEQMLAPRPAHMGANVIFNQADVDGGAPAQMVPGS* |
| Ga0116105_10465632 | 3300009624 | Peatland | VYRKEQMLAPRPAHMGANAVFNQAEVAGGAPAVPVPGV* |
| Ga0116113_10888062 | 3300009638 | Peatland | YRKEQMLAPRPAHMGANVVFNQADVDGGAPKEMVAGS* |
| Ga0116122_12907531 | 3300009639 | Peatland | NLIYRKEQLLAIAPAHMGANAVFNGAENAAGAPTEMTPGS* |
| Ga0116135_11494831 | 3300009665 | Peatland | EQMLASRPAHMGANVVFNQADVDGGAPKEMVAGS* |
| Ga0116224_102351422 | 3300009683 | Peatlands Soil | YRKEQMLAPRAAHMGANAVFNQAEVAGGAPPVPVPGI* |
| Ga0116219_102346461 | 3300009824 | Peatlands Soil | LVYRKEQMLAPRPAHMGANVIFNQADVDGGAPVQMVPGS* |
| Ga0123355_100017641 | 3300009826 | Termite Gut | NLVYRKEQLLAPRPAHLGANPVFNSAEVLEGAPTEVAPGE* |
| Ga0126380_120889881 | 3300010043 | Tropical Forest Soil | TFNATNLIYRKEQMLAPRPAHMGANIVFNQADVSGGAPAEVVPGS* |
| Ga0126380_122269681 | 3300010043 | Tropical Forest Soil | TNLIYRKEQLLAPMPAHLGANPVFNAAEVSAGAPAKVAPGE* |
| Ga0126373_129902071 | 3300010048 | Tropical Forest Soil | VYRKEMMLAPRPAHMGANIVFNQADVNGGAPAEMVPGS* |
| Ga0134082_103520891 | 3300010303 | Grasslands Soil | NATNLVYRKEQLLAPRPAHLGANPVFNAAEVMGGAPAEVAPGE* |
| Ga0074046_100490571 | 3300010339 | Bog Forest Soil | TNLIYRKEQMLAPRPAHMGANAVFNQAAVETGAPALPVQGS* |
| Ga0126370_105384241 | 3300010358 | Tropical Forest Soil | EQLLAPKPAHLGANPVFNAAEVMGGAPADVAPGE* |
| Ga0126370_113826771 | 3300010358 | Tropical Forest Soil | ATNLVMRKEQMLAPRPAHMGANIVFNQADVDGGAPTQMVPGS* |
| Ga0126370_113853852 | 3300010358 | Tropical Forest Soil | LIYRKEQLLAPKPAHLGANPVFNAAEVIGGAPAEMAPGQ* |
| Ga0126376_100966122 | 3300010359 | Tropical Forest Soil | LVYRKEQMLAPVPAHIGANAVFNQDEVGGGAPAVVAPGE* |
| Ga0126372_101580871 | 3300010360 | Tropical Forest Soil | TNLVYRKEQMLAPMPAHLGANAVFNQAEVIGGAPAEPAPGE* |
| Ga0126378_103767162 | 3300010361 | Tropical Forest Soil | NLIYRKEQMLAAAPAHMGANAVFNSAEVAGGAPASMIQGS* |
| Ga0126378_111015082 | 3300010361 | Tropical Forest Soil | FNATNLIYRKEQLLAPKPAHLGANPVFNAAELIGGAPTEVAPGE* |
| Ga0134128_101152113 | 3300010373 | Terrestrial Soil | LIYRKEQLLAAKPAHLGSNPVFNTAEVLGGAPAEAAPGE* |
| Ga0134126_130208382 | 3300010396 | Terrestrial Soil | FNATNLIYRKEQLLAARPAHLGANPVFNSAEVAGGAPAEVAPGE* |
| Ga0134122_108670272 | 3300010400 | Terrestrial Soil | LVYRKEQMLAPVPAHMGANSVFNRDEVVHGAPALPVQGS* |
| Ga0150983_121951671 | 3300011120 | Forest Soil | ASNLVYRKEQMLAPRPAHMGANVIFNQADVDGGAPAQMMPGS* |
| Ga0150983_155992752 | 3300011120 | Forest Soil | GFELASFNATNLVMRKEQMLAPRPAHMGANIVFNQADVNGGAPAEMVPGS* |
| Ga0137392_107896641 | 3300011269 | Vadose Zone Soil | NLVYRKEQMLAARPAHMGANVVFNQADVDGGAPKEMVAGS* |
| Ga0137393_110224771 | 3300011271 | Vadose Zone Soil | YRKEQMLATKPAHLGANPVFNAAEIAGGAPADFASGE* |
| Ga0137388_116677821 | 3300012189 | Vadose Zone Soil | LASFNVTDLIYRKEQMLAPLPAHMGANAVFNQSDVNGGAPAEMVPGS* |
| Ga0137383_107129761 | 3300012199 | Vadose Zone Soil | RKEQMLAPRPAHMGANVIFNQADVDGGAPAQMVPGS* |
| Ga0137362_106763172 | 3300012205 | Vadose Zone Soil | YRKEQMLSPLPAHLGSNAMFNEAEVEAGTPAVGS* |
| Ga0137362_114093181 | 3300012205 | Vadose Zone Soil | EQLLAARPAHLGANPVFNAADVAGGAPADVAPGE* |
| Ga0137380_116199672 | 3300012206 | Vadose Zone Soil | RKEQLLAAAPAHLGANPVFNTAEVIGGAPAEVAPGE* |
| Ga0137381_112069292 | 3300012207 | Vadose Zone Soil | GDLIYRKEQMLAAVPAHMGANAVFNRAEVAAGAPAAPVPGS* |
| Ga0137376_116998621 | 3300012208 | Vadose Zone Soil | KEQMLAPRPAHMGANAVFNQADVDGGAPAEMVPGS* |
| Ga0137378_101955482 | 3300012210 | Vadose Zone Soil | LIYRKEQLLAAKPAHLGANPVFNAAEVSGGAPAEVAPGE* |
| Ga0137378_106476991 | 3300012210 | Vadose Zone Soil | LIYRKEQLLSITPAHLGANAVFNGADTEGGAPTQVLPGS* |
| Ga0137370_104747922 | 3300012285 | Vadose Zone Soil | AFNASDLVYRKEQMLAPVPAHIGANAVFNQDEVAAGAPAVVAPGE* |
| Ga0137367_103611472 | 3300012353 | Vadose Zone Soil | NASNLIYRKEQMLAPRPAHMGANIVFNQADVMGGAPSEMVPGS* |
| Ga0137385_107125681 | 3300012359 | Vadose Zone Soil | NATNLIYRKEQLLAAAPAHLGANPVFNTAEVIGGAPAEVAPGE* |
| Ga0137385_108667031 | 3300012359 | Vadose Zone Soil | NLIYRKEQMLAPRPAHMGANAVFNQADVDGGAPAEMVPGS* |
| Ga0137361_112907671 | 3300012362 | Vadose Zone Soil | SASNLIYRKEQMLAPRPAHMGANAVFNQADVDGGAPAEMVPGS* |
| Ga0137361_116239171 | 3300012362 | Vadose Zone Soil | KEQMLAPRPAHMGANIVFNQADVDGGAPTEMVPGS* |
| Ga0137398_104810253 | 3300012683 | Vadose Zone Soil | SNLIYRKEQMLAARPAHMGANVVFNQADVDGGAPKEMVAGS* |
| Ga0137359_110595191 | 3300012923 | Vadose Zone Soil | ATNLIYRKEQLLAARPAHLGANPVFNAAEVAGGAPADVAPGE* |
| Ga0137407_107306991 | 3300012930 | Vadose Zone Soil | TFNASNLVYRKEQMLAAGPAHMGANSVFNQSEVAGGAPALPVQGM* |
| Ga0137407_108817693 | 3300012930 | Vadose Zone Soil | ASNLVYRKEQMLAAAPAHMGANAVFNQAEVEGGAPSLPVQGS* |
| Ga0164301_110012572 | 3300012960 | Soil | YRKEQLLAAGPAHLGANPVFNSAEVAGGAPAEVAPGE* |
| Ga0164302_100966922 | 3300012961 | Soil | NASNLIYRKEQMLSAAPAHMGANAVFNSAEVAGGAPALPVQGS* |
| Ga0126369_119138892 | 3300012971 | Tropical Forest Soil | YRKEQMLAAAPAHMGANAVFNSAEVAGGAPASMIQGS* |
| Ga0157372_129112021 | 3300013307 | Corn Rhizosphere | TNLIYRKEQLLAAKPAHLGSNPVFNTAEVIGGAPAEVAPGE* |
| Ga0181523_100029461 | 3300014165 | Bog | SNLVYRKEQMLAPRPAHMGANVVFNQADVDGGAPKEMVAGS* |
| Ga0181531_107176512 | 3300014169 | Bog | YRKEQMLAPRPAHMGANSVFNQADVAGGAPREMVAGS* |
| Ga0181537_107435011 | 3300014201 | Bog | ASNLVYRKEQMLASRPAHMGANVVFNQADVDGGAPKEMVAGS* |
| Ga0181537_107655411 | 3300014201 | Bog | LVYRKEQLLAASPAHLGANAVFNAEEVAEGAPAKAVPGT* |
| Ga0182024_120079721 | 3300014501 | Permafrost | LVYRKEQMLPPIPAHMGANAVFNQDEVNHGAPAAVLPGE* |
| Ga0157376_118752391 | 3300014969 | Miscanthus Rhizosphere | NATNLIYRKEQLLAAKPAHLGSNPVFNTAEVLGGAPAEAAPGE* |
| Ga0137418_107534091 | 3300015241 | Vadose Zone Soil | EQMLAPRPAHMGSNSVFNQADVDGGAPVEMVPGS* |
| Ga0137418_108661621 | 3300015241 | Vadose Zone Soil | ELASFNVTDLIYRKEQMLAPRPAHMGANAVFNQADVNGGAPAEMVPGS* |
| Ga0137409_102956401 | 3300015245 | Vadose Zone Soil | RKEQMLAAVPAHMGANAVFNRAEVAAGAPAAPVPGS* |
| Ga0132256_1025419151 | 3300015372 | Arabidopsis Rhizosphere | NLVYRKEQMLAPAPAHLGANSVFNQAEVEGGAPSLPVQGS* |
| Ga0182037_108701712 | 3300016404 | Soil | ATFTASSLVYRKEQMLAPVPAHLGANAVFNTADVLEDRIPAEPAPGA |
| Ga0187812_11760331 | 3300017821 | Freshwater Sediment | KEQLLSIAPAHMGANAVFNGAETEVGAPTQMIPGS |
| Ga0187824_102542092 | 3300017927 | Freshwater Sediment | RKEQMLAPRPAHMGANIVFNQADVDGGAPAQMVPGS |
| Ga0187824_102833272 | 3300017927 | Freshwater Sediment | LASFNATNLIYRKEQMLAAAPAHMGANAVFNSADVAGGAPALPVQGS |
| Ga0187803_104476831 | 3300017934 | Freshwater Sediment | LVYRKEQMLASRPAHMGANVVFNQADVDGGAPREMVAGS |
| Ga0187848_102353572 | 3300017935 | Peatland | SNLVYRKEQMLAPRPAHMGANVVFNQADVDGGAPKEMVAGS |
| Ga0187775_100922693 | 3300017939 | Tropical Peatland | FNSSNLVYRKEQMLAPMPAHMGANAIFNREEVEAGAPALPAQGS |
| Ga0187817_104989992 | 3300017955 | Freshwater Sediment | ASNLVYRKEQMLSPMPAHMGANAVFNSDEVAHGAPAAIVPGE |
| Ga0187778_109653661 | 3300017961 | Tropical Peatland | TFNASNLIYRKEQMLAPRPAHMAANAIFNQADVDAGAPAQIVAGS |
| Ga0187783_101833612 | 3300017970 | Tropical Peatland | ATNLIYRKEQMLAPRPAHLGANAVFNQAEVASGAPAVPMSGV |
| Ga0187783_105055871 | 3300017970 | Tropical Peatland | LVYRKEQMLAPRPAHMGENVVFNQADVDGGAPAQMVGGS |
| Ga0187781_102907971 | 3300017972 | Tropical Peatland | VYRKEQMLAPRPAHMGANAIFNQADVNAGAPAQLVSGS |
| Ga0187781_109040361 | 3300017972 | Tropical Peatland | NASNLVYRKEQMLAPRPAHMGANAIFNQADVNAGAPVQLQPGS |
| Ga0187777_102582583 | 3300017974 | Tropical Peatland | RKEQLLSVMPAHMGANAVFNEAEVEAGAPVAIVPGE |
| Ga0187782_112938341 | 3300017975 | Tropical Peatland | NLVYRKEQMLAPRPAHMGANIIFNQADVNAGAPAELVPGS |
| Ga0187782_114532022 | 3300017975 | Tropical Peatland | SNLIYRKEQMLAPRPAHMGANIIFNQADVDGGAPREMVAGS |
| Ga0187816_100865252 | 3300017995 | Freshwater Sediment | YRKEQMLAPRPAHMGANVVFNQADVDGGAPAQMVPGS |
| Ga0187804_101362231 | 3300018006 | Freshwater Sediment | SSLIYRKEQLLAAAPAHMGANAVFGKADTDVGAPATSLPGT |
| Ga0187886_13588652 | 3300018018 | Peatland | RKEQMLAPRPAHMGANVIFNQADVDGGAPAQMVQGS |
| Ga0187875_100565862 | 3300018035 | Peatland | VYRKEQMLAPRPAHMGANVVFNQADVDGGAPKEMVAGS |
| Ga0187871_102452682 | 3300018042 | Peatland | VYRKEQMLAPRPAHMGANAVFNQAEVAGGAPAVPVPGV |
| Ga0187859_108895851 | 3300018047 | Peatland | TFNASNLVYRKEQMLAPRPAHMGDNVIFNQADVDGGAPAQMVAGS |
| Ga0187784_102374331 | 3300018062 | Tropical Peatland | FNASNLVYRKEQMLAPRPAHLGANAVFNQAEVAAGAPAAQVPGV |
| Ga0187784_109089822 | 3300018062 | Tropical Peatland | NLIYRKEQMLAPRPAHMGANIVFNQADVNGGAPEEMVPGS |
| Ga0187784_109429161 | 3300018062 | Tropical Peatland | HGFEVASFNATNLIFRKEQMLAPKPGHLGANAIFNQADVEAGAPALPVPGS |
| Ga0187784_113742261 | 3300018062 | Tropical Peatland | SNLVYRKEQMLAPRPAHMGSNAIFNQADVDAGAPAQLVPGS |
| Ga0187772_100691961 | 3300018085 | Tropical Peatland | ATNLIYRKEQMLAPRPAHMGANIVFNQADVNGGAPAEMVPGS |
| Ga0187772_100824332 | 3300018085 | Tropical Peatland | LVYRKEQMLAPRPAHMGANIVFNQADVDGGAPTMMVPGS |
| Ga0187772_111105891 | 3300018085 | Tropical Peatland | RKEQMLAPRPAHMGANMIFNQADVDAGAPAQLVPGS |
| Ga0187772_112974741 | 3300018085 | Tropical Peatland | SNLVYRKEQMLAAAPAHMGANAVFGKQETDLGAPATVLPGT |
| Ga0187772_114714752 | 3300018085 | Tropical Peatland | YRKEQMLAPRPAHMGANIIFNQADVNAGAPAQLVPGS |
| Ga0187769_111474311 | 3300018086 | Tropical Peatland | NASNLVYRKEQMLAPRPAHMGSNAIFNQADVDAGAPAQLVPGS |
| Ga0187771_108893502 | 3300018088 | Tropical Peatland | KEQMLAPRPAHMAANAIFNQADVDAGAPAQLVPGV |
| Ga0187771_110173091 | 3300018088 | Tropical Peatland | GHGFEIASFNATNLIYRKEQMLAPRPAHLGANAVFNQAEVAGGAPAVPLPGV |
| Ga0187774_102248751 | 3300018089 | Tropical Peatland | RKEQMLAAAPAHMGANAVFGKQETDVGAPTTVVPGI |
| Ga0187770_102277592 | 3300018090 | Tropical Peatland | FNASNLVYRKEQMLAPRPAHMGSNAIFNQADVDAGAPAQLVPGS |
| Ga0187770_110930421 | 3300018090 | Tropical Peatland | TFNATNLVYRKEQMLAPRPAHMGANVVFNQADVNGGAPAELLPGS |
| Ga0066655_103595601 | 3300018431 | Grasslands Soil | NLIMRKEQMLAPRPAHMGANIIFNQADVNGGAPAEMVPGS |
| Ga0066662_101161551 | 3300018468 | Grasslands Soil | IYRKEQMLAPVPAHLGANAVFNSAEVAQGAPAVPAPGE |
| Ga0187798_18766191 | 3300019275 | Peatland | IASFNATNLIYRKEQMLAPRPAHLGANAVFNQAEVAGGAPAVPLPGV |
| Ga0193707_11191051 | 3300019881 | Soil | RKEQMLAAVPAHMGANAVFNRAEVAAGAPAVPLPGS |
| Ga0193729_12632572 | 3300019887 | Soil | RKEQMLAAVPAHMGANAVFNRAEVAAGAPAVPVPGS |
| Ga0193718_10525742 | 3300019999 | Soil | LVYRKEQMLAPVPAHMGANAVFNRDEVEAGSVSLPVQGS |
| Ga0179592_102407872 | 3300020199 | Vadose Zone Soil | FNASNLVYRKEQMLAPRPAHMGANVIFNQADVDGGAPVQMVPGS |
| Ga0210403_105655432 | 3300020580 | Soil | TNLVMRKEQMLAPRPAHMGANIVFNQADVNGGAPAEMVPGS |
| Ga0210401_101578011 | 3300020583 | Soil | NTSNLIYRKEQMLAPRPAHMGANVIFNQADVDGGAPAQMVPGS |
| Ga0210401_101946243 | 3300020583 | Soil | KEQMLAPRPAHMGANAVFNQAEVADGAPALPVPGV |
| Ga0210401_105364562 | 3300020583 | Soil | VYRKEQMLAPRPAHMGANVIFNQADVDGGAPAQMVPGS |
| Ga0210404_101441422 | 3300021088 | Soil | LIYRKEQMLAAAPAHMGANAVFNSADVAGGAPALPVQGS |
| Ga0210406_101544792 | 3300021168 | Soil | FNATDLVMRKEQMLAPRPAHMGANIVFNQADVNGGAPAEMVPGS |
| Ga0210405_111279861 | 3300021171 | Soil | LVYRKEQMLAPRPAHMGANVIFNQADVDAGAPAQMVPGS |
| Ga0210408_102598901 | 3300021178 | Soil | YRKEQMLAPRPAHMGANAVFNQAEVAAGAPAVPVPGS |
| Ga0210396_109057722 | 3300021180 | Soil | TFNASNLIYRKEQMLAPRPAHMGENVIFNQADVDGGAPAQMVAGS |
| Ga0210388_104763561 | 3300021181 | Soil | LVYRKEQLLAIAPAHMGANAVFNGEEVGGGAPAEMTQGS |
| Ga0193719_102784621 | 3300021344 | Soil | SNLIYRKEQMLAAGPAHMGANAVFNSADVAGGAPALPVQGS |
| Ga0210385_101570242 | 3300021402 | Soil | KEQMLAPRPAHMGANVIFNQADVDGGAPAQMVQGS |
| Ga0210387_102125711 | 3300021405 | Soil | ATFNASNLVYRKEQMLAPRPAHMGENVIFNQADVDGGAPAQMVAGS |
| Ga0210394_101321942 | 3300021420 | Soil | SFNASNLVYRKEQMLAPRPAHMGANVVFNQSDVDGGAPAQFVAGS |
| Ga0210394_113549952 | 3300021420 | Soil | NASNLVSRKEQMLAPRPAHMGDNVIFNQADVDGGAPKEMVAGS |
| Ga0182009_102911401 | 3300021445 | Soil | IYRKEQLLAAAPAHMGANAVFNTAEVDNGAPATLVPGS |
| Ga0210390_103741563 | 3300021474 | Soil | LVYRKEQMLAPRPAHMGANVIFNQADVDGGAPAQMMPGS |
| Ga0187846_104664832 | 3300021476 | Biofilm | RKEQMLAPAPAHMGANLVFNQADVKGGAPAQMLPGS |
| Ga0210402_106307842 | 3300021478 | Soil | SFNASNLVYRKEQMLAPMPAHMGAGAVFNRDEVASGAPSLPVQGS |
| Ga0210402_113936701 | 3300021478 | Soil | NVSGLIYRKEQLLAPMPAHMGANAVFNQDEVGVGAPALPVQRS |
| Ga0210410_115596592 | 3300021479 | Soil | ASNLVYRKEQMLAPRPAHMGANAVFNQAEVAGGAPAVPVPGS |
| Ga0210409_100347605 | 3300021559 | Soil | LVYRKEQMLAPRPAHMGANAVFNQAEVAEGAPSASVPGS |
| Ga0210409_100877052 | 3300021559 | Soil | YRKEQMLAPRPAHMGANAVFNQAEVAEGAPAVPVPGS |
| Ga0210409_109443772 | 3300021559 | Soil | IYRKEQLLAPMPAHMGANAVFNQDEVGVGAPALPVQRS |
| Ga0126371_100124131 | 3300021560 | Tropical Forest Soil | TNLIYRKEQMLAAAPAHMGANAVFNSAEVAGGAPASMIQGS |
| Ga0126371_110921212 | 3300021560 | Tropical Forest Soil | SLVYRKEQMLAPVPAHLGANAVFNTAEVLEDRMPAEPVPGV |
| Ga0242665_100156391 | 3300022724 | Soil | LVMRKEQMLAPRPAHMGANIVFNQADVNGGAPAEMVPGS |
| Ga0224564_10399713 | 3300024271 | Soil | RKEQMLAPRPAHMGANVVFNQADVDGGAPAQMVPGS |
| Ga0208821_10038001 | 3300025432 | Peatland | KEQMLAPRPAHMGANVVFNQADVDGGAPKEMVAGS |
| Ga0208690_10333132 | 3300025434 | Peatland | RKEQMLAPRPAHMGANVVFNQSDVDGGAPAQFVAGS |
| Ga0207684_110367882 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | ASFNASDLVYRKEQMLAPMPAHIGANAVFNQDEVAAGAPAVVAPGE |
| Ga0207663_101687651 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | KEQMLAPASAHLGANAVFNSDDVALGAPVQPMQNS |
| Ga0207646_109337811 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | ATFSATNLVYRKEMMLAPRPAHMGANIVFNQADVNGGAPSEMVPGS |
| Ga0207646_119391061 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | GFEIASFNATELIYRKEQMLAPMPAHMGANAVFNQEEVGAGAPAQIMPGE |
| Ga0207700_102269412 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | NLVYRKEMMLAPRPAHMGANIVFNQADVNGGAPSEMVPGS |
| Ga0207664_104866962 | 3300025929 | Agricultural Soil | KEQLLAAKPAHLGSNPVFNTSEVLGGAPAEAAPGE |
| Ga0207665_100908792 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MVYRKEQLLAAKPAHLGSNPVFNIAEVIGGAPAEAAPGE |
| Ga0207665_105722241 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | TFNASALIYRKEQMLAPTPAHIGANVVFNQAEVAGGAPAVPAPGE |
| Ga0207648_104876711 | 3300026089 | Miscanthus Rhizosphere | NASSLVYRKEQMLAAKPAHLGANSVFNQVEVLGGAPAEVAPGE |
| Ga0209236_12682241 | 3300026298 | Grasslands Soil | KEQLLAAVPAHLGANAIFNRADVEGGAAAVPVPGS |
| Ga0209471_12183111 | 3300026318 | Soil | NLIYRKEQLLAAVPAHIGANAVFNRAEVEGGAPAVPLPGS |
| Ga0209802_12643882 | 3300026328 | Soil | KEQMLAPRPAHMGANIVFNQADVDGGAPTEMVPGS |
| Ga0257173_10759212 | 3300026360 | Soil | ASNLIYRKEQLLAITPAHLGANAVFNGADTEGGAPTQVLPGS |
| Ga0257176_10883482 | 3300026361 | Soil | LATFSASNLIYRKEQMLAPRPAHMGANAVFNQADVDGGAPAEMVPGS |
| Ga0209690_11167992 | 3300026524 | Soil | SFNASNLIYRKEQLLAAVPAHLGANAIFNRADVEGGAAAVPVPGS |
| Ga0209059_10835261 | 3300026527 | Soil | KEQLLAAKPAHLGANPVFNTAEVIGGAPAEAAPGE |
| Ga0207741_10087132 | 3300026941 | Tropical Forest Soil | VYRKEMMLAPRPAHMGANIIFNQADVNGGAPAEVVPGS |
| Ga0208236_10143233 | 3300027066 | Forest Soil | KEQMLAARPAHMGANVVFNQADVDGGAPLQMVPGS |
| Ga0208239_10201301 | 3300027168 | Forest Soil | TFNASNLVYRKEQMLAPRPAHMGANVIFNQADVDGGAPAQMMPGS |
| Ga0209418_10494161 | 3300027371 | Forest Soil | TFNATNLVYRKEQMLAAAPAHMGANAVFNAAEVAGGAPALPIQGS |
| Ga0209004_10573931 | 3300027376 | Forest Soil | RKEQMLAAAPAHMGANAVFNSADVAGGAPALPVQGS |
| Ga0209218_10928732 | 3300027505 | Forest Soil | NASNLVYRKEQMLAARPAHMGANVVFNQADVDGGAPKEMVTGS |
| Ga0209773_103543941 | 3300027829 | Bog Forest Soil | ATFNASNLIYRKEQMLAPRPAHMGENVIFNQADVDGGAPAQMVAGS |
| Ga0209773_104334671 | 3300027829 | Bog Forest Soil | MLRKEQMLAARPAHMGANAVFNQAEVAGGAPAAPISGS |
| Ga0209517_102961132 | 3300027854 | Peatlands Soil | FNASNLVYRKEQMLAPRPAHMGANVIFNQADVDGGAPVQMVRGS |
| Ga0209701_101482051 | 3300027862 | Vadose Zone Soil | FNVSDLIYRKEQMLAPRPAHMGANVVFNQADVDGGAPAEMVPGS |
| Ga0209167_102378551 | 3300027867 | Surface Soil | ASNLVYRKEQMLAPRPAHMGANIIFNQADVDGGAPAQLVPGS |
| Ga0209579_101861031 | 3300027869 | Surface Soil | ASNLVYRKEQMLASRPAHMGANVVFNQADVDGGAPAQMVPGS |
| Ga0209283_101942222 | 3300027875 | Vadose Zone Soil | LIYRKEQMLAPRPAHMGANVVFNQADVDGGAPAEMVPGS |
| Ga0209590_100114331 | 3300027882 | Vadose Zone Soil | NASNLIYRKEQLLAAVPAHLGANAVFNRAEVEGGATAVPVPGS |
| Ga0209380_100047401 | 3300027889 | Soil | FNASNLVYRKEQMLAPRPAHMGANAVFNQAEVAAGGPAVPVPGS |
| Ga0209168_100985532 | 3300027986 | Surface Soil | NASNLIYRKEQMLASRPAHMGANVVFNQADVDGGAPKEMVAGS |
| Ga0137415_102883592 | 3300028536 | Vadose Zone Soil | FSASNLIYRKEQMLAPRPAHMGANAVFNQADVDGGAPAEMVPGS |
| Ga0302166_100621962 | 3300028652 | Fen | VYRKEQLLSIAPAHLGANAVFTGTETAGAAPPQLSSGS |
| Ga0302224_101408101 | 3300028759 | Palsa | SNLVYRKEQMLAPRPAHMGANVVFNQADVDGGAPAEMVAGS |
| Ga0302143_11130981 | 3300029918 | Bog | LVYRKEQMLAARPAHMGANAVFNQADVDGGAPKEMVAGS |
| Ga0311360_109005421 | 3300030339 | Bog | SFNAGGLVYRKEQMLAAVPAHMGANAVFNAAEVQGDQAPAFPVPGS |
| Ga0302184_101782632 | 3300030490 | Palsa | FNASNLVYRKEQMLASRPAHMGANVVFNQADVDGGAPKEMVAGS |
| Ga0316363_100044547 | 3300030659 | Peatlands Soil | NLVYRKEQMLAPRPAHMGANVIFNQADVDGGAPAQMVPGS |
| Ga0310038_104995742 | 3300030707 | Peatlands Soil | ASNLVYRKEQMLAPRPAHMGANVIFNQADVDGGAPAQMVPGS |
| Ga0073994_100571401 | 3300030991 | Soil | LASFNVTDLIYRKEQMLAPRPAHMGANVVFNQADVDGGAPAEMVPGS |
| (restricted) Ga0255311_10480881 | 3300031150 | Sandy Soil | IASFNASNLVYRKEQMLAPMPAHMGAGAVFNRDEVAAGVPSLPLQGS |
| Ga0170824_1196123061 | 3300031231 | Forest Soil | NASNLVYRKEQMLAPRPAHMGANVIFNQADVDGGAPAQMVPGS |
| Ga0302324_1004062674 | 3300031236 | Palsa | NLVYRKEQMLAAKPAHMGANAVFNQDEVATGAPSLPVPGS |
| Ga0302324_1017307101 | 3300031236 | Palsa | SNLVYRKEQMLASRPAHMGANVVFNQADVDGGAPAQMVAGS |
| Ga0265339_100484581 | 3300031249 | Rhizosphere | NLVYRKEQMLAPAPAHMGANQVFAKSESDLGAPTDVVPGS |
| Ga0170820_153910461 | 3300031446 | Forest Soil | FFFFIRKEQMLATRPAHMGANVVFNQADVAGGAPAEMVPGS |
| Ga0170819_135132651 | 3300031469 | Forest Soil | ASNLIYRKEQMLATRPAHMGANVVFNQADVAGGAPAEMVPGS |
| Ga0170818_1025391832 | 3300031474 | Forest Soil | YRKEQMLAPRPAHMGANIVFNQADVDGGAPTEMVPGS |
| Ga0170818_1036752562 | 3300031474 | Forest Soil | SFNASNLVYRKEQMLAPRPAHMGANIVFNQADVDGGAPTEMVPGS |
| Ga0170818_1112672571 | 3300031474 | Forest Soil | LVYRKEQMLAPRPAHMGANVIFNQADVDGGAPAQMVPGS |
| Ga0310686_1101090245 | 3300031708 | Soil | FNASNLVYRKEQMLAPRPAHMGANAVFNQAEVAAGAPAVPVPGS |
| Ga0310686_1178471792 | 3300031708 | Soil | NASNLVYRKEQMLAARPAHMGANAVFNQADVDGGAPKEMVAGS |
| Ga0307476_101600502 | 3300031715 | Hardwood Forest Soil | YRKEQMLAPRPAHMGANVVFNQADVDGGAPKEMVAGS |
| Ga0307476_109242032 | 3300031715 | Hardwood Forest Soil | ASFNASNLVYRKEQMLAPRPAHMGANIVFNQADVDGGAPTEMVPGS |
| Ga0307476_111212301 | 3300031715 | Hardwood Forest Soil | NASNLVYRKEQMLAPRPAHMGANIVFNQADVDGGAPTEMVPGS |
| Ga0310813_116682331 | 3300031716 | Soil | YRKEQMLAPTPAHIGANVVFNQAEIAGGAPAVPAPGE |
| Ga0310813_121960161 | 3300031716 | Soil | IATFNASALIYRKEQMLAPTPAHIGANVVFNQAEVAGGAPAVPAPGE |
| Ga0307474_101016071 | 3300031718 | Hardwood Forest Soil | NLVYRKEQMLAARPAHMGANVVFNQADVDGGAPKEMVTGS |
| Ga0307475_103412642 | 3300031754 | Hardwood Forest Soil | SNLIFRKEQMLAAAPAHMGANAVFNSADVAGGAPALPVQGS |
| Ga0307478_107575771 | 3300031823 | Hardwood Forest Soil | RKEQMLAARPAHMGANVVFNQADVDGGAPKEMVTGS |
| Ga0307478_110948021 | 3300031823 | Hardwood Forest Soil | NLVYRKEQMLAPRPAHMGENVIFNQADVDGGAPAQMVAGS |
| Ga0318544_103680321 | 3300031880 | Soil | SNLIMRKEDMLATAPAHLGANIVFNNMEVEAGAPVLPSPQGT |
| Ga0306923_103426481 | 3300031910 | Soil | ASNLVYRKEQMLAPRPAHMGANIVFNQADVNGGAPTEMVPGS |
| Ga0310912_101501821 | 3300031941 | Soil | TNLVYRKEQLLAARPGHLGANAIFNQAEVAGGAPALPAPGS |
| Ga0310912_113409092 | 3300031941 | Soil | NASNLVYRKEQMLAPRPAHMGANIVFNQADVNGGAPTEMVPGS |
| Ga0307479_102203932 | 3300031962 | Hardwood Forest Soil | SFNASDLVYRKEQMLAPMPAHMGANAVFNRDEVAAGAPSLPVQGS |
| Ga0307479_102569911 | 3300031962 | Hardwood Forest Soil | YRKEQMLAPRPAHMGANVIFNQADVDGGAPAQMVPGS |
| Ga0310911_100419522 | 3300032035 | Soil | LVMRKEQMLAAAPAHMGANAVFSSTDVATGAPALPVQGS |
| Ga0318533_101957762 | 3300032059 | Soil | ATFNVSDLVMRKEQMLAAAPAHMGANAVFSSTDVATGAPALPVQGS |
| Ga0307471_1011996441 | 3300032180 | Hardwood Forest Soil | FELASFNATDLIYRKEQMLAAAPAHMGANAVFNSADVAGGAPALPVQGS |
| Ga0307471_1018953161 | 3300032180 | Hardwood Forest Soil | VDLVYRKEQMLAAVPAHMGANAVFNRAEVAAGAPAAPVPGS |
| Ga0307471_1038821081 | 3300032180 | Hardwood Forest Soil | IYRKEQMLAAAPAHMGANAVFNSADVAGGAPALPIQGS |
| Ga0307472_1018631841 | 3300032205 | Hardwood Forest Soil | TFSASNLIYRKEQMLAPRPAHMGANAVFNQADVDGGAPAEMVPGS |
| Ga0335078_100602974 | 3300032805 | Soil | NASSLIYRKEQMLAPRPAHMGANSIFNQAEVAGGAPAVPVPGS |
| Ga0335078_101965521 | 3300032805 | Soil | NLVMRKEQMLAPRPAHMGANIEFNQADVNGGAPAELVPGA |
| Ga0335078_110863441 | 3300032805 | Soil | LVMRKEQMLAPRPAHMGANIEFNQADVNGGAPAELVPGA |
| Ga0335069_102535152 | 3300032893 | Soil | TLNASNLVYRKEQLLAPLPAHLGANAVFNKAEVSKGMPALTS |
| Ga0335071_100957582 | 3300032897 | Soil | NASNLVMRKEQMLAPRPAHMGANIIFNQADVDGGAPAQLVPGS |
| Ga0335084_102046072 | 3300033004 | Soil | LVYRKEQLLSIAPAHLGANAVFNGAESEGGAPAQMIQGS |
| Ga0335077_1000795313 | 3300033158 | Soil | RKEQLLAPKPAHMGANPVFNQAEVAGGAPATPIQGS |
| ⦗Top⦘ |