Metagenome / Metatranscriptome Family F012237

Overview

Basic Information

• Family ID: F012237
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 282
• Average Sequence Length: 39 residues
• Representative Sequence: LPNQRLKLSARGGRLIGKRSVLSAAAAGRSLSAIR
• Number of Associated Samples: 124
• Number of Associated Scaffolds: 275

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 36.79 %
• % of genes near scaffold ends (potentially truncated): 62.77 %
• % of genes from short scaffolds (< 2000 bps): 68.44 %
• Associated GOLD sequencing projects: 113
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.24

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (55.674 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (44.326 % of family members)
• Environment Ontology (ENVO): Unclassified (26.241 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (57.801 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Fibrous
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 25.40%
  β-sheet: 0.00%
  Coil/Unstructured: 74.60%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 275 Family Scaffolds
PF14534	DUF4440	2.91
PF00903	Glyoxalase	1.82
PF15580	Imm53	1.82
PF10077	DUF2314	1.45
PF03544	TonB_C	1.09
PF04229	GrpB	1.09
PF01872	RibD_C	1.09
PF08734	GYD	1.09
PF13711	DUF4160	0.73
PF15589	Imm21	0.73
PF13924	Lipocalin_5	0.73
PF07927	HicA_toxin	0.73
PF10387	DUF2442	0.73
PF09720	Unstab_antitox	0.73
PF09346	SMI1_KNR4	0.73
PF13620	CarboxypepD_reg	0.73
PF04072	LCM	0.73
PF13476	AAA_23	0.73
PF15631	Imm-NTF2-2	0.73
PF12680	SnoaL_2	0.73
PF13474	SnoaL_3	0.73
PF12681	Glyoxalase_2	0.36
PF08592	Anthrone_oxy	0.36
PF14499	DUF4437	0.36
PF13455	MUG113	0.36
PF05076	SUFU	0.36
PF09932	DUF2164	0.36
PF13787	HXXEE	0.36
PF09413	DUF2007	0.36
PF00248	Aldo_ket_red	0.36
PF13414	TPR_11	0.36
PF13551	HTH_29	0.36
PF06348	DUF1059	0.36
PF00717	Peptidase_S24	0.36
PF00144	Beta-lactamase	0.36
PF10012	DUF2255	0.36
PF13936	HTH_38	0.36
PF13683	rve_3	0.36
PF08974	DUF1877	0.36
PF06197	DUF998	0.36
PF00069	Pkinase	0.36
PF07883	Cupin_2	0.36
PF08240	ADH_N	0.36
PF04402	SIMPL	0.36
PF13184	KH_5	0.36
PF06283	ThuA	0.36
PF13365	Trypsin_2	0.36
PF01844	HNH	0.36
PF13011	LZ_Tnp_IS481	0.36
PF11066	DUF2867	0.36
PF04365	BrnT_toxin	0.36
PF06877	RraB	0.36
PF14119	DUF4288	0.36
PF11008	DUF2846	0.36
PF05117	DUF695	0.36
PF04993	TfoX_N	0.36
PF14526	Cass2	0.36
PF05016	ParE_toxin	0.36
PF12158	DUF3592	0.36
PF04343	DUF488	0.36
PF07859	Abhydrolase_3	0.36
PF13472	Lipase_GDSL_2	0.36
PF11622	DUF3251	0.36
PF07681	DoxX	0.36
PF12796	Ank_2	0.36
PF13207	AAA_17	0.36
PF08818	DUF1801	0.36
PF13826	DUF4188	0.36
PF13333	rve_2	0.36
PF13565	HTH_32	0.36
PF00589	Phage_integrase	0.36
PF06271	RDD	0.36
PF05694	SBP56	0.36
PF14300	DUF4375	0.36
PF07110	EthD	0.36
PF00005	ABC_tran	0.36

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 275 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	1.45
COG0262	Dihydrofolate reductase	Coenzyme transport and metabolism [H]	1.09
COG0810	Periplasmic protein TonB, links inner and outer membranes	Cell wall/membrane/envelope biogenesis [M]	1.09
COG1985	Pyrimidine reductase, riboflavin biosynthesis	Coenzyme transport and metabolism [H]	1.09
COG4274	Uncharacterized conserved protein, contains GYD domain	Function unknown [S]	1.09
COG2320	GrpB domain, predicted nucleotidyltransferase, UPF0157 family	General function prediction only [R]	1.09
COG1724	Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family	General function prediction only [R]	0.73
COG3315	O-Methyltransferase involved in polyketide biosynthesis	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.73
COG5649	Uncharacterized conserved protein, DUF1801 domain	Function unknown [S]	0.36
COG5646	Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)	Posttranslational modification, protein turnover, chaperones [O]	0.36
COG4813	Trehalose utilization protein	Carbohydrate transport and metabolism [G]	0.36
COG4430	Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family	Function unknown [S]	0.36
COG4270	Uncharacterized membrane protein	Function unknown [S]	0.36
COG3471	Predicted secreted (periplasmic) protein	Function unknown [S]	0.36
COG3371	Uncharacterized membrane protein	Function unknown [S]	0.36
COG3189	Uncharacterized conserved protein YeaO, DUF488 family	Function unknown [S]	0.36
COG3076	Regulator of RNase E activity RraB	Translation, ribosomal structure and biogenesis [J]	0.36
COG3070	Transcriptional regulator of competence genes, TfoX/Sxy family	Transcription [K]	0.36
COG2968	Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain	Function unknown [S]	0.36
COG2929	Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system	Defense mechanisms [V]	0.36
COG2859	Outer membrane channel-forming protein BP26/OMP28, SIMPL family	Cell wall/membrane/envelope biogenesis [M]	0.36
COG2367	Beta-lactamase class A	Defense mechanisms [V]	0.36
COG2259	Uncharacterized membrane protein YphA, DoxX/SURF4 family	Function unknown [S]	0.36
COG1714	Uncharacterized membrane protein YckC, RDD family	Function unknown [S]	0.36
COG1686	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	0.36
COG1680	CubicO group peptidase, beta-lactamase class C family	Defense mechanisms [V]	0.36
COG0657	Acetyl esterase/lipase	Lipid transport and metabolism [I]	0.36

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	56.38 %
Unclassified	root	N/A	43.62 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	56.38 %
Unclassified	root	N/A	43.62 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	55.67 %
Unclassified	root	N/A	43.62 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.35 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.35 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.62 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	9.57 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	7.45 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	4.26 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	1.42 %
Nitrospirae	phylum	All Organisms → cellular organisms → Bacteria → Nitrospirae	1.06 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	1.06 %
Euryarchaeota	phylum	All Organisms → cellular organisms → Archaea → Euryarchaeota	0.35 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.35 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → environmental samples	0.35 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.62 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	7.09 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2.84 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	1.42 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	1.42 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	1.06 %
Nitrospira	class	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira	1.06 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.71 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.71 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.71 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.71 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	0.71 %
Fungi	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi	0.35 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.35 %
unclassified Euryarchaeota	no rank	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota	0.35 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.62 %
unclassified Gemmatimonadetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes	5.67 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	1.77 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1.42 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	1.42 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1.06 %
Chloroflexia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia	1.06 %
Nitrospirales	order	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales	1.06 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.71 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.71 %
Gemmatimonadetes	class	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes	0.71 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.71 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.35 %
unclassified Gammaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria	0.35 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.35 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.35 %
Dikarya	subkingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya	0.35 %
unclassified Actinobacteria	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria	0.35 %
Longimicrobiia	class	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Longimicrobiia	0.35 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.35 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.62 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	5.67 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.77 %
Chloroflexales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales	1.06 %
Nitrospiraceae	family	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae	1.06 %
Planctomycetales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales	0.71 %
Flavobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia	0.71 %
Gemmatimonadales	order	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales	0.71 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.71 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.71 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.35 %
Ascomycota	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota	0.35 %
unclassified Bacteroidetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes	0.35 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.35 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.35 %
Pseudonocardiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales	0.35 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	0.35 %
Desulfobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	0.35 %
Chromatiales incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiales incertae sedis	0.35 %
Bacteroidetes Order II. Incertae sedis	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis	0.35 %
Actinobacteria bacterium 13_1_40CM_4_65_12	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12	0.35 %
Longimicrobiales	order	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Longimicrobiia → Longimicrobiales	0.35 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.35 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.35 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.62 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	5.67 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.77 %
Nitrospira	genus	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira	1.06 %
Chloroflexineae	suborder	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae	1.06 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	0.71 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	0.71 %
Gemmatimonadaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	0.71 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.71 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.71 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.35 %
Pseudonocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae	0.35 %
Sorangiineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae	0.35 %
Desulfobulbaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae	0.35 %
Rhodothermaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae	0.35 %
saccharomyceta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta	0.35 %
Thiohalobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiales incertae sedis → Thiohalobacter	0.35 %
Longimicrobiaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Longimicrobiia → Longimicrobiales → Longimicrobiaceae	0.35 %
Bacteroidetes bacterium 13_1_20CM_4_60_6	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6	0.35 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.35 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.35 %
Actinobacteria bacterium 13_1_40CM_4_65_12	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12	0.35 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.35 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.35 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.62 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	5.67 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.77 %
Oscillochloridaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae	1.06 %
unclassified Nitrospira	no rank	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira	1.06 %
Flavobacteriaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	0.71 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.71 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.71 %
Polyangiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae	0.35 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	0.35 %
Kutzneria	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria	0.35 %
Salinibacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter	0.35 %
Pezizomycotina	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina	0.35 %
unclassified Desulfobulbaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae	0.35 %
unclassified Gemmatimonadaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae	0.35 %
Rubinisphaera	genus	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera	0.35 %
Gemmatirosa	genus	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa	0.35 %
Longimicrobium	genus	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Longimicrobiia → Longimicrobiales → Longimicrobiaceae → Longimicrobium	0.35 %
unclassified Thiohalobacter	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiales incertae sedis → Thiohalobacter → unclassified Thiohalobacter	0.35 %
Bacteroidetes bacterium 13_1_20CM_4_60_6	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6	0.35 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.35 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.35 %
Actinobacteria bacterium 13_1_40CM_4_65_12	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12	0.35 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.35 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.35 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.62 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	5.67 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.77 %
Oscillochloris	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Oscillochloris	1.06 %
Nitrospira sp. ST-bin5	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. ST-bin5	1.06 %
Flavobacterium	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium	0.71 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.71 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.71 %
unclassified Polyangiaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae	0.35 %
Salinibacter ruber	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	0.35 %
leotiomyceta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta	0.35 %
Gemmatirosa kalamazoonesis	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	0.35 %
Longimicrobium terrae	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Longimicrobiia → Longimicrobiales → Longimicrobiaceae → Longimicrobium → Longimicrobium terrae	0.35 %
Desulfobulbaceae bacterium A2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium A2	0.35 %
Gemmatimonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	0.35 %
Rubinisphaera italica	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera → Rubinisphaera italica	0.35 %
unclassified Kutzneria	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria	0.35 %
Thiohalobacter sp. COW1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiales incertae sedis → Thiohalobacter → unclassified Thiohalobacter → Thiohalobacter sp. COW1	0.35 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	0.35 %
Bacteroidetes bacterium 13_1_20CM_4_60_6	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6	0.35 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.35 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.35 %
Actinobacteria bacterium 13_1_40CM_4_65_12	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12	0.35 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.35 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.35 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.62 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	5.67 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.77 %
unclassified Oscillochloris	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Oscillochloris → unclassified Oscillochloris	1.06 %
Nitrospira sp. ST-bin5	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. ST-bin5	1.06 %
Flavobacterium stagni	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium stagni	0.71 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.71 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.71 %
sordariomyceta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta	0.35 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.35 %
Kutzneria sp. CA-103260	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. CA-103260	0.35 %
Salinibacter ruber	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	0.35 %
Gemmatirosa kalamazoonesis	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	0.35 %
Longimicrobium terrae	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Longimicrobiia → Longimicrobiales → Longimicrobiaceae → Longimicrobium → Longimicrobium terrae	0.35 %
Desulfobulbaceae bacterium A2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium A2	0.35 %
Gemmatimonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	0.35 %
Rubinisphaera italica	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera → Rubinisphaera italica	0.35 %
Thiohalobacter sp. COW1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiales incertae sedis → Thiohalobacter → unclassified Thiohalobacter → Thiohalobacter sp. COW1	0.35 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	0.35 %
Bacteroidetes bacterium 13_1_20CM_4_60_6	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6	0.35 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.35 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.35 %
Actinobacteria bacterium 13_1_40CM_4_65_12	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12	0.35 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.35 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.35 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.62 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	5.67 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.77 %
Oscillochloris sp. ZM17-4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Oscillochloris → unclassified Oscillochloris → Oscillochloris sp. ZM17-4	1.06 %
Nitrospira sp. ST-bin5	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. ST-bin5	1.06 %
Flavobacterium stagni	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium stagni	0.71 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.71 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.71 %
Leotiomycetes	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes	0.35 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.35 %
Kutzneria sp. CA-103260	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. CA-103260	0.35 %
Salinibacter ruber	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	0.35 %
Gemmatirosa kalamazoonesis	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	0.35 %
Longimicrobium terrae	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Longimicrobiia → Longimicrobiales → Longimicrobiaceae → Longimicrobium → Longimicrobium terrae	0.35 %
Desulfobulbaceae bacterium A2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium A2	0.35 %
Gemmatimonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	0.35 %
Rubinisphaera italica	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera → Rubinisphaera italica	0.35 %
Thiohalobacter sp. COW1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiales incertae sedis → Thiohalobacter → unclassified Thiohalobacter → Thiohalobacter sp. COW1	0.35 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	0.35 %
Bacteroidetes bacterium 13_1_20CM_4_60_6	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6	0.35 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.35 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.35 %
Actinobacteria bacterium 13_1_40CM_4_65_12	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12	0.35 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.35 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.35 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.62 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	5.67 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.77 %
Oscillochloris sp. ZM17-4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Oscillochloris → unclassified Oscillochloris → Oscillochloris sp. ZM17-4	1.06 %
Nitrospira sp. ST-bin5	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. ST-bin5	1.06 %
Flavobacterium stagni	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium stagni	0.71 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.71 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.71 %
Helotiales	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales	0.35 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.35 %
Kutzneria sp. CA-103260	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. CA-103260	0.35 %
Salinibacter ruber	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	0.35 %
Gemmatirosa kalamazoonesis	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	0.35 %
Longimicrobium terrae	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Longimicrobiia → Longimicrobiales → Longimicrobiaceae → Longimicrobium → Longimicrobium terrae	0.35 %
Desulfobulbaceae bacterium A2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium A2	0.35 %
Gemmatimonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	0.35 %
Rubinisphaera italica	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera → Rubinisphaera italica	0.35 %
Thiohalobacter sp. COW1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiales incertae sedis → Thiohalobacter → unclassified Thiohalobacter → Thiohalobacter sp. COW1	0.35 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	0.35 %
Bacteroidetes bacterium 13_1_20CM_4_60_6	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6	0.35 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.35 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.35 %
Actinobacteria bacterium 13_1_40CM_4_65_12	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12	0.35 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.35 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.35 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.62 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	5.67 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.77 %
Oscillochloris sp. ZM17-4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Oscillochloris → unclassified Oscillochloris → Oscillochloris sp. ZM17-4	1.06 %
Nitrospira sp. ST-bin5	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. ST-bin5	1.06 %
Flavobacterium stagni	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium stagni	0.71 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.71 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.71 %
Helotiales incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Helotiales incertae sedis	0.35 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.35 %
Kutzneria sp. CA-103260	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. CA-103260	0.35 %
Salinibacter ruber	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	0.35 %
Gemmatirosa kalamazoonesis	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	0.35 %
Longimicrobium terrae	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Longimicrobiia → Longimicrobiales → Longimicrobiaceae → Longimicrobium → Longimicrobium terrae	0.35 %
Desulfobulbaceae bacterium A2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium A2	0.35 %
Gemmatimonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	0.35 %
Rubinisphaera italica	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera → Rubinisphaera italica	0.35 %
Thiohalobacter sp. COW1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiales incertae sedis → Thiohalobacter → unclassified Thiohalobacter → Thiohalobacter sp. COW1	0.35 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	0.35 %
Bacteroidetes bacterium 13_1_20CM_4_60_6	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6	0.35 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.35 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.35 %
Actinobacteria bacterium 13_1_40CM_4_65_12	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12	0.35 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.35 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.35 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.62 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	5.67 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.77 %
Oscillochloris sp. ZM17-4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Oscillochloris → unclassified Oscillochloris → Oscillochloris sp. ZM17-4	1.06 %
Nitrospira sp. ST-bin5	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. ST-bin5	1.06 %
Flavobacterium stagni	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium stagni	0.71 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.71 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.71 %
Cadophora	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Helotiales incertae sedis → Cadophora	0.35 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.35 %
Kutzneria sp. CA-103260	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. CA-103260	0.35 %
Salinibacter ruber	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	0.35 %
Gemmatirosa kalamazoonesis	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	0.35 %
Longimicrobium terrae	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Longimicrobiia → Longimicrobiales → Longimicrobiaceae → Longimicrobium → Longimicrobium terrae	0.35 %
Desulfobulbaceae bacterium A2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium A2	0.35 %
Gemmatimonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	0.35 %
Rubinisphaera italica	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera → Rubinisphaera italica	0.35 %
Thiohalobacter sp. COW1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiales incertae sedis → Thiohalobacter → unclassified Thiohalobacter → Thiohalobacter sp. COW1	0.35 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	0.35 %
Bacteroidetes bacterium 13_1_20CM_4_60_6	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6	0.35 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.35 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.35 %
Actinobacteria bacterium 13_1_40CM_4_65_12	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12	0.35 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.35 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.35 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.62 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	5.67 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.77 %
Oscillochloris sp. ZM17-4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Oscillochloris → unclassified Oscillochloris → Oscillochloris sp. ZM17-4	1.06 %
Nitrospira sp. ST-bin5	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. ST-bin5	1.06 %
Flavobacterium stagni	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium stagni	0.71 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.71 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.71 %
unclassified Cadophora	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Helotiales incertae sedis → Cadophora → unclassified Cadophora	0.35 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.35 %
Kutzneria sp. CA-103260	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. CA-103260	0.35 %
Salinibacter ruber	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	0.35 %
Gemmatirosa kalamazoonesis	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	0.35 %
Longimicrobium terrae	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Longimicrobiia → Longimicrobiales → Longimicrobiaceae → Longimicrobium → Longimicrobium terrae	0.35 %
Desulfobulbaceae bacterium A2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium A2	0.35 %
Gemmatimonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	0.35 %
Rubinisphaera italica	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera → Rubinisphaera italica	0.35 %
Thiohalobacter sp. COW1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiales incertae sedis → Thiohalobacter → unclassified Thiohalobacter → Thiohalobacter sp. COW1	0.35 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	0.35 %
Bacteroidetes bacterium 13_1_20CM_4_60_6	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6	0.35 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.35 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.35 %
Actinobacteria bacterium 13_1_40CM_4_65_12	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12	0.35 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.35 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.35 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.62 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	5.67 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.77 %
Oscillochloris sp. ZM17-4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Oscillochloris → unclassified Oscillochloris → Oscillochloris sp. ZM17-4	1.06 %
Nitrospira sp. ST-bin5	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. ST-bin5	1.06 %
Flavobacterium stagni	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium stagni	0.71 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.71 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.71 %
Cadophora sp. M221	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Helotiales incertae sedis → Cadophora → unclassified Cadophora → Cadophora sp. M221	0.35 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.35 %
Kutzneria sp. CA-103260	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. CA-103260	0.35 %
Salinibacter ruber	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	0.35 %
Gemmatirosa kalamazoonesis	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	0.35 %
Longimicrobium terrae	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Longimicrobiia → Longimicrobiales → Longimicrobiaceae → Longimicrobium → Longimicrobium terrae	0.35 %
Desulfobulbaceae bacterium A2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium A2	0.35 %
Gemmatimonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	0.35 %
Rubinisphaera italica	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera → Rubinisphaera italica	0.35 %
Thiohalobacter sp. COW1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiales incertae sedis → Thiohalobacter → unclassified Thiohalobacter → Thiohalobacter sp. COW1	0.35 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	0.35 %
Bacteroidetes bacterium 13_1_20CM_4_60_6	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6	0.35 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.35 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.35 %
Actinobacteria bacterium 13_1_40CM_4_65_12	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12	0.35 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.35 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.35 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300002911|JGI25390J43892_10122962	All Organisms → cellular organisms → Bacteria	594
3300005176|Ga0066679_10657176	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Oscillochloris → unclassified Oscillochloris → Oscillochloris sp. ZM17-4	682
3300005180|Ga0066685_10689225	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	701
3300005446|Ga0066686_10296281	All Organisms → cellular organisms → Bacteria → Proteobacteria	1098
3300005447|Ga0066689_10353561	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	916
3300005555|Ga0066692_10379869	All Organisms → cellular organisms → Bacteria	895
3300005557|Ga0066704_10121362	All Organisms → cellular organisms → Bacteria	1733
3300005559|Ga0066700_10042572	All Organisms → cellular organisms → Bacteria	2744
3300005559|Ga0066700_10124749	All Organisms → cellular organisms → Bacteria	1717
3300005561|Ga0066699_10189590	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1426
3300005568|Ga0066703_10505817	All Organisms → cellular organisms → Bacteria	716
3300005569|Ga0066705_10004038	All Organisms → cellular organisms → Bacteria	6125
3300005569|Ga0066705_10008148	All Organisms → cellular organisms → Bacteria	4802
3300005575|Ga0066702_10527754	Not Available	716
3300005575|Ga0066702_10549107	Not Available	698
3300005586|Ga0066691_10190807	All Organisms → cellular organisms → Bacteria	1190
3300005586|Ga0066691_10195644	Not Available	1176
3300005598|Ga0066706_10076923	All Organisms → cellular organisms → Bacteria	2354
3300005833|Ga0074472_10832079	Not Available	539
3300005875|Ga0075293_1079727	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	500
3300005876|Ga0075300_1074015	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	517
3300005886|Ga0075286_1012971	All Organisms → cellular organisms → Bacteria	999
3300006032|Ga0066696_11114059	All Organisms → cellular organisms → Bacteria	502
3300006046|Ga0066652_100816071	All Organisms → cellular organisms → Bacteria	892
3300006049|Ga0075417_10027313	All Organisms → cellular organisms → Bacteria	2335
3300006049|Ga0075417_10107768	All Organisms → cellular organisms → Bacteria	1268
3300006049|Ga0075417_10221995	Not Available	900
3300006049|Ga0075417_10228890	Not Available	887
3300006049|Ga0075417_10228890	Not Available	887
3300006049|Ga0075417_10386140	Not Available	691
3300006049|Ga0075417_10540025	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium A2	589
3300006194|Ga0075427_10104803	All Organisms → cellular organisms → Bacteria	529
3300006577|Ga0074050_11288055	Not Available	584
3300006794|Ga0066658_10430762	Not Available	718
3300006796|Ga0066665_10057744	All Organisms → cellular organisms → Bacteria	2702
3300006796|Ga0066665_10134766	All Organisms → cellular organisms → Bacteria	1857
3300006797|Ga0066659_11082113	All Organisms → cellular organisms → Bacteria	670
3300006797|Ga0066659_11185294	Not Available	638
3300006800|Ga0066660_10279038	Not Available	1323
3300006800|Ga0066660_10413309	Not Available	1117
3300006800|Ga0066660_10452636	All Organisms → cellular organisms → Bacteria	1073
3300006844|Ga0075428_100173156	All Organisms → cellular organisms → Bacteria	2339
3300006844|Ga0075428_100261748	All Organisms → cellular organisms → Bacteria → Proteobacteria	1862
3300006844|Ga0075428_100298734	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera → Rubinisphaera italica	1731
3300006844|Ga0075428_100613611	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	1161
3300006844|Ga0075428_100920790	Not Available	927
3300006844|Ga0075428_101022340	Not Available	874
3300006844|Ga0075428_102287349	Not Available	556
3300006844|Ga0075428_102420983	Not Available	539
3300006845|Ga0075421_100046642	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	5491
3300006845|Ga0075421_100094669	All Organisms → cellular organisms → Bacteria	3761
3300006845|Ga0075421_100094669	All Organisms → cellular organisms → Bacteria	3761
3300006845|Ga0075421_100163152	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	2780
3300006845|Ga0075421_100177218	Not Available	2652
3300006845|Ga0075421_100201349	All Organisms → cellular organisms → Bacteria → FCB group	2464
3300006845|Ga0075421_100670324	Not Available	1209
3300006845|Ga0075421_100729368	Not Available	1149
3300006845|Ga0075421_101071684	Not Available	907
3300006845|Ga0075421_101244374	All Organisms → cellular organisms → Bacteria	827
3300006846|Ga0075430_100801788	All Organisms → cellular organisms → Bacteria → Proteobacteria	776
3300006847|Ga0075431_100051413	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	4249
3300006847|Ga0075431_100081948	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	3331
3300006847|Ga0075431_100129646	All Organisms → cellular organisms → Bacteria	2602
3300006847|Ga0075431_100190083	Not Available	2104
3300006847|Ga0075431_100929302	Not Available	839
3300006847|Ga0075431_101266834	All Organisms → cellular organisms → Bacteria	699
3300006847|Ga0075431_101878623	Not Available	555
3300006852|Ga0075433_10085998	All Organisms → cellular organisms → Bacteria	2776
3300006852|Ga0075433_10116883	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. CA-103260	2366
3300006852|Ga0075433_10160358	Not Available	2001
3300006852|Ga0075433_10188693	Not Available	1834
3300006852|Ga0075433_10365809	Not Available	1274
3300006852|Ga0075433_10449190	Not Available	1136
3300006852|Ga0075433_10483710	Not Available	1090
3300006852|Ga0075433_11508734	All Organisms → cellular organisms → Bacteria	580
3300006852|Ga0075433_11915523	All Organisms → cellular organisms → Bacteria	508
3300006854|Ga0075425_100367586	Not Available	1656
3300006871|Ga0075434_100023960	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	5959
3300006871|Ga0075434_100050888	Not Available	4115
3300006871|Ga0075434_100062617	All Organisms → cellular organisms → Bacteria	3703
3300006871|Ga0075434_100090536	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	3060
3300006871|Ga0075434_100113995	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2716
3300006871|Ga0075434_100148581	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12	2363
3300006871|Ga0075434_100181770	Not Available	2123
3300006871|Ga0075434_100200488	Not Available	2015
3300006871|Ga0075434_100240006	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1832
3300006871|Ga0075434_100481270	All Organisms → cellular organisms → Bacteria	1262
3300006871|Ga0075434_101241947	Not Available	757
3300006880|Ga0075429_100051664	Not Available	3576
3300006880|Ga0075429_100051664	Not Available	3576
3300006880|Ga0075429_100078980	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Oscillochloris → unclassified Oscillochloris → Oscillochloris sp. ZM17-4	2868
3300006880|Ga0075429_100107861	Not Available	2433
3300006880|Ga0075429_100133657	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Longimicrobiia → Longimicrobiales → Longimicrobiaceae → Longimicrobium → Longimicrobium terrae	2170
3300006880|Ga0075429_100395835	Not Available	1209
3300006880|Ga0075429_100592070	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	972
3300006880|Ga0075429_100717851	Not Available	875
3300006880|Ga0075429_101202323	Not Available	662
3300006904|Ga0075424_100053346	All Organisms → cellular organisms → Bacteria → Proteobacteria	4225
3300006904|Ga0075424_100053346	All Organisms → cellular organisms → Bacteria → Proteobacteria	4225
3300006904|Ga0075424_102511631	Not Available	539
3300006969|Ga0075419_10099154	All Organisms → cellular organisms → Bacteria	1871
3300006969|Ga0075419_10396688	All Organisms → cellular organisms → Bacteria	945
3300006969|Ga0075419_10588820	Not Available	780
3300006969|Ga0075419_11010500	All Organisms → cellular organisms → Bacteria	605
3300007255|Ga0099791_10570397	Not Available	552
3300009012|Ga0066710_100033270	All Organisms → cellular organisms → Bacteria	6055
3300009012|Ga0066710_100462698	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1904
3300009012|Ga0066710_101028265	Not Available	1272
3300009090|Ga0099827_10414821	All Organisms → cellular organisms → Bacteria	1152
3300009100|Ga0075418_10745125	Not Available	1057
3300009100|Ga0075418_11485625	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiales incertae sedis → Thiohalobacter → unclassified Thiohalobacter → Thiohalobacter sp. COW1	735
3300009100|Ga0075418_12472100	Not Available	567
3300009137|Ga0066709_100583086	All Organisms → cellular organisms → Bacteria	1590
3300009137|Ga0066709_102982133	Not Available	622
3300009147|Ga0114129_10078153	All Organisms → cellular organisms → Bacteria	4603
3300009147|Ga0114129_10143751	All Organisms → cellular organisms → Bacteria	3268
3300009147|Ga0114129_10154594	All Organisms → cellular organisms → Bacteria	3138
3300009147|Ga0114129_10172029	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	2952
3300009147|Ga0114129_10199878	Not Available	2708
3300009147|Ga0114129_10274392	All Organisms → cellular organisms → Bacteria	2255
3300009147|Ga0114129_10287012	Not Available	2197
3300009147|Ga0114129_10298283	All Organisms → cellular organisms → Bacteria	2149
3300009147|Ga0114129_10374651	All Organisms → cellular organisms → Bacteria	1881
3300009147|Ga0114129_10434076	Not Available	1725
3300009147|Ga0114129_10515699	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1559
3300009147|Ga0114129_10554029	Not Available	1495
3300009147|Ga0114129_10633661	All Organisms → cellular organisms → Bacteria	1381
3300009147|Ga0114129_10676228	All Organisms → cellular organisms → Bacteria	1329
3300009147|Ga0114129_10677983	Not Available	1327
3300009147|Ga0114129_10948057	Not Available	1087
3300009147|Ga0114129_11031866	Not Available	1034
3300009147|Ga0114129_11210275	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	940
3300009147|Ga0114129_11234543	All Organisms → cellular organisms → Bacteria	929
3300009147|Ga0114129_11716202	All Organisms → cellular organisms → Bacteria	766
3300009147|Ga0114129_11791493	All Organisms → cellular organisms → Bacteria	747
3300009147|Ga0114129_12152490	Not Available	672
3300009147|Ga0114129_12153925	Not Available	672
3300009147|Ga0114129_12883113	Not Available	569
3300009147|Ga0114129_12921796	Not Available	564
3300009147|Ga0114129_12934866	Not Available	563
3300009147|Ga0114129_13018254	Not Available	553
3300009162|Ga0075423_10035053	All Organisms → cellular organisms → Bacteria	5106
3300009162|Ga0075423_10055431	Not Available	4091
3300009162|Ga0075423_10094819	All Organisms → cellular organisms → Bacteria	3119
3300009162|Ga0075423_10367162	All Organisms → cellular organisms → Bacteria	1510
3300009162|Ga0075423_12707317	Not Available	543
3300010046|Ga0126384_12343845	Not Available	516
3300010336|Ga0134071_10124830	All Organisms → cellular organisms → Bacteria	1239
3300010362|Ga0126377_11208772	Not Available	826
3300010403|Ga0134123_11631852	All Organisms → cellular organisms → Bacteria	693
3300011271|Ga0137393_11739481	All Organisms → cellular organisms → Bacteria	512
3300011444|Ga0137463_1115418	Not Available	1010
3300012199|Ga0137383_10126010	Not Available	1869
3300012200|Ga0137382_10097321	All Organisms → cellular organisms → Bacteria	1936
3300012201|Ga0137365_10232612	Not Available	1373
3300012203|Ga0137399_10554683	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	965
3300012204|Ga0137374_10012363	All Organisms → cellular organisms → Bacteria	9948
3300012204|Ga0137374_10109657	Not Available	2574
3300012204|Ga0137374_10303302	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. ST-bin5	1309
3300012204|Ga0137374_10303302	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. ST-bin5	1309
3300012205|Ga0137362_10355339	Not Available	1269
3300012206|Ga0137380_10031472	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	4891
3300012207|Ga0137381_10085995	All Organisms → cellular organisms → Bacteria	2648
3300012207|Ga0137381_10101702	All Organisms → cellular organisms → Bacteria	2438
3300012207|Ga0137381_10721780	Not Available	866
3300012210|Ga0137378_10488692	Not Available	1137
3300012225|Ga0137434_1025231	Not Available	806
3300012349|Ga0137387_10149780	Not Available	1660
3300012350|Ga0137372_10398996	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1042
3300012353|Ga0137367_10094788	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. ST-bin5	2202
3300012353|Ga0137367_11215450	Not Available	503
3300012355|Ga0137369_10678332	Not Available	710
3300012360|Ga0137375_10355887	Not Available	1297
3300012363|Ga0137390_10114377	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	2671
3300012532|Ga0137373_10064348	All Organisms → cellular organisms → Bacteria → Proteobacteria	3342
3300012532|Ga0137373_10223337	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1536
3300012685|Ga0137397_11088949	All Organisms → cellular organisms → Bacteria → Acidobacteria	583
3300012923|Ga0137359_11651414	Not Available	528
3300012929|Ga0137404_12010731	Not Available	539
3300012931|Ga0153915_10254020	All Organisms → cellular organisms → Bacteria → Proteobacteria	1949
3300012931|Ga0153915_12811837	All Organisms → cellular organisms → Bacteria	568
3300012931|Ga0153915_13104927	All Organisms → cellular organisms → Bacteria → Proteobacteria	540
3300012972|Ga0134077_10378770	Not Available	608
3300014873|Ga0180066_1006131	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium stagni	1923
3300015241|Ga0137418_10039775	All Organisms → cellular organisms → Bacteria	4337
3300017656|Ga0134112_10281283	Not Available	665
3300017659|Ga0134083_10015944	All Organisms → cellular organisms → Bacteria	2595
3300018053|Ga0184626_10288883	Not Available	682
3300018068|Ga0184636_1211325	All Organisms → cellular organisms → Bacteria → Proteobacteria	689
3300018079|Ga0184627_10392996	Not Available	723
3300018079|Ga0184627_10586564	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6	562
3300018082|Ga0184639_10484789	All Organisms → cellular organisms → Bacteria	627
3300018084|Ga0184629_10607685	Not Available	557
3300018084|Ga0184629_10705192	Not Available	508
3300018431|Ga0066655_10011455	All Organisms → cellular organisms → Bacteria	3861
3300018433|Ga0066667_11386532	Not Available	617
3300018468|Ga0066662_10070444	All Organisms → cellular organisms → Bacteria	2338
3300018482|Ga0066669_10222788	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1466
3300019360|Ga0187894_10501355	Not Available	526
3300019458|Ga0187892_10245878	Not Available	922
3300019458|Ga0187892_10329187	Not Available	750
3300019458|Ga0187892_10390793	Not Available	665
3300020022|Ga0193733_1067029	All Organisms → cellular organisms → Bacteria → Proteobacteria	1009
3300021081|Ga0210379_10259813	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	755
3300025922|Ga0207646_11246572	Not Available	651
3300026295|Ga0209234_1014562	All Organisms → cellular organisms → Bacteria	2976
3300026309|Ga0209055_1002512	All Organisms → cellular organisms → Bacteria	11557
3300026309|Ga0209055_1025051	All Organisms → cellular organisms → Bacteria	2805
3300026312|Ga0209153_1085481	All Organisms → cellular organisms → Bacteria	1167
3300026318|Ga0209471_1004019	All Organisms → cellular organisms → Bacteria	8196
3300026318|Ga0209471_1263810	All Organisms → cellular organisms → Bacteria	582
3300026328|Ga0209802_1134035	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1070
3300026333|Ga0209158_1282583	All Organisms → cellular organisms → Bacteria → Proteobacteria	570
3300026343|Ga0209159_1135487	All Organisms → cellular organisms → Bacteria	1004
3300026532|Ga0209160_1220160	Not Available	669
3300026538|Ga0209056_10008251	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	10682
3300026550|Ga0209474_10079518	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	2256
3300026552|Ga0209577_10252122	Not Available	1331
3300027187|Ga0209869_1013187	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	909
3300027846|Ga0209180_10013312	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	4286
3300027873|Ga0209814_10024261	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2477
3300027873|Ga0209814_10031317	Not Available	2190
3300027873|Ga0209814_10032980	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	2137
3300027873|Ga0209814_10122695	Not Available	1108
3300027873|Ga0209814_10189769	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	887
3300027873|Ga0209814_10445545	Not Available	571
3300027875|Ga0209283_10633953	All Organisms → cellular organisms → Bacteria	674
3300027880|Ga0209481_10075137	Not Available	1603
3300027880|Ga0209481_10111433	All Organisms → cellular organisms → Bacteria	1329
3300027880|Ga0209481_10379945	Not Available	723
3300027880|Ga0209481_10442261	Not Available	669
3300027880|Ga0209481_10688195	Not Available	531
3300027882|Ga0209590_10221241	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1202
3300027903|Ga0209488_10452336	All Organisms → cellular organisms → Bacteria	946
3300027909|Ga0209382_10019267	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	8302
3300027909|Ga0209382_10085229	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	3718
3300027909|Ga0209382_10111940	All Organisms → cellular organisms → Bacteria	3189
3300027909|Ga0209382_10151088	Not Available	2690
3300027909|Ga0209382_10171997	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Oscillochloris → unclassified Oscillochloris → Oscillochloris sp. ZM17-4	2498
3300027909|Ga0209382_10506872	All Organisms → cellular organisms → Bacteria → FCB group	1328
3300027909|Ga0209382_11277101	Not Available	746
3300028536|Ga0137415_10070273	All Organisms → cellular organisms → Bacteria	3363
3300028536|Ga0137415_11362548	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Helotiales incertae sedis → Cadophora → unclassified Cadophora → Cadophora sp. M221	530
3300028803|Ga0307281_10433640	Not Available	506
3300031949|Ga0214473_10993118	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium stagni	887
3300032770|Ga0335085_10035904	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	6843
3300032770|Ga0335085_10035904	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	6843
3300032770|Ga0335085_10141816	Not Available	3029
3300032770|Ga0335085_10152671	All Organisms → cellular organisms → Bacteria	2894
3300032770|Ga0335085_10193472	Not Available	2499
3300032770|Ga0335085_10615893	Not Available	1219
3300032770|Ga0335085_10624958	Not Available	1208
3300032770|Ga0335085_12281985	Not Available	542
3300032782|Ga0335082_10330345	Not Available	1394
3300032782|Ga0335082_10374147	All Organisms → cellular organisms → Bacteria	1290
3300032782|Ga0335082_10947587	Not Available	724
3300032782|Ga0335082_11087506	Not Available	665
3300032782|Ga0335082_11551141	Not Available	534
3300033412|Ga0310810_11414198	Not Available	529
3300033412|Ga0310810_11414198	Not Available	529
3300033433|Ga0326726_10009306	All Organisms → cellular organisms → Bacteria	8712
3300033433|Ga0326726_10065187	All Organisms → cellular organisms → Bacteria	3208
3300033433|Ga0326726_10363720	All Organisms → cellular organisms → Bacteria	1367
3300033433|Ga0326726_10742337	Not Available	948
3300033433|Ga0326726_11293898	Not Available	709
3300033433|Ga0326726_11705762	All Organisms → cellular organisms → Bacteria	613
3300033500|Ga0326730_1012288	Not Available	1865
3300033513|Ga0316628_101718877	Not Available	835
3300033811|Ga0364924_004058	All Organisms → cellular organisms → Bacteria	2559
3300033811|Ga0364924_007166	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	2005
3300033812|Ga0364926_140997	All Organisms → cellular organisms → Bacteria	514
3300034090|Ga0326723_0010760	All Organisms → cellular organisms → Bacteria	3593
3300034090|Ga0326723_0014398	All Organisms → cellular organisms → Bacteria	3165
3300034090|Ga0326723_0155540	All Organisms → cellular organisms → Bacteria → Proteobacteria	1005
3300034090|Ga0326723_0284453	Not Available	740
3300034090|Ga0326723_0434491	Not Available	598
3300034165|Ga0364942_0125895	All Organisms → cellular organisms → Bacteria → FCB group	833
3300034773|Ga0364936_001106	All Organisms → cellular organisms → Bacteria → Proteobacteria	3665
3300034773|Ga0364936_120481	Not Available	527
3300034817|Ga0373948_0053954	Not Available	869

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	55.32%
Host-Associated	Host-Associated	44.68%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	50.00%
Plants	Host-Associated → Plants	44.68%
Aquatic	Environmental → Aquatic	5.32%

Category

Habitat	Taxonomy	Distribution
Rhizosphere	Host-Associated → Plants → Rhizosphere	44.68%
Soil	Environmental → Terrestrial → Soil	42.20%
Peat	Environmental → Terrestrial → Peat	4.26%
Sediment	Environmental → Aquatic → Sediment	3.90%
Floodplain	Environmental → Terrestrial → Floodplain	2.13%
Freshwater	Environmental → Aquatic → Freshwater	1.42%
Cave	Environmental → Terrestrial → Cave	1.42%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	44.33%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	35.46%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	6.03%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	4.26%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.90%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	2.13%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	1.42%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.06%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.35%
Loam	Environmental → Terrestrial → Soil → Loam	0.35%
Sand	Environmental → Terrestrial → Soil → Sand	0.35%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.35%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	44.33%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	17.73%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	17.38%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	6.03%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	4.26%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.90%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	2.13%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	1.42%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	1.06%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.35%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.35%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.35%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.35%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.35%

Habitat

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	44.33%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	13.83%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	13.12%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	4.96%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	4.26%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	3.90%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	2.48%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	2.13%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.42%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.42%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	1.06%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	1.06%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	1.06%
Bio-Ooze	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze	1.06%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.71%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.35%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.35%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.35%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.35%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.35%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.35%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.35%
Microbial Mat On Rocks	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks	0.35%
Rhizosphere Soil	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil	0.35%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300002911	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm	Environmental
3300005176	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128	Environmental
3300005180	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134	Environmental
3300005446	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135	Environmental
3300005447	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138	Environmental
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental
3300005557	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153	Environmental
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental
3300005561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148	Environmental
3300005568	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152	Environmental
3300005569	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154	Environmental
3300005575	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151	Environmental
3300005586	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140	Environmental
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental
3300005833	Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK	Environmental
3300005875	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101	Environmental
3300005876	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401	Environmental
3300005886	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205	Environmental
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated
3300006194	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1	Host-Associated
3300006577	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)	Environmental
3300006794	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107	Environmental
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental
3300010336	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015	Environmental
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental
3300011444	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2	Environmental
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental
3300012225	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2	Environmental
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental
3300012355	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG	Environmental
3300012360	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG	Environmental
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental
3300012532	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG	Environmental
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental
3300012972	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG	Environmental
3300014873	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D	Environmental
3300015241	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)	Environmental
3300017656	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015	Environmental
3300017659	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG	Environmental
3300018053	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1	Environmental
3300018068	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2	Environmental
3300018079	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1	Environmental
3300018082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2	Environmental
3300018084	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1	Environmental
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental
3300019360	White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG	Environmental
3300019458	Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG	Environmental
3300020022	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2	Environmental
3300021081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo	Environmental
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental
3300026295	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)	Environmental
3300026309	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)	Environmental
3300026312	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)	Environmental
3300026318	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)	Environmental
3300026328	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)	Environmental
3300026333	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)	Environmental
3300026343	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)	Environmental
3300026532	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)	Environmental
3300026538	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)	Environmental
3300026550	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)	Environmental
3300026552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)	Environmental
3300027187	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60 (SPAdes)	Environmental
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated
3300027875	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)	Environmental
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental
3300028803	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120	Environmental
3300031949	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197	Environmental
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental
3300032782	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1	Environmental
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental
3300033500	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fraction	Environmental
3300033513	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C	Environmental
3300033811	Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17	Environmental
3300033812	Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17	Environmental
3300034090	Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N	Environmental
3300034165	Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17	Environmental
3300034773	Sediment microbial communities from East River floodplain, Colorado, United States - 4_s17	Environmental
3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI25390J43892_101229621	3300002911	Grasslands Soil	STGGARVRNHRGLNCALPNQRLKLAARGGRMIGKGSVLIAAAAARSLSAIR*
Ga0066679_106571762	3300005176	Soil	VRNHRGLNCALPNQRLKLSARGGRMIGKGSVLIAAAADHSLSAIR*
Ga0066685_106892252	3300005180	Soil	AHIDLAPSNMRMKLSARGGRLIGNSSNLSAAAAGRSLCAIR*
Ga0066686_102962812	3300005446	Soil	MSQVPPNMRLKLSARGGRLIGKGSILIAAAAGRSLGAIR*
Ga0066689_103535611	3300005447	Soil	LNCALPNQRLKLPARGGRVIGKGSVLIAAAAGRSLSAIR*
Ga0066692_103798692	3300005555	Soil	VRNHCGLNCALPNQRLKLSARGGRMIGKGSVLIAAAAGRSLSAIR*
Ga0066704_101213622	3300005557	Soil	VRNHCGLNCALPNQRLKLSARGGRMIGKGSVLIAAAADHSLSAIR*
Ga0066700_100425724	3300005559	Soil	VRSHRGLNCALPHQRLKPPARGGRVIGKGSVLIAAAAGRSLSAIR*
Ga0066700_101247493	3300005559	Soil	ALPNKRLKLAACGGRLKRNGSVLSAAAAGRSLSAIR*
Ga0066699_101895904	3300005561	Soil	CALPNQRLKLSARGGRMIGKGSVLIAAAAGRSLSAIR*
Ga0066703_105058171	3300005568	Soil	VRNHRGLNCALPNQRLKLSARGGRMIGKGSVLIAAAAGHSLSAIRYAAPQKDAL*
Ga0066705_100040382	3300005569	Soil	VRNHRGLNCALPSQRLKLSACGGRMIGKDSVLIAAAAGRSLSAIR*
Ga0066705_100081484	3300005569	Soil	VRNHRGLKCALPNQRLKLSARGGRVIGKGSVLIAAAVGRSLSAIR*
Ga0066702_105277541	3300005575	Soil	TGGARVRNHRGLNCALPNQRLKLSARGGRMIGKGSVLIAAAAGRSLSAIR*
Ga0066702_105491071	3300005575	Soil	EHSVLPNMRLKLAARGGRLIEKASFLIAAAAGRSLSAIR*
Ga0066691_101908074	3300005586	Soil	GLNCALPNQRLKLSARGGRMIGKGSVLIAAAADHSLSAIR*
Ga0066691_101956443	3300005586	Soil	LSTVAPNQRLKLSARGGRVVGNWINLSAAAAGRSLSAIR*
Ga0066706_100769235	3300005598	Soil	VRNHRGLNCALPSQRLKLSARGGRMIGKDSVLIAAAAGRSLSAIR*
Ga0074472_108320792	3300005833	Sediment (Intertidal)	MYPVCTKLLPNQRWKLSARGGRLGGNGSVLSAAAAGR
Ga0075293_10797271	3300005875	Rice Paddy Soil	GLPNQRLKLSARGGHICKKKSVLSVAAAGRSLSATR*
Ga0075300_10740151	3300005876	Rice Paddy Soil	SIERLGVRPNQRLKLSARGGHICKKKSVLSVAAAGRSLSATR*
Ga0075286_10129713	3300005886	Rice Paddy Soil	RQMPNPRLKLSARGGRSVGKGSILIAAAAGRSLSAIR*
Ga0066696_111140591	3300006032	Soil	MMARPNKRLKLSACGGRSIGNWFILSAAAAGRSLSAIR*
Ga0066652_1008160712	3300006046	Soil	MCSESTWQMRAPPNQRLKLTARGGRSIRELSFLSAAAAGRSLS
Ga0075417_100273135	3300006049	Populus Rhizosphere	MSLLPNQRLKLSARGGRLIGKRSVLSAAAAGRSLSAIR*
Ga0075417_101077681	3300006049	Populus Rhizosphere	SGGLPNQRLKLTARGGRLIGKGSVLIAAAAGRTLSAIR*
Ga0075417_102219951	3300006049	Populus Rhizosphere	MVREMPLPNQRLKLSARGGRVVGNGSLLIAAAAGRSLSAIR*
Ga0075417_102288902	3300006049	Populus Rhizosphere	MALSNKRLKLAARGGRLIGKESLLVAAAAGRSLSAIR*
Ga0075417_102288904	3300006049	Populus Rhizosphere	PNQRLKLTARGGRVRGNGSIFSAAAAGRSLSAIR*
Ga0075417_103861401	3300006049	Populus Rhizosphere	PNMRLKLTARGGRVLGNESVLSAAAAGRSLSAIR*
Ga0075417_105400251	3300006049	Populus Rhizosphere	MLPNLRLKLPARGGRLIGKKSVLIAAAAGRSLSAIR*
Ga0075427_101048032	3300006194	Populus Rhizosphere	MLIAMPPANQRLKLTARGGRLMRNSSVLSAAAAGRSLS
Ga0074050_112880552	3300006577	Soil	LKLSARGGRPVGNGSVLSAAAGGRSFSAVRYAHR*
Ga0066658_104307621	3300006794	Soil	SNLRLKLPARGGRSVENRSVLIAAAAGRSLSAIR*
Ga0066665_100577443	3300006796	Soil	LAPNQRLKLTARGGRSVGNGSVLIAAAAGRSLSAIR*
Ga0066665_101347664	3300006796	Soil	VVAWAQPNPRLKLSARGGRVIGSGSVLSAAAAGRSLSAIR*
Ga0066659_110821132	3300006797	Soil	ARVRNHRGLNCALPNQRLKLSARGGRMIGKGSVLIAAAAGHSLSAIRYAAPQKDAL*
Ga0066659_111852941	3300006797	Soil	ARVRNHRGLNCALPNQRLKLSARGGRMIGKGSVLIAAAAGRSLSAIR*
Ga0066660_102790384	3300006800	Soil	LNCALPNQRLKLSARGGRMIGKGSVLIAAAAGRSLSAIR*
Ga0066660_104133093	3300006800	Soil	NCALPNQRLKLSARGGRMIGKGSVLIAAAAGRSLSAIR*
Ga0066660_104526363	3300006800	Soil	SEHSVLPNMRLKLAARGGRLIEKASFLIAAAAGRSLSAIR*
Ga0075428_1001731562	3300006844	Populus Rhizosphere	MSIGCTKVPPNQRLKLSARGGRVIGKWSVLSAAAAGRSLSAIR*
Ga0075428_1002617482	3300006844	Populus Rhizosphere	MASICVDMLPNLRLKLPARGGRLIGKKSVLIAAAAGRSLSAIR*
Ga0075428_1002987344	3300006844	Populus Rhizosphere	MVRGLPRQPNMRLKLTARGGRVLGNESVLSAAAAGRSLSAIR*
Ga0075428_1006136111	3300006844	Populus Rhizosphere	MRHGRNGKWLAPNMRLKLLARGGRSIGKWSVLIAAAAGRNLSAIR*
Ga0075428_1009207904	3300006844	Populus Rhizosphere	PNQRLKLTARGGRVIGNRYVLSAAVAGRSLSAIR*
Ga0075428_1010223402	3300006844	Populus Rhizosphere	GALPNQRLKLSARGGRLVGNGSILIAAAAGRSLSAIR*
Ga0075428_1022873491	3300006844	Populus Rhizosphere	MASMCVDMLPNQRLKLTARGGRLIGKRSVLSAAAAGRSL
Ga0075428_1024209832	3300006844	Populus Rhizosphere	MSPLPNQRLKLTARGGRSRGKESVLIAAAAGRSLS
Ga0075421_1000466422	3300006845	Populus Rhizosphere	VTCLSELPNQRLKLTARGGRLIGKGSVLSAAATGRSLSAIR*
Ga0075421_10009466910	3300006845	Populus Rhizosphere	VRGRRGLTYALPNQRLKLTARGGRLIGKRSILSAAAAGRSLSAIR*
Ga0075421_1000946692	3300006845	Populus Rhizosphere	MGLPNMRLKLTARGGRLIGNRSVLSAAAAGRSLSAIR*
Ga0075421_1001631521	3300006845	Populus Rhizosphere	MLRPNQRLKLTARGGRLVGNRSVLSAAAAGRSLSAIR*
Ga0075421_1001772186	3300006845	Populus Rhizosphere	MWRPNQRLKLTARGGRLVRYGSVLMAAATGRSLSAIR*
Ga0075421_1002013495	3300006845	Populus Rhizosphere	ARAPANMRLKLTARGRRLVGNGSVFSAAAAGRSLSAIR*
Ga0075421_1006703242	3300006845	Populus Rhizosphere	VSKPPSNQRLKLTSRGGRLKGKRSILIAAAAGRSLSAIR*
Ga0075421_1007293682	3300006845	Populus Rhizosphere	MASMCVDMLPNQRLKLTARGGRLIGKRSVLSAAAAGRSLSAIR*
Ga0075421_1010716841	3300006845	Populus Rhizosphere	PIMLRPNQRLKLTARGGRLVGNRSVLSAAAAGRSLSAIR*
Ga0075421_1012443741	3300006845	Populus Rhizosphere	MSLPNQRLKLTARGGRLRGNRLLLSAAAAGRSLSAIR*
Ga0075430_1008017881	3300006846	Populus Rhizosphere	VAQAPPNQRMKLAARGGRSVGNNVFLIAAAAGRSLCAIR*
Ga0075431_10005141310	3300006847	Populus Rhizosphere	MGGEPPNQRLKLPARGGRLVGHKSFLSTAAAGRSLSAIR*
Ga0075431_1000819482	3300006847	Populus Rhizosphere	MVQDDSCCGKVPPNQRLKLTARGGRLKGKVPVLSAAAAGRSLSAIR*
Ga0075431_1001296463	3300006847	Populus Rhizosphere	VLRPNQRLKLTACGGRVVGKRSILIAAAPGRSLSAIR*
Ga0075431_1001900834	3300006847	Populus Rhizosphere	MIAKPPNQRLKLSARGGRLIGKGSVLIAAAAGRSLSAIR*
Ga0075431_1009293021	3300006847	Populus Rhizosphere	PNQRLKLPARGGRLRGNESILIAAAAGRSLSAIR*
Ga0075431_1012668342	3300006847	Populus Rhizosphere	PNMRLKLTARGGRLIGNWLFLSAAAAGRSLSAIR*
Ga0075431_1018786232	3300006847	Populus Rhizosphere	PNQRLKLTARGGRLVGNGVVLPAAAAGRSLSAIR*
Ga0075433_100859982	3300006852	Populus Rhizosphere	MKARLLPNMRLKLSARGGRLIGKVFILIAAAAGRSLSAIR*
Ga0075433_101168836	3300006852	Populus Rhizosphere	PMGLPNMRLKLTARGGRLRGNRLFLSAAAAGRSLSAIR*
Ga0075433_101603584	3300006852	Populus Rhizosphere	QPPNQRLKLSARGGRLRGNWSILSAAAAGRSLSAIR*
Ga0075433_101886932	3300006852	Populus Rhizosphere	VYLNMLPNMRLKLTARGGRLVGDGSVLMAAAAGRSLSAIR*
Ga0075433_103658094	3300006852	Populus Rhizosphere	MNKLAPNQRLKLTARGGRLMGNRSILSAAAAGRSLSAIR*
Ga0075433_104491902	3300006852	Populus Rhizosphere	VDMLPNQRLKLSARGGRLIAKESVLIAAAAGRSLSAIR*
Ga0075433_104837101	3300006852	Populus Rhizosphere	MASICVDMLPNQRLKLSARGGRLIAKESVLIAAAAGRSLSAIR*
Ga0075433_115087341	3300006852	Populus Rhizosphere	LPNQRLKLSARGGRLIAKESVLIAAAAGRSLSAIR*
Ga0075433_119155232	3300006852	Populus Rhizosphere	MLPNQRLKLTARGGRLTGNESVLSAAAAGRSLSAIR*
Ga0075425_1003675862	3300006854	Populus Rhizosphere	MSLPNQRLKLSARGGHNCRKESVLSVAAAGRSLSAIR*
Ga0075434_1000239605	3300006871	Populus Rhizosphere	MIQAHLPNQRLKLSARGGRVVGNGSVLSAAAAGRSLSAIR*
Ga0075434_1000508882	3300006871	Populus Rhizosphere	MGAPPNQRLKLTARGGRLVRNGSVLSAAAAGRSLSAIR*
Ga0075434_1000626174	3300006871	Populus Rhizosphere	VPQQPNQRLKLTARGGRLKGKKSILIAAAAGRSLRAIR*
Ga0075434_1000905361	3300006871	Populus Rhizosphere	VRPNQRLKLSARGGRLVEKGFVLSAAAAGRSLSAIR*
Ga0075434_1001139957	3300006871	Populus Rhizosphere	MMQPPNMRLKLTARGGRLIGNRSVLSAAAAGRSLSAIR*
Ga0075434_1001485818	3300006871	Populus Rhizosphere	PNQRLKLTARGGRLRGNVSILSAAAAGRSLSAIR*
Ga0075434_1001817704	3300006871	Populus Rhizosphere	MTQQPNMRLKLTARGGRVKGKESILIAAAAGRSLSAIR*
Ga0075434_1002004885	3300006871	Populus Rhizosphere	MGLPNMRLKLTARGGRLRGNRLFLSAAAAGRSLSAIR
Ga0075434_1002400064	3300006871	Populus Rhizosphere	GRLLPNQRLKLTTRGGRLIEKESVLIAAAAGRSLSAIR*
Ga0075434_1004812702	3300006871	Populus Rhizosphere	MASICVDTLPNQRLKLSARGGRLIAKESVLIAAAAGRSLSAIR*
Ga0075434_1012419471	3300006871	Populus Rhizosphere	MVQDDSCCGKVPPNQRLKLTARGGRSVRNESILIAAAAGRSLSAIR*
Ga0075429_1000516643	3300006880	Populus Rhizosphere	VIVGLPNQRLKLTARGGRVIGNWSILCAAATGRSLSAIR*
Ga0075429_1000516648	3300006880	Populus Rhizosphere	VPLPNQRLKLTARGGRLVGKELVLSAAAAGRSLSAIR*
Ga0075429_1000789806	3300006880	Populus Rhizosphere	MRGLPPNQRLKLTARGGRLIGNESVLSAAAAGRSLSAIR*
Ga0075429_1001078611	3300006880	Populus Rhizosphere	LPNQRLKLSARGGRLIGKRSVLSAAAAGRSLSAIR*
Ga0075429_1001336572	3300006880	Populus Rhizosphere	MTGLSNQRLKLSARGGRLVGSASVLSAAAAGRSLSAIR*
Ga0075429_1003958351	3300006880	Populus Rhizosphere	SNQRLKLTARGGRSIGNGSVLMAAAAGRSLSAIR*
Ga0075429_1005920704	3300006880	Populus Rhizosphere	PNMRLKLTARGGRVVGNRSILIAAAAGRSLSAIR*
Ga0075429_1007178511	3300006880	Populus Rhizosphere	RSRLPNMRLKLPARGGRLIGKGSILLAAAAGRSLSAIR*
Ga0075429_1012023232	3300006880	Populus Rhizosphere	PNQRLKLPARGGRLRGKGSVLIAAAAGRSLSAIR*
Ga0075424_1000533462	3300006904	Populus Rhizosphere	VTPRRAPPNQRLKLSARGGRVAGNRSVLSAAAAGRSLSAIR*
Ga0075424_1000533465	3300006904	Populus Rhizosphere	VSKPPSNQRLKLTARGGRLVGNGSVLIAAAAGRSLSAIR*
Ga0075424_1025116311	3300006904	Populus Rhizosphere	GGTLPNQRLKLSARGGRLRGNGSVLSAAAAGRSLSAFR*
Ga0075419_100991541	3300006969	Populus Rhizosphere	RPNQRLKLTARGGRLMGNGSILSAAAAGCSLSAIR*
Ga0075419_103966881	3300006969	Populus Rhizosphere	PPNQRLKLTARGGRLREKRSILLAAAAGRSLSAIR*
Ga0075419_105888202	3300006969	Populus Rhizosphere	PPNQRLKLTARGGRLRAKGSILMAAAAGRSLSAIR*
Ga0075419_110105003	3300006969	Populus Rhizosphere	ALPNQRLKLTARGGRPKGKRSILIAAAAGRSLSAIR*
Ga0099791_105703971	3300007255	Vadose Zone Soil	SICVDMLPNQRLKLTARGGRVVGNGSVLIAAAAGRSLSAIR*
Ga0066710_10003327012	3300009012	Grasslands Soil	TLVVAWAQPNPRLKLSARGGRVIGSGSVLSAAAAGRSLSAIR
Ga0066710_1004626982	3300009012	Grasslands Soil	MTLRPNQRMNLSASGGRFWRNRSIFSAAAAGRSLCAIR
Ga0066710_1010282651	3300009012	Grasslands Soil	MGAIPRQDRLPNQRLKLSACGGRLIRNWSVLSAAAAGRSLSA
Ga0099827_104148211	3300009090	Vadose Zone Soil	LPNQRLKLSARGGRLVENNVFLPTAAAGRSLSAIR*
Ga0075418_107451253	3300009100	Populus Rhizosphere	PLPNQRLKLTARGGRLVGKELVLSAAAAGRSLSAIR*
Ga0075418_114856251	3300009100	Populus Rhizosphere	RQPNMRLKLTARGSRLIGKRSVLIAAATGRSLSAIR*
Ga0075418_124721002	3300009100	Populus Rhizosphere	VPSNMRLKLTARAGRLVGHGTVLSAAAAGGSLREIR*
Ga0066709_1005830864	3300009137	Grasslands Soil	GGARVRNHRGLNCALPNQRLKLSARGGRMIGKGSFLIAAAASRSLSAIR*
Ga0066709_1029821332	3300009137	Grasslands Soil	SNMRMKLSARGGRLIGNWSKLSAAAAGRSLCAPR*
Ga0114129_100781539	3300009147	Populus Rhizosphere	MTPNMRLKLTARGGRLVANSSVLIAAAAGRSLSAIR*
Ga0114129_101437511	3300009147	Populus Rhizosphere	MPLPNQRLKLTARGGRLRGKRSILIAAAAGRSLSAIR*
Ga0114129_101545946	3300009147	Populus Rhizosphere	MRARPNQRLKLTARGGRLIGKWFTLIAAAAGRSLSAIR*
Ga0114129_101720292	3300009147	Populus Rhizosphere	MAGALPNQRLKLTACGGRLVGNRSLLSAAAAGRCLSAIR*
Ga0114129_101998785	3300009147	Populus Rhizosphere	CSAGQPNQRLKLSARGARLVRNRSILSAGAAGRSLSAIR*
Ga0114129_102743925	3300009147	Populus Rhizosphere	VALPNQRLKLSARGGRLVGNGSVLIAAAAGRSLSAIR*
Ga0114129_102870124	3300009147	Populus Rhizosphere	RPNQRLKLTTRGGRLLRNGSILSAAAAGRSLSAIR*
Ga0114129_102982831	3300009147	Populus Rhizosphere	LARAPANMRLKLTARGRRLVGNGSVFSAAAAGRSLSAIR*
Ga0114129_103746516	3300009147	Populus Rhizosphere	LPVLRPNQRLKLTACGGRVVGKRSILIAAAPGRSLSAIR*
Ga0114129_104340761	3300009147	Populus Rhizosphere	SRSRLPNMRLKLPARGGRLIGKGSILLAAAAGRSLSAIR*
Ga0114129_105156994	3300009147	Populus Rhizosphere	WPIMLRPNQRLKLTARGGRLVGNRSVLSAAAAGRSLSAIR*
Ga0114129_105540291	3300009147	Populus Rhizosphere	TLLSVSTQPNQRLKLTARGGRLRGNGSVLSAAAAGRSLSAIR*
Ga0114129_106336614	3300009147	Populus Rhizosphere	DVFTDPQPPNKRLKLTARGGRQVGNLSILSAAAAGRSLSAIR*
Ga0114129_106762281	3300009147	Populus Rhizosphere	CSGGLPNQRLKLTARGGRLIGKGSVLIAAAAGRTLSAIR*
Ga0114129_106779831	3300009147	Populus Rhizosphere	MKGLPPNQRLKLTARGGRLIGNRSILSAAAAGRSLSAI
Ga0114129_109480573	3300009147	Populus Rhizosphere	VSKPPSNQRLKLPARGDRVVRSRSVLSAAAAGRSLSAIR*
Ga0114129_110318663	3300009147	Populus Rhizosphere	RSFVRLSRLPNMRLKLTARGGRVIGNRFVLSAADAGRSLSAIR*
Ga0114129_112102751	3300009147	Populus Rhizosphere	MVTLGPAPNIRLKLSARGGRVVGKGSILSAAAAGCSLSAIR
Ga0114129_112345431	3300009147	Populus Rhizosphere	EPPNMRLKLAARGGRLRGKGSILIAAAAGRSLSAIR*
Ga0114129_117162021	3300009147	Populus Rhizosphere	PNQRLKLSARGGRLVGNGSVLIAAATGRSLSAIR*
Ga0114129_117914932	3300009147	Populus Rhizosphere	MVLPNQRLKLTARGGRLIAKESVLLAAAAGRSLSAIR*
Ga0114129_121524901	3300009147	Populus Rhizosphere	VLPNQRLKLSARGGRVIGKGFVLSAAAAGRSLSAIR*
Ga0114129_121539251	3300009147	Populus Rhizosphere	PMSLLPNQRLKLSARGGRLIGKRSVLSAAAAGRSLSAIR*
Ga0114129_128831131	3300009147	Populus Rhizosphere	MPLPNQRMKLSARGGHTCRLNSILSVAAAGRSLCALR
Ga0114129_129217961	3300009147	Populus Rhizosphere	PNQRLKLSARGGRLVGKGSILIAAAAGRSLSAIR*
Ga0114129_129348661	3300009147	Populus Rhizosphere	PNQRLKLTARGGRLIGNRSILIAAAAGRSLSAIR*
Ga0114129_130182541	3300009147	Populus Rhizosphere	LKQDAVLPNQRLKLTARGGRLIVKGSILIAAAAGRSLSSIR
Ga0075423_100350531	3300009162	Populus Rhizosphere	LTCDLKLTARGGRLIGKRTVLSAAAAGRSLSAFR*
Ga0075423_100554311	3300009162	Populus Rhizosphere	PPMGLPNMRLKLTARGGRLRGNRLFLSAAAAGRSLSAIR*
Ga0075423_100948191	3300009162	Populus Rhizosphere	PNQRLKLTTRGGRLIEKESVLIAAAAGRSLSAIR*
Ga0075423_103671625	3300009162	Populus Rhizosphere	GQAPNQRLKLTARGGRLIGNRLFLSAAAAGRSLSAIR*
Ga0075423_127073172	3300009162	Populus Rhizosphere	MLPNQRLKLSGCGGRLKGNGSALIAAAATRSLSAIR*
Ga0126384_123438451	3300010046	Tropical Forest Soil	AGRVLANQRMKLTARGGRLIGNGLIFCAAAAGRSLCAIR*
Ga0134071_101248303	3300010336	Grasslands Soil	RYPPPNQRMKLTACRGHIWRNRSLLIVAAAGRSLSAIR*
Ga0126377_112087721	3300010362	Tropical Forest Soil	MKDLDNAPSNMRMKLSTRGGRVIGKGLLLSAAAAGRSLCAIR*
Ga0134123_116318521	3300010403	Terrestrial Soil	RVRGLCGLNCAQPNQRVKLSARGGHNGRKESVLSVAAAGRSLSAIR*
Ga0137393_117394811	3300011271	Vadose Zone Soil	GGARVRSHRGLNCALPNQRLKLMARGGRVIGKGSVLIAAAAGRGLSAIR*
Ga0137463_11154182	3300011444	Soil	SKVLPNQRLKLSARGGRLVGSSFVLSAAAAGRSLSAIR*
Ga0137383_101260103	3300012199	Vadose Zone Soil	MTLRPNMRLKLSARGGRLIGKGSVLLAAAAGRSLSAIR*
Ga0137382_100973213	3300012200	Vadose Zone Soil	MTLRPNQRMKLSASGGRFWRNRSIFSAAAAGRSLCAIR*
Ga0137365_102326121	3300012201	Vadose Zone Soil	PNMRLKLSARGGRLIGKGSVLLAAATGRSLSAIR*
Ga0137399_105546832	3300012203	Vadose Zone Soil	MAWICVDMLPNQRLKLTARGGRVVGDGSVLIAAAAGRSLSAIR*
Ga0137374_100123635	3300012204	Vadose Zone Soil	MRVLPNQRLKLSARGGRLRGKGSILIVAAAPHSLSAIR*
Ga0137374_101096572	3300012204	Vadose Zone Soil	MGRVRPNQRLKLSARGGRLIGKGSILIAAAAGRSLSASR*
Ga0137374_101585266	3300012204	Vadose Zone Soil	MYPVCTGMLPNQRMKLTARGGHIRRNRVTLSVAAAGRSLCAIR*
Ga0137374_103033021	3300012204	Vadose Zone Soil	TKRLPNQRMKLPACGGRLRGKGFVLIAAAAGRSLCAVR*
Ga0137374_103033023	3300012204	Vadose Zone Soil	MRVLLPNMRMKLAARGGRMMGNEFVLSAAAAGRSLCAIR*
Ga0137362_103553391	3300012205	Vadose Zone Soil	CALPNQRLKLSARGGRMIGKGSVLIAAAARRSLSAIR*
Ga0137380_100314724	3300012206	Vadose Zone Soil	VWLRAVRALPNERLNLTGLGGRLRGKGSILIVAAARRSLSAIR*
Ga0137381_100859951	3300012207	Vadose Zone Soil	MLLPPNQRLKLSARGGRLVGNEFVLSAAAAGRSLSA
Ga0137381_101017021	3300012207	Vadose Zone Soil	EVVVPRMSPPNQRMKLTARGGRVKRKKSFWSAAATGCSLCAIR*
Ga0137381_107217801	3300012207	Vadose Zone Soil	FRVSMLLPPNQRLKLSARGGRLVGNEFVLSAAAAGRSLSAIR*
Ga0137378_104886922	3300012210	Vadose Zone Soil	MTLRPNQRMKLSARGGRFWRNRSILSAAAAGRSLCAIR*
Ga0137434_10252311	3300012225	Soil	MLLPNRRINLSARGGRVAGNGSVLSAAAAGRSLCAI
Ga0137387_101497802	3300012349	Vadose Zone Soil	MTLRPNQRMNLSASGGRFWRNRSIFSAAAAGRSLCAIR*
Ga0137372_103989962	3300012350	Vadose Zone Soil	MSLDWRRPNKRLKLTARGGRLVGKASFLIAAGAGRSLSAIR*
Ga0137367_100947883	3300012353	Vadose Zone Soil	VTKRLPNQRMKLPACGGRLRGKGFVLIAAAAGRSLCAVR*
Ga0137367_112154501	3300012353	Vadose Zone Soil	IASLANQRLKLTARGGRLKGNWSVLSAAAAGRSLSAIR*
Ga0137369_106783322	3300012355	Vadose Zone Soil	GPVPSSPSNQRLKLTARGGRLRGKGSILIAAAAGRSLSAIC*
Ga0137375_103558874	3300012360	Vadose Zone Soil	RSGPRPVRPNQRLKLSARGGRLVGNGSVLLAAAAGRSLSAIR*
Ga0137390_101143774	3300012363	Vadose Zone Soil	MTALLTHPPNQRLKLSASGGRSKGNGFVLIAAAAGRSLSAIR*
Ga0137373_100643481	3300012532	Vadose Zone Soil	VAQPNQRLKLSARGGHTCWNRFILSVAAAGRSLSAIH*
Ga0137373_102233373	3300012532	Vadose Zone Soil	MAPNMRMKLTARGGRLKGNGLFLSAAAAGRSLCAIR*
Ga0137397_110889491	3300012685	Vadose Zone Soil	ALPNQRLNLTARGGRVIGKGSVLIAAPAGRSLSAIR*
Ga0137359_116514142	3300012923	Vadose Zone Soil	MASICVDMLPNQRLKLTARGGRVVGNGSVLIAAAAGRSLSAIR*
Ga0137404_120107313	3300012929	Vadose Zone Soil	LPNQRLKLTARGGRVVGNGSVLIAAAAGRSLSAIR*
Ga0153915_102540201	3300012931	Freshwater Wetlands	MLLPNQRLKLSARGGRLIGKGSLLIAAAAGRSLSAFR*
Ga0153915_128118372	3300012931	Freshwater Wetlands	RRPSNQRLKLAARGGRGKEKGFVLLAAAAGRSLSAIR*
Ga0153915_131049271	3300012931	Freshwater Wetlands	KWLPNLRLKLSARGGRLARNWSVLSAAAAGRSLSAIR*
Ga0134077_103787701	3300012972	Grasslands Soil	MRVQPNKRLKLSARGGRSTRERSFLSAAAAGRSLSAFR
Ga0180066_10061311	3300014873	Soil	MLPRVPNKRMKLAARGGRMVGIRSVLIAAAAGRSLSAIR*
Ga0137418_100397751	3300015241	Vadose Zone Soil	RGLNCALPNQRLKLSARGGRMIGKGSVLIAAAARRSLSAIR*
Ga0134112_102812831	3300017656	Grasslands Soil	TPSSERRVLPNMRLKLSARGGRLVGNGFVLSAAAAGRSLSAIR
Ga0134083_100159442	3300017659	Grasslands Soil	MSRSEPPNQRLKLSARGGRLVGNKVFLIAAAAGRSLSAIR
Ga0184626_102888831	3300018053	Groundwater Sediment	DVTPNQRLKLAARGGRLVGNGSVSSAAAAGRSLSAIR
Ga0184636_12113251	3300018068	Groundwater Sediment	MLRKLAPNQRLKLSARGGRLVGNESVLSAAAAGRSLSA
Ga0184627_103929962	3300018079	Groundwater Sediment	RHPNMRLKLSARGGRLIENGFVLSAAAAGRSLSAIR
Ga0184627_105865641	3300018079	Groundwater Sediment	HAVGVLPNQRMKLAARGGRVIGNSLFLSAAAAGRSLCAIR
Ga0184639_104847892	3300018082	Groundwater Sediment	AREQPPPNKRMKLSARGGHTCRTKSVLSVAAAGRSLCANR
Ga0184629_106076852	3300018084	Groundwater Sediment	LPNQRLKLSARGGRVVGNGSVLSAAAAGRSLSASR
Ga0184629_107051923	3300018084	Groundwater Sediment	VGASLGRVMPNQRLKLSACGGRSAGKGSVLSAAATG
Ga0066655_100114554	3300018431	Grasslands Soil	MPLNQRLKVLALGGRLIGNKVFLSAASAGRSLSAIR
Ga0066667_113865321	3300018433	Grasslands Soil	PRRRNMRVKLAAWGGRSVGKESLLIAAAPGRSLSAIR
Ga0066662_100704444	3300018468	Grasslands Soil	VVAWAQPNPRLKLSARGGRVIGSGSVLSAAAAGRSLSAIR
Ga0066669_102227881	3300018482	Grasslands Soil	RGLNCALPNQRLKLSARGGRMIGKGSILIAAAAGRSLSAIR
Ga0187894_105013551	3300019360	Microbial Mat On Rocks	LIRLRPNQRMKLTARGGRVKRNRSFVAAAATGCSLCAF
Ga0187892_102458782	3300019458	Bio-Ooze	PKSSRPNQRMKLSARGGRLRGMGFVMIAAAAGRSLCAVR
Ga0187892_103291871	3300019458	Bio-Ooze	MAKRPNQRMKLSARGGRVKRKQSFLSAAATGCSLCAIR
Ga0187892_103907931	3300019458	Bio-Ooze	MCWAVLPNQRMKLSARGGRVKRHPSFLAAAATGCSL
Ga0193733_10670293	3300020022	Soil	SHRGLNCALPNQRLKLTARGGRVIGKGSVLIAAAAGRSLSAIR
Ga0210379_102598132	3300021081	Groundwater Sediment	MDTLPNQRLKLSARGGRLIGKKSVLIAAAAGRSLSAIR
Ga0207646_112465722	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	LCGLNCALPNRRLKLSARGGHNCRKESILSVAAAGRSLSAIR
Ga0209234_10145626	3300026295	Grasslands Soil	VRNHRGLNRALPNQRLKLSARDGRMIGKSSVFIAAAAGCSLSAIR
Ga0209055_100251221	3300026309	Soil	VRSHRGLNCALPHQRLKPPARGGRVIGKGSVLIAAAAGRSLSASR
Ga0209055_10250513	3300026309	Soil	VRNHRGLNCALPSQRLKLSACGGRMIGKDSVLIAAAAGRSLCAIR
Ga0209153_10854812	3300026312	Soil	VRNHRGLNCALPNQRLKLSARGGRMIGKGSVLIAAAAGRSLSAIR
Ga0209471_10040192	3300026318	Soil	VRNHRGLNCALPSQRLKLSACGGRMIGKDSVLIAAAAGRSLSAIR
Ga0209471_12638102	3300026318	Soil	SSEHSVLPNMRLKLAARGGRLIEKASFLIAAAAGRSLSAIR
Ga0209802_11340353	3300026328	Soil	PLNQRLKLSARGGRLVGNGSVLSAAAAGRSLSAIR
Ga0209158_12825833	3300026333	Soil	STGGARVRNHCGLNCALPNQRLKLSARGGRMIGKGSVLIAAAADHSLSAIR
Ga0209159_11354872	3300026343	Soil	VRNHRGLNCALPNQRLKLSARGGRMIGKGSVLIAPAAGRSLSAIR
Ga0209160_12201601	3300026532	Soil	MYPVCTGLLPNPPMKLSARGGRSVRNRSVLSAAAAGRSLW
Ga0209056_100082519	3300026538	Soil	MGAIPRQDRLPNQRLKLSACGGRLIRNWSVLSAAAAGRSLSAIR
Ga0209474_100795184	3300026550	Soil	PGLYRVAPNLRMKLSARGGRLVRNWSFLSAAAAGRSLCAIR
Ga0209577_102521223	3300026552	Soil	GLNCALPNQRLKLSARGGRMIGKGSVLIAAAAGRSLSAIR
Ga0209869_10131872	3300027187	Groundwater Sand	RVPDLLTMCKLPNQRLKLSGGGGRPKGNGSLLIAAAAPRSLSAIR
Ga0209180_100133123	3300027846	Vadose Zone Soil	VRSHRGLNCALPNQRLKLMARGGRVIGKGSVLIAAAAGRGLSAIR
Ga0209814_100242612	3300027873	Populus Rhizosphere	MSIGCTKVPPNQRLKLSARGGRVIGKWSVLSAAAAGRSLSAIR
Ga0209814_100313175	3300027873	Populus Rhizosphere	VIAPSNQRLKLSARGGRLIGKGSILSAAAAGRSLSAIR
Ga0209814_100329804	3300027873	Populus Rhizosphere	MGLPNMRLKLTARGGRLIGNRSVLSAAAAGRSLSAIR
Ga0209814_100829243	3300027873	Populus Rhizosphere	LGGPLDQTRSGPSGPPNMRLKLTARGGRLRGKRSILIAAAAGRSLSAIR
Ga0209814_101226951	3300027873	Populus Rhizosphere	ERPNQRLKLTARGGRLMGNGSILSAAAAGCSLSAIR
Ga0209814_101897691	3300027873	Populus Rhizosphere	CDKVQPNMRLKLPARGGRLVGHKSFLSTAAAGRSLSAIR
Ga0209814_104455452	3300027873	Populus Rhizosphere	MALSNKRLKLAARGGRLIGKESLLVAAAAGRSLSAIR
Ga0209283_106339532	3300027875	Vadose Zone Soil	MYQGPPNQRLKLSARGGRPGGTESVLSAAAAGRSL
Ga0209481_100751371	3300027880	Populus Rhizosphere	TYVLTNRLCSGGLPNQRLKLTARGGRLIGKGSVLIAAAAGRSLSAIR
Ga0209481_101114333	3300027880	Populus Rhizosphere	MSLLPNQRLKLSARGGRLIGKRSVLSAAAAGRSLSAIR
Ga0209481_103799452	3300027880	Populus Rhizosphere	LPVKQPPNQRMKLSARGGRLIGNWSILSAAAAGRSLCAIR
Ga0209481_104422612	3300027880	Populus Rhizosphere	RMGGEPPNQRLKLPARGGRLVGHKSFLSTAAAGRSLSAIR
Ga0209481_106881951	3300027880	Populus Rhizosphere	HRLRPNQRLKLTARSGRVVGKGSILSAAAAGRSLSAIR
Ga0209590_102212411	3300027882	Vadose Zone Soil	RVSMLLPPNQRLKLSARGGRLVRNEFVLSAAAAGRSLSAIR
Ga0209488_104523363	3300027903	Vadose Zone Soil	VRSHRGLNCALPNQGLKLMARGGRVIGKGSVLIAAAAGRGLSAIR
Ga0209382_1001926711	3300027909	Populus Rhizosphere	MVRGLPRQPNMRLKLTARGGRVLGNESVLSAAAAGRSLSAIR
Ga0209382_100852296	3300027909	Populus Rhizosphere	MLRPNQRLKLTARGGRLVGNRSVLSAAAAGRSLSAIR
Ga0209382_101119405	3300027909	Populus Rhizosphere	MLIAMPPANQRLKLTARGGRLMRNSSVLSAAAAGRSLSAIR
Ga0209382_101510885	3300027909	Populus Rhizosphere	VIVGLPNQRLKLTARGGRVIGNWSILCAAATGRSLSAIR
Ga0209382_101719977	3300027909	Populus Rhizosphere	VRGRRGLTYALPNQRLKLTARGGRLIGKRSILSAAAAGRSLSAIR
Ga0209382_105068723	3300027909	Populus Rhizosphere	ILARAPANMRLKLTARGRRLVGNGSVFSAAAAGRSLSAIR
Ga0209382_112771013	3300027909	Populus Rhizosphere	RPNQRLKLTARGGRLIGNWSILIAAAAGRSLSAIR
Ga0137415_100702733	3300028536	Vadose Zone Soil	VRSHRGLNCALPNQRLKLTARGGRVIGKGSVLIAAAAGRSLRAIR
Ga0137415_113625482	3300028536	Vadose Zone Soil	MAWICVDMLPNQRLKLTARGGRVVGDGSVLIAAAAGRSLSAIR
Ga0307281_104336401	3300028803	Soil	PAGKVLPNQRLKLSARGGRLVGNKSVLSAAAAGRSLSAIR
Ga0214473_109931181	3300031949	Soil	MVPPNQRMKLSARGGRLVGNRSVLSAAAAGRSLCAIR
Ga0335085_100359047	3300032770	Soil	MLPPNLRLKLSARGGRSIEERLFLSAAAAGRSLSASR
Ga0335085_100359049	3300032770	Soil	MCCLKLPPNLRLKLSARGGRAIRERSFLSAAAAGRSLSAFR
Ga0335085_101418162	3300032770	Soil	MPSVRLCLPPNLRLKLAARGGRAIKERSFLSAAAAGRSLSASR
Ga0335085_101526716	3300032770	Soil	MPSLPVCLLPNLRLKLSARGGRSIKEWSFLSAAAAGRSLSAFR
Ga0335085_101934722	3300032770	Soil	MMALPNLRLKLSARGGRSIKEVVFLIAAAAGRSLSASR
Ga0335085_106158933	3300032770	Soil	TRNERPSNLRLKLSARGGRAITERFFLSAAAAGRSLSAFR
Ga0335085_106249582	3300032770	Soil	MMAFARALPWQPNLRLKLSARGGRVGWNTFILSAAAAGRSLSASR
Ga0335085_122819852	3300032770	Soil	LPNLRLKLSARGGRTIKELLLLIAAAAGRSLSASR
Ga0335082_103303453	3300032782	Soil	MALPNLRLKLSARGGRTIKELLLLIAAAAGRSLSASR
Ga0335082_103741471	3300032782	Soil	RPLTPPNWRLKLSARGGRLIRELIFLIAAAAGRSLSASR
Ga0335082_109475871	3300032782	Soil	AAFLWLIAVRPNLRLKLPARGGRAIKERSFLSAAAAGRSLSAFR
Ga0335082_110875061	3300032782	Soil	MVCHVLPNWRLKLAARGGRSIKERSFLIAAAAGRSLSASRYAA
Ga0335082_115511411	3300032782	Soil	MPSLPVCLLPNLRLKLSARGGRSIKEWSFLSAAAAGRSLSASR
Ga0310810_114141981	3300033412	Soil	VKRVPNLRLKLSARGGRLVGNGSVLSAAAAGRSLSA
Ga0310810_114141982	3300033412	Soil	MPPPNQRLKLTARGGRLIGKWSILSAAAAGRSLSAIR
Ga0326726_100093061	3300033433	Peat Soil	LPNLRLKLSARGGRLKGKGSVLIAAAAGRSLSAIR
Ga0326726_100651876	3300033433	Peat Soil	MMAGEPPNQRLKLSARGGRLVGKGSVLIAAAAGRSLSAIR
Ga0326726_103637201	3300033433	Peat Soil	TSSEAPPNQRLKLSARGGRVVGNGFILSAAAAGRSLSAIR
Ga0326726_107423371	3300033433	Peat Soil	MLRPDLRLKLSARGGRLVENWFVLIAAAAGRSLSAIR
Ga0326726_112938981	3300033433	Peat Soil	NALSSNTWLPNPRLKLSGCGGRLKGKGSVLIAAAAPRSLSAIR
Ga0326726_117057621	3300033433	Peat Soil	VTKRLPNLRLKLSARGGRVVGNWIYLSAAAAGRSLSAIR
Ga0326730_10122885	3300033500	Peat Soil	VPPNQRLKLSARGGRLKGKGSILIAAAAGRSLSAIR
Ga0316628_1017188771	3300033513	Soil	VGQLAIGPPPNQRLKLAARGGRLVGNWSILSAAAAGRSLSAIR
Ga0364924_004058_292_414	3300033811	Sediment	MVAWAQPDPRLKLAARGGHVVGNGSVLSAAAAGRSLCANR
Ga0364924_007166_1059_1169	3300033811	Sediment	MPPNQRLKLSARGGRLIGKESLLIAAAAGRSLSATR
Ga0364926_140997_1_135	3300033812	Sediment	RRGLSTQKVAAYQRMKLSARGGRLVGNSSFLSAAAAGRSLSAFR
Ga0326723_0010760_178_291	3300034090	Peat Soil	MTLPNQRLKLSARGGHTCRKKSVLSVAAAGRSLSAIR
Ga0326723_0014398_2723_2836	3300034090	Peat Soil	MALPNQRLKLSARGGRLKGKDSFLLAAAAGRSLSAIR
Ga0326723_0155540_1_117	3300034090	Peat Soil	AGALPNQRLKLSVRGGRSVGNESVLIAAAAGRSLSAIR
Ga0326723_0284453_2_115	3300034090	Peat Soil	ALTSNMRLKLSAWGGRLVGNGSLLIAAAPGRSLSATR
Ga0326723_0434491_1_117	3300034090	Peat Soil	ARWLPNLRLKLSAGGGRLIAKGSVLIAAAAGRSLSAVR
Ga0364942_0125895_2_112	3300034165	Sediment	WQSNQRLKLSARGGRVVGNRVFLSAAATGCSLCAFR
Ga0364936_001106_2_124	3300034773	Sediment	VHGSEAPYQRMKLSARGGRLMRTWSVLIAAAAGRSLCAVR
Ga0364936_120481_393_527	3300034773	Sediment	VTCGAQVRQLPSKGMKLAARGGRVGGNGFVLSAAAAGRSLSAIR
Ga0373948_0053954_761_868	3300034817	Rhizosphere Soil	PPNQRLKLPARGGRVRGTGSILIAAATGRSLSAIR