| Basic Information | |
|---|---|
| Family ID | F012096 |
| Family Type | Metagenome |
| Number of Sequences | 283 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MSTWLIAAMGVVYFVVAIDQFIKGGVGTGIMFLGYAMGNVGLVMVAK |
| Number of Associated Samples | 188 |
| Number of Associated Scaffolds | 283 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 77.11 % |
| % of genes near scaffold ends (potentially truncated) | 28.62 % |
| % of genes from short scaffolds (< 2000 bps) | 69.96 % |
| Associated GOLD sequencing projects | 159 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.70 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (57.951 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater (28.269 % of family members) |
| Environment Ontology (ENVO) | Unclassified (65.018 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (78.445 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.00% β-sheet: 0.00% Coil/Unstructured: 44.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.70 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 283 Family Scaffolds |
|---|---|---|
| PF10926 | DUF2800 | 40.64 |
| PF10991 | DUF2815 | 32.51 |
| PF11753 | DUF3310 | 2.12 |
| PF00476 | DNA_pol_A | 1.41 |
| PF02945 | Endonuclease_7 | 1.41 |
| PF00176 | SNF2-rel_dom | 1.06 |
| PF01464 | SLT | 0.71 |
| PF03237 | Terminase_6N | 0.71 |
| PF08707 | PriCT_2 | 0.71 |
| PF00959 | Phage_lysozyme | 0.35 |
| PF02915 | Rubrerythrin | 0.35 |
| PF00166 | Cpn10 | 0.35 |
| PF00303 | Thymidylat_synt | 0.35 |
| PF02867 | Ribonuc_red_lgC | 0.35 |
| PF02739 | 5_3_exonuc_N | 0.35 |
| PF11351 | GTA_holin_3TM | 0.35 |
| PF06945 | DUF1289 | 0.35 |
| COG ID | Name | Functional Category | % Frequency in 283 Family Scaffolds |
|---|---|---|---|
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 1.41 |
| COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 0.35 |
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.35 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.35 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.35 |
| COG3313 | Predicted Fe-S protein YdhL, DUF1289 family | General function prediction only [R] | 0.35 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.27 % |
| Unclassified | root | N/A | 24.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000439|TBL_comb48_EPIDRAFT_1026783 | Not Available | 2500 | Open in IMG/M |
| 3300001836|RCM27_1083754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 640 | Open in IMG/M |
| 3300001836|RCM27_1095683 | Not Available | 503 | Open in IMG/M |
| 3300001849|RCM26_1075374 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 846 | Open in IMG/M |
| 3300001850|RCM37_1019882 | Not Available | 592 | Open in IMG/M |
| 3300001851|RCM31_10039188 | All Organisms → Viruses → Predicted Viral | 1260 | Open in IMG/M |
| 3300001851|RCM31_10076805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1415 | Open in IMG/M |
| 3300002091|JGI24028J26656_1002902 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3026 | Open in IMG/M |
| 3300002091|JGI24028J26656_1009619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermosediminibacterales → Tepidanaerobacteraceae → Tepidanaerobacter → Tepidanaerobacter acetatoxydans | 1217 | Open in IMG/M |
| 3300002092|JGI24218J26658_1003028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4031 | Open in IMG/M |
| 3300002092|JGI24218J26658_1012123 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
| 3300002202|metazooDRAFT_1251755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
| 3300002307|JGI24890J29729_1054166 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300002835|B570J40625_100126973 | All Organisms → cellular organisms → Bacteria | 3008 | Open in IMG/M |
| 3300002933|G310J44882_10003108 | Not Available | 6481 | Open in IMG/M |
| 3300003375|JGI26470J50227_1003621 | All Organisms → cellular organisms → Bacteria | 4644 | Open in IMG/M |
| 3300003375|JGI26470J50227_1004542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 3982 | Open in IMG/M |
| 3300003375|JGI26470J50227_1005831 | All Organisms → cellular organisms → Bacteria | 3386 | Open in IMG/M |
| 3300003375|JGI26470J50227_1005854 | All Organisms → cellular organisms → Bacteria | 3382 | Open in IMG/M |
| 3300003375|JGI26470J50227_1008439 | All Organisms → cellular organisms → Bacteria | 2672 | Open in IMG/M |
| 3300003375|JGI26470J50227_1059933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
| 3300003411|JGI25911J50253_10091574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 944 | Open in IMG/M |
| 3300003430|JGI25921J50272_10060248 | Not Available | 845 | Open in IMG/M |
| 3300003785|Ga0007851_104308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 760 | Open in IMG/M |
| 3300003787|Ga0007811_1000002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 57523 | Open in IMG/M |
| 3300003789|Ga0007835_1022683 | Not Available | 508 | Open in IMG/M |
| 3300003793|Ga0007847_100001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 105595 | Open in IMG/M |
| 3300003793|Ga0007847_100281 | All Organisms → cellular organisms → Bacteria | 4203 | Open in IMG/M |
| 3300003797|Ga0007846_1002565 | All Organisms → cellular organisms → Bacteria | 2403 | Open in IMG/M |
| 3300003797|Ga0007846_1024219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300003798|Ga0007842_1000214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5344 | Open in IMG/M |
| 3300003820|Ga0007863_1011320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 831 | Open in IMG/M |
| 3300003852|Ga0031655_10033142 | All Organisms → cellular organisms → Bacteria | 2370 | Open in IMG/M |
| 3300003852|Ga0031655_10048365 | All Organisms → cellular organisms → Bacteria | 1875 | Open in IMG/M |
| 3300003852|Ga0031655_10105240 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1133 | Open in IMG/M |
| 3300003852|Ga0031655_10396872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 513 | Open in IMG/M |
| 3300004095|Ga0007829_10004026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2852 | Open in IMG/M |
| 3300004095|Ga0007829_10126348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 532 | Open in IMG/M |
| 3300004126|Ga0066179_10020314 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300004481|Ga0069718_13613459 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300004481|Ga0069718_15373726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 849 | Open in IMG/M |
| 3300004481|Ga0069718_15636234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1342 | Open in IMG/M |
| 3300004685|Ga0065177_1031065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1008 | Open in IMG/M |
| 3300004686|Ga0065173_1008132 | All Organisms → cellular organisms → Bacteria | 1945 | Open in IMG/M |
| 3300004693|Ga0065167_1050128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
| 3300004694|Ga0065170_1003992 | All Organisms → cellular organisms → Bacteria | 2032 | Open in IMG/M |
| 3300004770|Ga0007804_1095954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 756 | Open in IMG/M |
| 3300004773|Ga0007795_10016278 | All Organisms → cellular organisms → Bacteria | 2592 | Open in IMG/M |
| 3300004774|Ga0007794_10030908 | All Organisms → Viruses → Predicted Viral | 1598 | Open in IMG/M |
| 3300004774|Ga0007794_10101310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 859 | Open in IMG/M |
| 3300004774|Ga0007794_10109547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 824 | Open in IMG/M |
| 3300004775|Ga0007798_10042106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1013 | Open in IMG/M |
| 3300004777|Ga0007827_10128074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
| 3300004804|Ga0007796_10088293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 970 | Open in IMG/M |
| 3300004804|Ga0007796_10108669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 853 | Open in IMG/M |
| 3300004804|Ga0007796_10166786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
| 3300004804|Ga0007796_10182659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
| 3300004805|Ga0007792_10037479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1470 | Open in IMG/M |
| 3300004805|Ga0007792_10045913 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1323 | Open in IMG/M |
| 3300004805|Ga0007792_10131970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
| 3300004807|Ga0007809_10002399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7567 | Open in IMG/M |
| 3300005517|Ga0070374_10195997 | Not Available | 1040 | Open in IMG/M |
| 3300005528|Ga0068872_10424724 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300005580|Ga0049083_10143228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
| 3300005662|Ga0078894_10783696 | Not Available | 835 | Open in IMG/M |
| 3300005662|Ga0078894_11600820 | Not Available | 537 | Open in IMG/M |
| 3300006072|Ga0007881_1059429 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300006100|Ga0007806_1022413 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1316 | Open in IMG/M |
| 3300006100|Ga0007806_1100276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300006104|Ga0007882_10241632 | Not Available | 598 | Open in IMG/M |
| 3300006108|Ga0007862_1027161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1245 | Open in IMG/M |
| 3300006114|Ga0007815_1088448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300006115|Ga0007816_1014784 | Not Available | 1847 | Open in IMG/M |
| 3300006116|Ga0007807_1029001 | All Organisms → Viruses → Predicted Viral | 1173 | Open in IMG/M |
| 3300006117|Ga0007818_1002204 | All Organisms → cellular organisms → Bacteria | 4750 | Open in IMG/M |
| 3300006118|Ga0007859_1079943 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300006118|Ga0007859_1095918 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
| 3300006119|Ga0007866_1018065 | Not Available | 1479 | Open in IMG/M |
| 3300006119|Ga0007866_1102291 | Not Available | 526 | Open in IMG/M |
| 3300006127|Ga0007805_1125036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
| 3300006128|Ga0007828_1018758 | Not Available | 1455 | Open in IMG/M |
| 3300007538|Ga0099851_1014744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3185 | Open in IMG/M |
| 3300007542|Ga0099846_1350991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
| 3300007708|Ga0102859_1126688 | Not Available | 743 | Open in IMG/M |
| 3300007708|Ga0102859_1126697 | Not Available | 743 | Open in IMG/M |
| 3300007861|Ga0105736_1046131 | Not Available | 866 | Open in IMG/M |
| 3300008113|Ga0114346_1002255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13075 | Open in IMG/M |
| 3300008259|Ga0114841_1143547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 958 | Open in IMG/M |
| 3300008266|Ga0114363_1122125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 903 | Open in IMG/M |
| 3300008267|Ga0114364_1041354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1718 | Open in IMG/M |
| 3300008267|Ga0114364_1139940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
| 3300008448|Ga0114876_1267706 | Not Available | 514 | Open in IMG/M |
| 3300009037|Ga0105093_10439184 | Not Available | 718 | Open in IMG/M |
| 3300009037|Ga0105093_10491173 | Not Available | 682 | Open in IMG/M |
| 3300009068|Ga0114973_10021150 | All Organisms → Viruses | 4041 | Open in IMG/M |
| 3300009082|Ga0105099_10035720 | Not Available | 2576 | Open in IMG/M |
| 3300009082|Ga0105099_10465456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
| 3300009082|Ga0105099_10693671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
| 3300009082|Ga0105099_11037363 | Not Available | 523 | Open in IMG/M |
| 3300009082|Ga0105099_11131628 | Not Available | 502 | Open in IMG/M |
| 3300009151|Ga0114962_10099440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1814 | Open in IMG/M |
| 3300009151|Ga0114962_10107029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1733 | Open in IMG/M |
| 3300009151|Ga0114962_10459582 | Not Available | 679 | Open in IMG/M |
| 3300009152|Ga0114980_10030960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3310 | Open in IMG/M |
| 3300009152|Ga0114980_10514465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
| 3300009154|Ga0114963_10020532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4403 | Open in IMG/M |
| 3300009155|Ga0114968_10000421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 31472 | Open in IMG/M |
| 3300009158|Ga0114977_10242038 | Not Available | 1044 | Open in IMG/M |
| 3300009163|Ga0114970_10056366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2520 | Open in IMG/M |
| 3300009164|Ga0114975_10049938 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2465 | Open in IMG/M |
| 3300009164|Ga0114975_10200745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1127 | Open in IMG/M |
| 3300009169|Ga0105097_10157183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1250 | Open in IMG/M |
| 3300009169|Ga0105097_10242136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 994 | Open in IMG/M |
| 3300009175|Ga0073936_10024087 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6497 | Open in IMG/M |
| 3300009180|Ga0114979_10001206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17385 | Open in IMG/M |
| 3300009180|Ga0114979_10693364 | Not Available | 577 | Open in IMG/M |
| 3300009181|Ga0114969_10140754 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1523 | Open in IMG/M |
| 3300009182|Ga0114959_10022921 | All Organisms → Viruses | 3924 | Open in IMG/M |
| 3300009182|Ga0114959_10501157 | Not Available | 586 | Open in IMG/M |
| 3300009183|Ga0114974_10000534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 31845 | Open in IMG/M |
| 3300009183|Ga0114974_10000641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 28770 | Open in IMG/M |
| 3300009502|Ga0114951_10008805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8192 | Open in IMG/M |
| 3300009502|Ga0114951_10610039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 523 | Open in IMG/M |
| 3300010157|Ga0114964_10078273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1669 | Open in IMG/M |
| 3300010157|Ga0114964_10155516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1110 | Open in IMG/M |
| 3300010158|Ga0114960_10166620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1173 | Open in IMG/M |
| 3300010885|Ga0133913_10983508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2183 | Open in IMG/M |
| 3300010885|Ga0133913_11865099 | Not Available | 1501 | Open in IMG/M |
| 3300011184|Ga0136709_1001178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4660 | Open in IMG/M |
| 3300011184|Ga0136709_1031977 | Not Available | 726 | Open in IMG/M |
| 3300011184|Ga0136709_1051000 | Not Available | 575 | Open in IMG/M |
| 3300012264|Ga0136715_1027240 | Not Available | 672 | Open in IMG/M |
| 3300012346|Ga0157141_1012755 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300012667|Ga0157208_10012128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1191 | Open in IMG/M |
| 3300013093|Ga0164296_1274669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300013093|Ga0164296_1392226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300013094|Ga0164297_10407907 | Not Available | 520 | Open in IMG/M |
| 3300013285|Ga0136642_1004128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5205 | Open in IMG/M |
| 3300013285|Ga0136642_1004655 | All Organisms → cellular organisms → Bacteria | 4796 | Open in IMG/M |
| 3300013285|Ga0136642_1034617 | Not Available | 1425 | Open in IMG/M |
| 3300013286|Ga0136641_1054441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1158 | Open in IMG/M |
| 3300014711|Ga0134314_106893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
| 3300014711|Ga0134314_110598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
| 3300014811|Ga0119960_1008106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 968 | Open in IMG/M |
| 3300014811|Ga0119960_1032991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 767 | Open in IMG/M |
| 3300015050|Ga0181338_1034140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
| 3300015050|Ga0181338_1056005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
| 3300017722|Ga0181347_1006372 | Not Available | 3895 | Open in IMG/M |
| 3300017722|Ga0181347_1211387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
| 3300017754|Ga0181344_1007305 | All Organisms → cellular organisms → Bacteria | 3638 | Open in IMG/M |
| 3300017754|Ga0181344_1106697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
| 3300017754|Ga0181344_1156527 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
| 3300017754|Ga0181344_1177849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
| 3300017766|Ga0181343_1024425 | Not Available | 1851 | Open in IMG/M |
| 3300017766|Ga0181343_1109146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 782 | Open in IMG/M |
| 3300017774|Ga0181358_1211734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300018414|Ga0194135_10013772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5200 | Open in IMG/M |
| 3300019784|Ga0181359_1034309 | Not Available | 1964 | Open in IMG/M |
| 3300020048|Ga0207193_1137090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2094 | Open in IMG/M |
| 3300020141|Ga0211732_1376201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
| 3300020158|Ga0194038_1000174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 27222 | Open in IMG/M |
| 3300020158|Ga0194038_1083409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 952 | Open in IMG/M |
| 3300020158|Ga0194038_1136916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 710 | Open in IMG/M |
| 3300020160|Ga0211733_11195525 | All Organisms → cellular organisms → Bacteria | 6801 | Open in IMG/M |
| 3300020161|Ga0211726_10454417 | Not Available | 544 | Open in IMG/M |
| 3300020528|Ga0208224_1015969 | Not Available | 1089 | Open in IMG/M |
| 3300020716|Ga0214207_1034911 | Not Available | 568 | Open in IMG/M |
| 3300020726|Ga0214220_1054979 | Not Available | 504 | Open in IMG/M |
| 3300020731|Ga0214170_1001303 | All Organisms → cellular organisms → Bacteria | 7113 | Open in IMG/M |
| 3300020735|Ga0214219_1044123 | Not Available | 656 | Open in IMG/M |
| 3300021131|Ga0214206_1040540 | Not Available | 515 | Open in IMG/M |
| 3300021133|Ga0214175_1004190 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2516 | Open in IMG/M |
| 3300021133|Ga0214175_1037524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
| 3300021354|Ga0194047_10000412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 29145 | Open in IMG/M |
| 3300021354|Ga0194047_10002721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10032 | Open in IMG/M |
| 3300021354|Ga0194047_10006245 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6322 | Open in IMG/M |
| 3300021354|Ga0194047_10018779 | Not Available | 3415 | Open in IMG/M |
| 3300021354|Ga0194047_10056471 | Not Available | 1766 | Open in IMG/M |
| 3300021519|Ga0194048_10002088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9938 | Open in IMG/M |
| 3300021519|Ga0194048_10220508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
| 3300021962|Ga0222713_10311230 | Not Available | 999 | Open in IMG/M |
| 3300021963|Ga0222712_10472936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
| 3300022063|Ga0212029_1013111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1048 | Open in IMG/M |
| 3300022063|Ga0212029_1032467 | Not Available | 735 | Open in IMG/M |
| 3300022179|Ga0181353_1005237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3045 | Open in IMG/M |
| 3300022190|Ga0181354_1185977 | Not Available | 628 | Open in IMG/M |
| 3300022407|Ga0181351_1110348 | All Organisms → Viruses → Predicted Viral | 1048 | Open in IMG/M |
| 3300022407|Ga0181351_1117345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1003 | Open in IMG/M |
| 3300022543|Ga0212119_1064599 | Not Available | 577 | Open in IMG/M |
| 3300022555|Ga0212088_10025778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7481 | Open in IMG/M |
| 3300022555|Ga0212088_10030561 | All Organisms → cellular organisms → Bacteria | 6555 | Open in IMG/M |
| 3300022555|Ga0212088_10358184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1013 | Open in IMG/M |
| 3300022591|Ga0236341_1017259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2303 | Open in IMG/M |
| 3300022591|Ga0236341_1086328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
| 3300022602|Ga0248169_103205 | All Organisms → Viruses | 18913 | Open in IMG/M |
| 3300022602|Ga0248169_115769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5070 | Open in IMG/M |
| 3300023091|Ga0224559_1230710 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → unclassified Gimesia → Gimesia sp. | 631 | Open in IMG/M |
| 3300023174|Ga0214921_10002161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 32344 | Open in IMG/M |
| 3300023311|Ga0256681_11160283 | Not Available | 780 | Open in IMG/M |
| 3300024348|Ga0244776_10049419 | Not Available | 3290 | Open in IMG/M |
| 3300024348|Ga0244776_10561707 | Not Available | 726 | Open in IMG/M |
| 3300025091|Ga0209616_1001826 | All Organisms → Viruses → Predicted Viral | 4047 | Open in IMG/M |
| 3300025091|Ga0209616_1016623 | Not Available | 746 | Open in IMG/M |
| 3300025091|Ga0209616_1024777 | Not Available | 608 | Open in IMG/M |
| 3300025353|Ga0208255_105342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1278 | Open in IMG/M |
| 3300025357|Ga0208383_1000007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 65153 | Open in IMG/M |
| 3300025358|Ga0208504_1024984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 787 | Open in IMG/M |
| 3300025358|Ga0208504_1034323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
| 3300025368|Ga0208620_1000003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 65567 | Open in IMG/M |
| 3300025379|Ga0208738_1013739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1352 | Open in IMG/M |
| 3300025381|Ga0208871_1000259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18949 | Open in IMG/M |
| 3300025381|Ga0208871_1002515 | Not Available | 4057 | Open in IMG/M |
| 3300025381|Ga0208871_1020908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 984 | Open in IMG/M |
| 3300025382|Ga0208256_1029726 | Not Available | 789 | Open in IMG/M |
| 3300025382|Ga0208256_1032707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 743 | Open in IMG/M |
| 3300025383|Ga0208250_1017554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1241 | Open in IMG/M |
| 3300025390|Ga0208743_1043972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 626 | Open in IMG/M |
| 3300025398|Ga0208251_1000151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 22639 | Open in IMG/M |
| 3300025413|Ga0208614_1006391 | Not Available | 2349 | Open in IMG/M |
| 3300025417|Ga0208616_1002415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3645 | Open in IMG/M |
| 3300025423|Ga0208746_1046085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 699 | Open in IMG/M |
| 3300025423|Ga0208746_1052523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
| 3300025429|Ga0208500_1005683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2140 | Open in IMG/M |
| 3300025430|Ga0208622_1058878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
| 3300025430|Ga0208622_1077276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 556 | Open in IMG/M |
| 3300025435|Ga0208618_1032652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 946 | Open in IMG/M |
| 3300025450|Ga0208744_1035961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1019 | Open in IMG/M |
| 3300025467|Ga0208260_1077634 | Not Available | 667 | Open in IMG/M |
| 3300025595|Ga0208248_1110465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
| 3300025606|Ga0207954_1054834 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1072 | Open in IMG/M |
| 3300025606|Ga0207954_1125648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
| 3300025616|Ga0208613_1018891 | Not Available | 1711 | Open in IMG/M |
| 3300025616|Ga0208613_1039023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1112 | Open in IMG/M |
| 3300025647|Ga0208160_1056984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1093 | Open in IMG/M |
| 3300025648|Ga0208507_1183453 | Not Available | 554 | Open in IMG/M |
| 3300025723|Ga0208741_10100489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
| 3300025777|Ga0208110_1008510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1299 | Open in IMG/M |
| 3300025778|Ga0208388_1041405 | Not Available | 673 | Open in IMG/M |
| 3300025782|Ga0208867_1007199 | Not Available | 1888 | Open in IMG/M |
| 3300027689|Ga0209551_1045537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1460 | Open in IMG/M |
| 3300027708|Ga0209188_1117831 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1041 | Open in IMG/M |
| 3300027736|Ga0209190_1148659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1018 | Open in IMG/M |
| 3300027741|Ga0209085_1228853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
| 3300027749|Ga0209084_1172469 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 890 | Open in IMG/M |
| 3300027754|Ga0209596_1000138 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 63710 | Open in IMG/M |
| 3300027759|Ga0209296_1009696 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5832 | Open in IMG/M |
| 3300027763|Ga0209088_10013137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4412 | Open in IMG/M |
| 3300027777|Ga0209829_10000726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 28761 | Open in IMG/M |
| 3300027792|Ga0209287_10045896 | Not Available | 1597 | Open in IMG/M |
| 3300027792|Ga0209287_10304822 | Not Available | 611 | Open in IMG/M |
| 3300027792|Ga0209287_10377126 | Not Available | 545 | Open in IMG/M |
| 3300027797|Ga0209107_10196083 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 999 | Open in IMG/M |
| 3300027804|Ga0209358_10000416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 37759 | Open in IMG/M |
| 3300027896|Ga0209777_10099218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2487 | Open in IMG/M |
| 3300027896|Ga0209777_10181714 | Not Available | 1707 | Open in IMG/M |
| 3300027896|Ga0209777_10184883 | Not Available | 1689 | Open in IMG/M |
| 3300027896|Ga0209777_10314477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1205 | Open in IMG/M |
| 3300027896|Ga0209777_10327009 | Not Available | 1176 | Open in IMG/M |
| 3300027896|Ga0209777_10408823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1019 | Open in IMG/M |
| 3300027896|Ga0209777_11168386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
| 3300027899|Ga0209668_10306237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1021 | Open in IMG/M |
| 3300027969|Ga0209191_1028086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2725 | Open in IMG/M |
| 3300027974|Ga0209299_1185542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 768 | Open in IMG/M |
| 3300028025|Ga0247723_1100901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
| 3300031707|Ga0315291_11339399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
| 3300031746|Ga0315293_10111250 | Not Available | 2315 | Open in IMG/M |
| 3300031759|Ga0316219_1001851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 21397 | Open in IMG/M |
| 3300031759|Ga0316219_1022010 | All Organisms → cellular organisms → Bacteria | 3030 | Open in IMG/M |
| 3300031759|Ga0316219_1055316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1616 | Open in IMG/M |
| 3300031772|Ga0315288_11254627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300031784|Ga0315899_11377243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| 3300031787|Ga0315900_10045288 | All Organisms → cellular organisms → Bacteria | 4704 | Open in IMG/M |
| 3300031884|Ga0316220_1002282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18122 | Open in IMG/M |
| 3300031884|Ga0316220_1122714 | Not Available | 959 | Open in IMG/M |
| 3300032053|Ga0315284_11829173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
| 3300032117|Ga0316218_1094362 | All Organisms → Viruses → Predicted Viral | 1182 | Open in IMG/M |
| 3300032173|Ga0315268_10891765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 893 | Open in IMG/M |
| 3300032579|Ga0316228_1035444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2108 | Open in IMG/M |
| 3300032605|Ga0316232_1099949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1304 | Open in IMG/M |
| 3300032665|Ga0316221_1056392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1563 | Open in IMG/M |
| 3300033816|Ga0334980_0303310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
| 3300034102|Ga0335029_0018496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5325 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 28.27% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 12.01% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 8.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 4.24% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 4.24% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.24% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 3.53% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.47% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 2.12% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 1.77% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater | 1.77% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.77% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.77% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.77% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 1.41% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.41% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.06% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.71% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.71% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.71% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.71% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.71% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.35% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.35% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.35% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.35% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.35% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.35% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.35% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.35% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.35% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.35% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000439 | Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300001836 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM27, ROCA_DNA191_0.2um_MCP-N_C_3a | Environmental | Open in IMG/M |
| 3300001849 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2b | Environmental | Open in IMG/M |
| 3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
| 3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
| 3300002202 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2012 | Environmental | Open in IMG/M |
| 3300002307 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300002933 | Combined Assembly of freshwater hypolimnion microbial communities from Trout Bog Lake, Wisconsin, USA | Environmental | Open in IMG/M |
| 3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300003785 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH06Jun08 | Environmental | Open in IMG/M |
| 3300003787 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 | Environmental | Open in IMG/M |
| 3300003789 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 | Environmental | Open in IMG/M |
| 3300003793 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Jun08 | Environmental | Open in IMG/M |
| 3300003797 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 | Environmental | Open in IMG/M |
| 3300003798 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 | Environmental | Open in IMG/M |
| 3300003820 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 | Environmental | Open in IMG/M |
| 3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
| 3300004095 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 | Environmental | Open in IMG/M |
| 3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300004685 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (version 2) | Environmental | Open in IMG/M |
| 3300004686 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (version 2) | Environmental | Open in IMG/M |
| 3300004693 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA7.5M (version 2) | Environmental | Open in IMG/M |
| 3300004694 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (version 2) | Environmental | Open in IMG/M |
| 3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
| 3300004773 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA1M | Environmental | Open in IMG/M |
| 3300004774 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M | Environmental | Open in IMG/M |
| 3300004775 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA17M | Environmental | Open in IMG/M |
| 3300004777 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07 | Environmental | Open in IMG/M |
| 3300004804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M | Environmental | Open in IMG/M |
| 3300004805 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M | Environmental | Open in IMG/M |
| 3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006072 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 | Environmental | Open in IMG/M |
| 3300006100 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 | Environmental | Open in IMG/M |
| 3300006104 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 | Environmental | Open in IMG/M |
| 3300006108 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 | Environmental | Open in IMG/M |
| 3300006114 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09 | Environmental | Open in IMG/M |
| 3300006115 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 | Environmental | Open in IMG/M |
| 3300006116 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Aug09 | Environmental | Open in IMG/M |
| 3300006117 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE08Jun09 | Environmental | Open in IMG/M |
| 3300006118 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 | Environmental | Open in IMG/M |
| 3300006119 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 | Environmental | Open in IMG/M |
| 3300006127 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 | Environmental | Open in IMG/M |
| 3300006128 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007861 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3um | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009175 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
| 3300012264 | Freshwater sediment bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - Sed-PBS metaG | Environmental | Open in IMG/M |
| 3300012346 | Freshwater microbial communities from Emily Creek, Ontario, Canada - S29 | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
| 3300013094 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG | Environmental | Open in IMG/M |
| 3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300014711 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0111 | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300018414 | Freshwater sediment microbial communities in response to fracking from North America - Little Laurel Run_MetaG_LLRF_2013 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020158 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-6m | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020528 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020716 | Freshwater microbial communities from Trout Bog Lake, WI - 13JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300020726 | Freshwater microbial communities from Trout Bog Lake, WI - 31JUL2007 hypolimnion | Environmental | Open in IMG/M |
| 3300020731 | Freshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 epilimnion | Environmental | Open in IMG/M |
| 3300020735 | Freshwater microbial communities from Trout Bog Lake, WI - 25JUL2007 hypolimnion | Environmental | Open in IMG/M |
| 3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300021133 | Freshwater microbial communities from Trout Bog Lake, WI - 09AUG2007 epilimnion | Environmental | Open in IMG/M |
| 3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022543 | Indian_combined assembly | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300022591 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2 | Environmental | Open in IMG/M |
| 3300022602 | Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnion | Environmental | Open in IMG/M |
| 3300023091 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34 | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025091 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025353 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH06Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025357 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025358 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025368 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025379 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025381 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025382 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025390 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025398 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025413 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025417 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025423 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025429 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025430 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025435 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025450 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025467 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025595 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M (SPAdes) | Environmental | Open in IMG/M |
| 3300025606 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M (SPAdes) | Environmental | Open in IMG/M |
| 3300025616 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025648 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025723 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025777 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH13Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025778 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025782 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE05Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031759 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003P | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031884 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18005 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032117 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032579 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18021 | Environmental | Open in IMG/M |
| 3300032605 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13 | Environmental | Open in IMG/M |
| 3300032665 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18007 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TBL_comb48_EPIDRAFT_10267833 | 3300000439 | Freshwater | MSTWLIAAMGLVYLVVAIDQFIKGGIGTGIMFLGYSMGNVGLVMVAK* |
| RCM27_10837542 | 3300001836 | Marine Plankton | MSTWLIAAMGVVYFVVACDQLMKGAPWIGVMFLGYAIGNLGLTMQVK* |
| RCM27_10956832 | 3300001836 | Marine Plankton | MSTWLIAAMGVVYFVVAIDQFFKGGVGTGIMFLGYAMGNVGLVMVAK* |
| RCM26_10753743 | 3300001849 | Marine Plankton | IAAMGLVYFIVALDQFYKGGVGTGIMFLGYAMGNVGLVMVAK* |
| RCM37_10198822 | 3300001850 | Marine Plankton | VSTWLVAAMGFVYFIVALDQFYKGGVGTGIMFLGYAMGNVGLVMVAK* |
| RCM31_100391885 | 3300001851 | Marine Plankton | MGVVYFVVAIDQFFKGGVGTGIMFLGYAMGNVGLVMVAK* |
| RCM31_100768053 | 3300001851 | Marine Plankton | MSTWLIAAMGLVYFIVAMDQFYKGGVGTGIMFLGYAMGNVGLVMVAK* |
| JGI24028J26656_10029023 | 3300002091 | Lentic | VSTWLIAAMGVVYFIVACDQFYKGGVGTGIMFLGYAMGNVGLVMVAK* |
| JGI24028J26656_10096192 | 3300002091 | Lentic | MSTWLIAAMGVVYFVVACDQFYKGGTGTGIMFLGYAMGNVGLVMVAK* |
| JGI24218J26658_10030282 | 3300002092 | Lentic | MSTWLIAAMGVVYFIVACDQFYKGGIGTGIMFLGYAMGNIGLVMVAK* |
| JGI24218J26658_10121234 | 3300002092 | Lentic | MSAWLIGAMGVVYAIVAIDQFIKGGVGQGIMFMGYAIGNVGLVIVAK* |
| metazooDRAFT_12517553 | 3300002202 | Lake | MSTWLIALMGLVYLYVGIEQFFKGSVGTGIMFIGYAIGNAGLVLVAK* |
| JGI24890J29729_10541662 | 3300002307 | Lentic | MSAWLIGAMGVVYAIVAIDQLIKGGVGQGIMFMGYAIGNVGLVIVAK* |
| B570J40625_1001269734 | 3300002835 | Freshwater | MSTWLIAAMGCVYFIVAIDQFMKGGVGTGIMFVGYAIGNVGLVLVAK* |
| G310J44882_1000310811 | 3300002933 | Freshwater | MSTWLIAAMGAVYFYIACEQFWKGSIGTGIMFLGYAIGNIGLVMVAK* |
| JGI26470J50227_10036215 | 3300003375 | Freshwater | VSTWLIAAMGVVYFVVACDQFYKGGIGTGIMFLGYAMGNIGLVMVAK* |
| JGI26470J50227_10045427 | 3300003375 | Freshwater | MSAWLVVVTGIIYFVVSLDQFRKGSVGTGIMFLGYSIGNVGILLTVK* |
| JGI26470J50227_10058313 | 3300003375 | Freshwater | MSTWLIAGMGIVYFIVALDQFRKGGIGTGIMFLGYAMGNVGLVMVAK* |
| JGI26470J50227_10058544 | 3300003375 | Freshwater | MSNWLVGAMGLVYLIIAADQFRKGGIGQGIMFLGYAIGNGGMLLVVK* |
| JGI26470J50227_10084393 | 3300003375 | Freshwater | MSTWLIAAMGVVYFIVAMDQFRKGGIGTGIMFLGYAMGNVGLVMVAK* |
| JGI26470J50227_10599331 | 3300003375 | Freshwater | MSTWLIAAMGVVYFIVAMDQFRKGGIGTGIMFLGYAMGNVG |
| JGI25911J50253_100915741 | 3300003411 | Freshwater Lake | MSTWLLAAMGCVYFIVAIDQFMKGGIGTGIMFIGYAVGNVGLVLVAK* |
| JGI25921J50272_100602481 | 3300003430 | Freshwater Lake | MSTWLIAAMGCVYFIVAIDQFMKGGVGTGIMFIGYAIGNAGLVLVAK* |
| Ga0007851_1043082 | 3300003785 | Freshwater | MSTWLIAAMGVVYFIVAMDQFYKGGIGTGIMFLGYAMGNVGLVMVAK* |
| Ga0007811_100000278 | 3300003787 | Freshwater | MSSWLVGLMGLVYLAVAVEQFMKGGYGQGIMFTGYAIGNAGILLVVK* |
| Ga0007835_10226831 | 3300003789 | Freshwater | MSTWLIAAMGLVYLVVAIDQFIKGGIGTGIMFLGYAMGNVGLVMVAK* |
| Ga0007847_10000165 | 3300003793 | Freshwater | MSTWLIAAMGVVYFVVAIDQFMKGGIGTGIMFLGYAMGNVGLVMVAK* |
| Ga0007847_1002816 | 3300003793 | Freshwater | MSTWLITAMGLVYLXVAIDQFIKGGIGTGIMXLGYAMGNVGLVMVAK* |
| Ga0007846_10025652 | 3300003797 | Freshwater | MSTWLVAAMGLVYFVVAVDQFIKGGMGTGIMFLGYAVGNVGLVLQVK* |
| Ga0007846_10242192 | 3300003797 | Freshwater | MSTWLIAAMGIVYFIVAMDQFRKGGIGTGIMFLGYAMGNVGLVMVAK* |
| Ga0007842_100021416 | 3300003798 | Freshwater | MSTWLVAAMGLVYFVVAIDQVIKGAPWFGVMFLGYAIGNLGLTMQVK* |
| Ga0007863_10113201 | 3300003820 | Freshwater | MSTWLIAGMGIVYFIVALDQFRKGGIGTGIMFLGYAMGNVG |
| Ga0031655_100331421 | 3300003852 | Freshwater Lake Sediment | RREGGFCVSTWLIAAMGVVYFVVACDQFYKGGIGTGIMFLGYAMGNIGLVMVAK* |
| Ga0031655_100483652 | 3300003852 | Freshwater Lake Sediment | MSTWLVAAMGLVYLVVAIDQFMKGGMGTGIMFLGYAIGNAGLVLQVK* |
| Ga0031655_101052403 | 3300003852 | Freshwater Lake Sediment | MSTWLVAAMGFVYFVVACDQFMKGGMGTGIMFLGYAIGNVGLVLQVK* |
| Ga0031655_103968722 | 3300003852 | Freshwater Lake Sediment | WLIALMGMVYFVVACDQFYKGGIGTSIMFLGYAIGNIGLVMVAK* |
| Ga0007829_100040262 | 3300004095 | Freshwater | MSTWLIALMGMVYFVVACDQFYKGGIGTSIMFLGYAIGNIGLVMVAK* |
| Ga0007829_101263481 | 3300004095 | Freshwater | MSTWLIAAMGLVYLVVAIDQFTKGGTGTGIMFLGYAIGNLGLIMVAK* |
| Ga0066179_100203142 | 3300004126 | Freshwater Lake | MSTWLIAGMGLVYFIVAIDQFMKGGIGTGIMFIGYAVGNVGLVLVAK* |
| Ga0069718_136134592 | 3300004481 | Sediment | MSTWLIGAMGIVYAVVAIDQFIKGGVGQGIMFMGYAIGNIGLVIVAK* |
| Ga0069718_153737261 | 3300004481 | Sediment | SWLIGVIGVVYFAVAIDQFIKGGVGTGIMFLGYALGNVGLVIVAK* |
| Ga0069718_156362342 | 3300004481 | Sediment | MSTWLIAAMGLVYFVVACDQFMKGGTGTGIMFLGYAIGNVGLVMVAK* |
| Ga0065177_10310652 | 3300004685 | Freshwater | MSTWLIAAMGVVYFIVAMDQFRKGGVGTGIMFLGYAMGNVGLVMVAK* |
| Ga0065173_10081322 | 3300004686 | Freshwater | MSTWLIGAMGLVYFVVAIDQFIKGGIGTGIMFLGYAMGNVGLVMVAK* |
| Ga0065167_10501282 | 3300004693 | Freshwater | MSTWLIAAMGVVYFVVAIDQFYKGGIGTGIMFLGYAIGNAGLVFVAK* |
| Ga0065170_10039923 | 3300004694 | Freshwater | MSTWLVAAMGLVYFVVAIDQVIKGAPWIGVMFLGYAIGNLGLTMQVK* |
| Ga0007804_10959543 | 3300004770 | Freshwater | IDSQQGRREGGFCVSTWLIAAMGVVYFVVACDQFYKGGIGTGIMFLGYAMGNIGLVMVAK |
| Ga0007795_100162784 | 3300004773 | Freshwater | MSTWLIAAMGLVYLYVGLEQFWKGSVGTGIMFIGYAIGNAGLVLVAK* |
| Ga0007794_100309083 | 3300004774 | Freshwater | MSTWLIAAMGVVYFVVAIDQFYKGGIGTGIMFLGYAMGNVGLVMVAK* |
| Ga0007794_101013102 | 3300004774 | Freshwater | MSTWLIAAMGVVYFIVAIDQFMKGGIGTGIMFLGYSMGNVGLVMVAK* |
| Ga0007794_101095472 | 3300004774 | Freshwater | MSTWLIAAMGVVYFVVACDQFYKGGIGTGIMFLGYAMGNIGLVMVAK* |
| Ga0007798_100421061 | 3300004775 | Freshwater | MSTWLIALMGMVYFVVACDQFYKGGIGTGIMFLGYAIGNIGLVMVAK* |
| Ga0007827_101280743 | 3300004777 | Freshwater | LIAAMGVVYFIVAMDQFRKGGIGTGIMFLGYAMGNVGLVMVAK* |
| Ga0007796_100882933 | 3300004804 | Freshwater | MSTWLIAAMGVVYFVVAIDQFIKGGVGTGIMFLGYAMGNVGLVMVAK* |
| Ga0007796_101086692 | 3300004804 | Freshwater | MSTWLIAAMGVVYFVVACDQFIKGGIGTGIMFLGYAMGNVGLVMVAK* |
| Ga0007796_101667862 | 3300004804 | Freshwater | MSTWLIAAMGVVYFIVAIDQFFKGGTGTGIMFLGYALGNVGLVLVAK* |
| Ga0007796_101826592 | 3300004804 | Freshwater | MSTWLIAAMGVVYFVVACDQFIKGGVGTGIMFLGYALGNMGLVMVAK* |
| Ga0007792_100374792 | 3300004805 | Freshwater | MSTWLIAAMGVVYFVVALDQFYKGGIGTGIMFLGYAMGNVGLVMVAK* |
| Ga0007792_100459131 | 3300004805 | Freshwater | MSTWLIALMGMVYFVVACDQFYKGGIGTGIMFLGYAVGNIGLVMVAK* |
| Ga0007792_101319702 | 3300004805 | Freshwater | MSTWLIAAMGFVYFVVAIDQFIKGGVGTGIMFLGYAIGNVGLVMVAK* |
| Ga0007809_1000239916 | 3300004807 | Freshwater | MSTWLVATMGLVYFVVAIDQVIKGAPWIGVMFLGYAIGNLGLTMQVK* |
| Ga0065704_104391422 | 3300005289 | Switchgrass Rhizosphere | MGLVYLYVAGEQLFKGGHGQAIMFFGYALGNLGLLFVVK* |
| Ga0070374_101959971 | 3300005517 | Freshwater Lake | MGCVYFIVAIDQFMKGGIGTGIMFIGYAVGNVGLVLVAK* |
| Ga0068872_104247241 | 3300005528 | Freshwater Lake | MSTWLIAAMGLVYFIVAIDQFMKGGVGTGIMFIGYAIGNVGLILVAK* |
| Ga0049083_101432281 | 3300005580 | Freshwater Lentic | AAMGCVYFIVAIDQFMKGGIGTGIMFIGYAVGNVGLVLVAK* |
| Ga0078894_107836963 | 3300005662 | Freshwater Lake | MSTWLIAAMGCVYFIVAIDQFMKGGVGTGIMFIGYAVGNVGLVLVAK* |
| Ga0078894_116008202 | 3300005662 | Freshwater Lake | RGLPMSTWLIAAMGFVYFIVAIDQFMKGGVGTGIMFIGYALGNVGLVMVAK* |
| Ga0007881_10594293 | 3300006072 | Freshwater | MSTWLIAAMGVVYFIVAMDQFRKGGIGTGIMFLGY |
| Ga0007806_10224131 | 3300006100 | Freshwater | RRLTQTGKSQRRRKGGLCMSTWLIAAMGVVYFIVAMDQFRKGGIGTGIMFLGYAMGNVGLVMVAK* |
| Ga0007806_11002761 | 3300006100 | Freshwater | GGLCMSTWLIAAMGVVYFIVAMDQFRKGGIGTGIMFLGYAMGNVGLVMVAK* |
| Ga0007882_102416323 | 3300006104 | Freshwater | VAAMGLVYFVVAVDQFIKGGMGTGIMFLGYAVGNVGLVLQVK* |
| Ga0007862_10271614 | 3300006108 | Freshwater | MSTWLIAAMGVVYFIVAVDQFIKGGVGTGIMFLGYAMGNVGLVMVAK* |
| Ga0007815_10884483 | 3300006114 | Freshwater | MGVVYFIVAMDQFRKGGIGTGIMFLGYAMGNVGLVMVAK* |
| Ga0007816_10147841 | 3300006115 | Freshwater | YFVVAVDQFIKGGMGTGIMFLGYAVGNVGLVLQVK* |
| Ga0007807_10290012 | 3300006116 | Freshwater | MSTWLVAAMGLVYFVVAVDQFIKGGMGTGIMFLGYAVG |
| Ga0007818_10022043 | 3300006117 | Freshwater | MGVVYFVVACDQFYKGGIGTGIMFLGYAMGNIGLVMVAK* |
| Ga0007859_10799433 | 3300006118 | Freshwater | VVYFYVACEQFYKGSMGTGIMFLGYAMGNIGLVMVAK* |
| Ga0007859_10959181 | 3300006118 | Freshwater | VSTNQRKCEGGFCMSTWLIAAMGVVYFIVAMDQFRKGGIGTGIMFLGYAMGNVGLVMVAK |
| Ga0007866_10180654 | 3300006119 | Freshwater | LCMSTWLIAAMGAVYFYIACEQFWKGSIGTGIMFLGYAIGNIGLVMVAK* |
| Ga0007866_11022912 | 3300006119 | Freshwater | MSTWLVATMGLVYFVVAIDQVIKGAPWFGVMFLGYAIGNLGLTMQVK* |
| Ga0007805_11250361 | 3300006127 | Freshwater | TWLIAGMGIVYFIVALDQFRKGGIGTGIMFLGYAMGNVGLVMVAK* |
| Ga0007828_10187581 | 3300006128 | Freshwater | ATMGLVYFVVAIDQVIKGGPWIGVMFLGYAIGNLGLTMQVK* |
| Ga0099851_10147442 | 3300007538 | Aqueous | MSTWLIAAMGFVYFIVACDQFIKGGVGTGIMFLGYAIGNVGLVMVAK* |
| Ga0099846_13509912 | 3300007542 | Aqueous | MSSWLIGVIGVVYAAVAIDQFLKGGVGQGIMFMGYAIGNVGLVIIAK* |
| Ga0102859_11266882 | 3300007708 | Estuarine | MSSWLIAVIGLVYFAVAIDQFIKGGVGTGIMFLGYALGNVGLVMVAK* |
| Ga0102859_11266972 | 3300007708 | Estuarine | MSSWLIAVIGVVYFAVAIDQFIKGGVGTGIMFLGYAMGNVGLVMVAK* |
| Ga0105736_10461313 | 3300007861 | Estuary Water | MSSWLIAVIGVVYFAVAIDQFIKGGVGTGIMFLGYALGNVGLVMVAK* |
| Ga0114346_10022553 | 3300008113 | Freshwater, Plankton | MSSWLIGIIGVVYFAVAIDQFIKGGVGTGIMFLGYALGNVGLVIVAK* |
| Ga0114841_11435471 | 3300008259 | Freshwater, Plankton | MSTWLIAVIGVVYFVVACDQFVKGGVGTGIMFLGYALGN |
| Ga0114363_11221251 | 3300008266 | Freshwater, Plankton | MSTWLIAAMGCVYFIVAIDQFLKGGVGTGIMFIGYAIGNAGLVLVAK* |
| Ga0114364_10413542 | 3300008267 | Freshwater, Plankton | MSSWLIGVIGVVYFAVAIDQFIKGGVGTGIMFLGYALGNVGLVIVAK* |
| Ga0114364_11399402 | 3300008267 | Freshwater, Plankton | MSTWLIAVIGVVYFVVACDQFVKGGVGTGIMFLGYALGNIGLIMVAK* |
| Ga0114876_12677062 | 3300008448 | Freshwater Lake | MSTWLIAAMGLVYFIVAIDQFMKGGVGTGIMFIGYAI |
| Ga0105093_104391842 | 3300009037 | Freshwater Sediment | MSTWLIAAMGVVYFYVACEQFWKGSMGTGIMFLGYAMGNIGLVMVAK* |
| Ga0105093_104911732 | 3300009037 | Freshwater Sediment | MSTWLIGAMGIVYAIVAIDQFIKGGVGQGIMFMGYAIGNIGLVIVAK* |
| Ga0114973_100211506 | 3300009068 | Freshwater Lake | MSTWLIAAMGVVYLHVAAEQMWKGSLGTAIMFLGYAIGNAGLVIVAK* |
| Ga0105099_100357203 | 3300009082 | Freshwater Sediment | MSTWLVAAMGLVYFYISMEQFFKGSPGTGIMFLGYAIGNVGLILQVK* |
| Ga0105099_104654562 | 3300009082 | Freshwater Sediment | MSTWLIAAMGIVYFVVACDQFIKGGTGTGIMFLGYAIGNVGLVMVAK* |
| Ga0105099_106936712 | 3300009082 | Freshwater Sediment | MSTWLIGAMGIVYAVVSVDQFIKGGVGQGIMFMGYAIGNIGLVIVAK* |
| Ga0105099_110373632 | 3300009082 | Freshwater Sediment | YFAVAIDQFMKGGVGQGIMFLGYALGNVGLVIVAK* |
| Ga0105099_111316282 | 3300009082 | Freshwater Sediment | MSSWLIGVIGVVYFAVAIDQFIKGGVGQGIMFMGYAIGNIGLVIVAK* |
| Ga0114962_100994402 | 3300009151 | Freshwater Lake | VSTWLIAAMGLVYLVVAIDQFIKGGVGTGIMFLGYAIGNVGLVIVAK* |
| Ga0114962_101070293 | 3300009151 | Freshwater Lake | MSTWLIAAMGVVYFIVACDQFYKGGIGTGIMFLGYAMGNVGLVMVAK* |
| Ga0114962_104595821 | 3300009151 | Freshwater Lake | LCMSTWLIAAMGVVYLYVAAEQMWKGSLGTAIMFLGYAIGNAGLVIVAK* |
| Ga0114980_100309603 | 3300009152 | Freshwater Lake | MSTWLIAAMGFVYFIVAIDQFMKGGVGTGIMFIGYALGNVGLVMVAK* |
| Ga0114980_105144651 | 3300009152 | Freshwater Lake | MSTWLIAAMGVVYFVVAIDQFMKGGIGTGIMFIGYATGNIGLVMVAK* |
| Ga0114963_100205323 | 3300009154 | Freshwater Lake | MSTWLIAAMGVVYFIVAIDQFVKGGVGTGIMFLGYAMGNVGLVMVAK* |
| Ga0114968_1000042126 | 3300009155 | Freshwater Lake | MSTWLIAAMGLVYLVVAIDQFIKGGVGTGIMFLGYAIGNVGLVIVAK* |
| Ga0114977_102420383 | 3300009158 | Freshwater Lake | LRMSTWLIAAMGVVYFYVACEQFWKGSTGTGIMFLGYAMGNVGLVMVAK* |
| Ga0114970_100563663 | 3300009163 | Freshwater Lake | MSTWLIAAMGVVYLYVAAEQMWKGSLGTAIMFLGYAIGNAGLVIVAK* |
| Ga0114975_100499385 | 3300009164 | Freshwater Lake | MSTWLIAAMGVVYFYVACEQFWKGSTGTGIMFLGYAMGNVGLVMVAK* |
| Ga0114975_102007452 | 3300009164 | Freshwater Lake | MSTWLIAAMGVVYFVVACDQFYKGGIGTGIMFLGYAMGNVGLVMVAK* |
| Ga0105097_101571833 | 3300009169 | Freshwater Sediment | MSSWLIGVIGLVYAAVAVDQFMKGGVGQGIMFMGYAIGNIGLVIVAK* |
| Ga0105097_102421362 | 3300009169 | Freshwater Sediment | MSSWLIAVIGVVYFIVACDQFLKGGTGTGIMFLGYALGNVGLVMVAK* |
| Ga0073936_1002408710 | 3300009175 | Freshwater Lake Hypolimnion | MSTWLIAAMGAVYFYIACEQFWKGSMGTGIMFLGYAIGNIGLVMVAK* |
| Ga0114979_100012069 | 3300009180 | Freshwater Lake | MSTWLIAAMGVVYFVVAIDQFMKGGIGTGIMFIGYAMGNVGLVMVAK* |
| Ga0114979_106933641 | 3300009180 | Freshwater Lake | MSTWLIAAMGVVYFVVAIDQFMKGGIGTGIMFIGYATGNIGLVM |
| Ga0114969_101407541 | 3300009181 | Freshwater Lake | VSTWLIAAMGLVYLIVAIDQFIKGGVGTGIMFLGYAIGNVGLVIVAK* |
| Ga0114959_100229215 | 3300009182 | Freshwater Lake | MSTWLIAAMGVVYFYVACEQFWKGSAGTGIMFLGYALGNIGLVMVAK* |
| Ga0114959_105011571 | 3300009182 | Freshwater Lake | MSTWLIAAMGVVYFVVACDQFIKGGVGTGIMFLGYALGNVGLVMVAK* |
| Ga0114974_100005344 | 3300009183 | Freshwater Lake | MSTWLIAAMGFVYFIVACDQFWKGGVGTGIMFLGYAIGNIGLVLVAK* |
| Ga0114974_100006414 | 3300009183 | Freshwater Lake | MSTWLIAAMGVVYFIVACDQFYKGGVGTGIMFLGYAMGNVGLVMVAK* |
| Ga0114951_1000880512 | 3300009502 | Freshwater | MSTWLVAAMGMVYAVVALDQFIKGGMGTGIMFLGYAIGNIGLVLQVK* |
| Ga0114951_106100392 | 3300009502 | Freshwater | FRMSTWLISLMGMVYFVVACDQFYKGGIGTGIMFLGYAIGNIGLVMVAK* |
| Ga0114964_100782732 | 3300010157 | Freshwater Lake | VSTWLIAAMGVIYLIVAIDQFIKGGVGTGIMFLGYAIGNVGLVIVAK* |
| Ga0114964_101555162 | 3300010157 | Freshwater Lake | MSAWLIGAMGVVYAIVAIDQFIKGGIGQGIMVMGYAIGNVGLVIVAK* |
| Ga0114960_101666202 | 3300010158 | Freshwater Lake | MSTWLIAAMGVVYLYVAAEQMWKGSFGTAIMFLGYAIGNAGLVIVAK* |
| Ga0133913_109835082 | 3300010885 | Freshwater Lake | MSTWLIAAMGLVYFIVAIDQFMKGGVGTGIMFIGYAVGNIGLVLVAK* |
| Ga0133913_118650991 | 3300010885 | Freshwater Lake | VYFYVACEQFWKGSAGTGIMFLGYALGNIGLVMVAK* |
| Ga0136709_100117810 | 3300011184 | Freshwater | MSTWLIGVIGVVYFAVAIDQFIKGGVGTGIMFLGYALGNVGLVMVAK* |
| Ga0136709_10319772 | 3300011184 | Freshwater | MSSWLIGVIGVVYFAVAIDQFIKGGVGTGIMFLGYALGNVGLVMVAK* |
| Ga0136709_10510002 | 3300011184 | Freshwater | AMGVVYFIVACDQFYKGGVGTGIMFLGYAMGNVGLVMVAK* |
| Ga0136715_10272402 | 3300012264 | Freshwater Sediment | MSSWLIGVIGLVYFAVAVDQFIKGGVGTGIMFLGYALGNVGLVMVAK* |
| Ga0157141_10127552 | 3300012346 | Freshwater | MSTWLIAAMGVVYFVVACDQFYKGGVGTGIMFLGYAMGNVGLVMVAK* |
| Ga0157208_100121281 | 3300012667 | Freshwater | MSTWLIAAMGVVYFVVACDQFYKGGVGTGIMFLGYAMGNVGLV |
| Ga0164296_12746691 | 3300013093 | Freshwater | RRRKGGLCMSTWLIAAMGVVYFIVAMDQFRKGGIGTGIMFLGYAMGNVGLVMVAK* |
| Ga0164296_13922261 | 3300013093 | Freshwater | GFFMSTWLIAGMGIVYFIVALDQFRKGGIGTGIMFLGYAMGNVGLVMVAK* |
| Ga0164297_104079072 | 3300013094 | Freshwater | MSTWLIAAMGVVYFVVALDQFRKGGIGTGIMFLGYAMGNVGLVMVAK* |
| Ga0136642_10041284 | 3300013285 | Freshwater | MSTWLIAAMGVVYFIVACDQFFKGGIGTGIMFLGYALGNIGLVMVAK* |
| Ga0136642_10046552 | 3300013285 | Freshwater | MSTWLIAAMGVVYFVVAIDQFLKGGTGTGIMFLGYALGNVGLVLVAK* |
| Ga0136642_10346174 | 3300013285 | Freshwater | MSTWLIAAMGFVYFIVACDQFMKGGTGTGIMFLGYAIGNVGLVLVAK* |
| Ga0136641_10544413 | 3300013286 | Freshwater | MSTWLIAGMGVVYFVVAIDQFYKGGIGTGIMFLGYAMGNVGLVMVAK* |
| Ga0134314_1068931 | 3300014711 | Surface Water | MSTWLIAAMGVVYFVVACDQFYKGGVGTGVMFLGYAIGNVGLVMVAK* |
| Ga0134314_1105982 | 3300014711 | Surface Water | MSTWLVAAMGFVYFVVACDQFIKGGMGTGIMFLGYAVGNVGLVLQVK* |
| Ga0119960_10081062 | 3300014811 | Aquatic | MSSWLIGVIGLVYFAVAIDQFIKGGVGTGIMFLGYALGNVGLVMVAK* |
| Ga0119960_10329913 | 3300014811 | Aquatic | VSQSRSWLIAAMGVVYFVVAIDQFIKGGVGTGIMFLGYAMGNVGLVMVAK* |
| Ga0181338_10341402 | 3300015050 | Freshwater Lake | MSTWLIAGMGLVYFIVAIDQFMKGGVGTGIMFIGYAVGNIGLVLVAK* |
| Ga0181338_10560051 | 3300015050 | Freshwater Lake | MSTWLIAAMGLVYFIVAIDQFMKGGVGTGIMFIGY |
| Ga0181347_10063724 | 3300017722 | Freshwater Lake | MSTWLIAAMGFVYFIVAIDQFLKGGVGTGIMFIGYALGNVGLVMVAK |
| Ga0181347_12113871 | 3300017722 | Freshwater Lake | IAGMGLVYFIVAIDQFMKGGIGTGIMFVGYAIGNVGLILVAK |
| Ga0181344_10073056 | 3300017754 | Freshwater Lake | MSTWLIAAMGLVYLYVGLEQFWKGSVGTGIMFIGYAIGNAGLVMVAK |
| Ga0181344_11066971 | 3300017754 | Freshwater Lake | MSTWLIAAMGCVYFIVAIDQFMKGGVGTGIMFIGYAIGNAG |
| Ga0181344_11565272 | 3300017754 | Freshwater Lake | MSTWLIAAMGVVYFIVACDQFCKGGVGTGIMFLGYAMGNVGLVMVS |
| Ga0181344_11778493 | 3300017754 | Freshwater Lake | STWLIAAMGCVYFIVAIDQFMKGGVGTGIMFIGYAIGNAGLVLVAK |
| Ga0181343_10244254 | 3300017766 | Freshwater Lake | MSTWLIAAMGVVYFIVACDQFYKGGVGTGIMFLGYAMGNIGLVMVAK |
| Ga0181343_11091462 | 3300017766 | Freshwater Lake | MSTWLIAAMGCVYFIVAVDQFMKGGVGTGIMFIGYAIGNAGLVLVAK |
| Ga0181358_12117342 | 3300017774 | Freshwater Lake | MGLVYFIVAIDQFMKGGVGTGIMFIGYAVGNIGLVLVAK |
| Ga0194135_1001377212 | 3300018414 | Watersheds | MSTWLVAAMGLVYAVVAIDQFIKGGVGTGIMFLGYAIGNIGLILQVK |
| Ga0181359_10343094 | 3300019784 | Freshwater Lake | MSTWLIAAMGFVYFIVAIDQFMKGGVGTGIMFIGYALGNVGLVMVAK |
| Ga0207193_11370902 | 3300020048 | Freshwater Lake Sediment | XXXXLSHGGGKFMSSWLIGVIGVVYFAVAIDQFIKGGVGTGIMFLGYALGNVGLVIVAK |
| Ga0211732_13762011 | 3300020141 | Freshwater | TWLIAAMGCVYFIVAIDQFMKGGVGTGIMFIGYALGNVGLVMVAK |
| Ga0194038_100017410 | 3300020158 | Anoxic Zone Freshwater | VSTWLIAAMGVVYFVVACDQFYKGGVGTGIMFLGYALGNVGLVMVAK |
| Ga0194038_10834092 | 3300020158 | Anoxic Zone Freshwater | MSAWLIGAMGIVYAIVAIDQFIKGGVGQGIMFMGYAIGNIGLVIVAK |
| Ga0194038_11369161 | 3300020158 | Anoxic Zone Freshwater | MSTWLIALMGMVYFVVACDQFYKGGIGTSIMFLGYAIGNIG |
| Ga0211733_111955255 | 3300020160 | Freshwater | MSTWLIAAMGCVYFIVAIDQFMKGGVGTGIMFIGYALGNVGLVMVAK |
| Ga0211726_104544171 | 3300020161 | Freshwater | WLIAAMGCVYFIVAIDQFMKGGVGTGIMFIGYAVGNVGLVLVAK |
| Ga0208224_10159693 | 3300020528 | Freshwater | MSTWLIAAMGCVYFIVAIDQFMKGGVGTGIMFVGYAIGNVGLVLVAK |
| Ga0214207_10349112 | 3300020716 | Freshwater | MSSWLVGLMGLVYLAVAVEQFMKGGYGQGIMFTGYAIGNAGILLVVK |
| Ga0214220_10549792 | 3300020726 | Freshwater | MSTWLIAAMGAVYFYIACEQFWKGSIGTGIMFLGYAIGNIGLVMVAK |
| Ga0214170_10013032 | 3300020731 | Freshwater | MSTWLIAAMGVVYFIVAMDQFRKGGIGTGIMFLGYAMGNVGLVMVAK |
| Ga0214219_10441233 | 3300020735 | Freshwater | MSSWLVVVTGIIYFVVSLDQFRKGSVGTGIMFLGYSIGNAGILLTVK |
| Ga0214206_10405402 | 3300021131 | Freshwater | RCQGRLCMSSWLVVVTGIIYFVVAIDQFRKGSVGTGIMFLGYSIGNVGILLTVK |
| Ga0214175_10041905 | 3300021133 | Freshwater | MSTWLIAGMGIVYFIVALDQFRKGGIGTGIMFLGYAMGNVGLVMVAK |
| Ga0214175_10375241 | 3300021133 | Freshwater | MSTWLIAAMGLVYLVVAIDQFIKGGIGTGIMFLGY |
| Ga0194047_1000041248 | 3300021354 | Anoxic Zone Freshwater | VSTWLIAAMGVVYFVVAIDQFYKGGLGTGIMFLGYAMGNVGLVMVAK |
| Ga0194047_1000272120 | 3300021354 | Anoxic Zone Freshwater | MSTWLVAAMGLVYLVVSIDQFTKGATGQGIMFLGYAIGNAGILLVVK |
| Ga0194047_100062454 | 3300021354 | Anoxic Zone Freshwater | MSTWLIAAMGLVYLIVAVDQFFKGGLGQAIMFFGYAIGNLGLVIVAK |
| Ga0194047_100187796 | 3300021354 | Anoxic Zone Freshwater | VYFVVACDQFIKGGVGTGIMFLGYALGNVGLVMVAK |
| Ga0194047_100564712 | 3300021354 | Anoxic Zone Freshwater | MSTWLIGAIGIVYAVVAIDQFIKGGVGQGIMFMGYAIGNIGLVIIAK |
| Ga0194048_100020886 | 3300021519 | Anoxic Zone Freshwater | MSTWLIAGMGVTYFIVAIDQFMKGGVGTGIMFLGYAMGNVGLVMVAK |
| Ga0194048_102205082 | 3300021519 | Anoxic Zone Freshwater | MSTWLIAAMGVVYFIVAIDQFFKGGTGTGIMFLGYALGNVGLVLVAK |
| Ga0222713_103112303 | 3300021962 | Estuarine Water | TWLIAAMGFVYFIVAIDQFMKGGVGTGIMFIGYALGNVGLVMVAK |
| Ga0222712_104729362 | 3300021963 | Estuarine Water | MSTWLIAAMGCVYFIVAIDQFMKGGVGTGIMFIGYAIGNVGLILV |
| Ga0212029_10131113 | 3300022063 | Aqueous | YFIVACDQFIKGGVGTGIMFLGYAIGNVGLVMVAK |
| Ga0212029_10324672 | 3300022063 | Aqueous | MSSWLIGVIGLVYAAVAIDQFIKGGIGQGIMFMGYAIGNIGLVIVAK |
| Ga0181353_10052376 | 3300022179 | Freshwater Lake | MSTWLIAAMGLVYFIVAIDQFMKGGVGTGIMFIGYAIGNAGLVLVAK |
| Ga0181354_11859772 | 3300022190 | Freshwater Lake | MSTWLIAAMGLVYFIVAIDQFMKGGVGTGIMFIGYAVGNVGLVLVAK |
| Ga0181351_11103482 | 3300022407 | Freshwater Lake | MSTWLIAAMGLVYFIVAIDQFMKGGVGTGIMFIGYAVGNIGLVLVAK |
| Ga0181351_11173452 | 3300022407 | Freshwater Lake | MSTWLIAGMGLVYFIVAIDQFMKGGIGTGIMFIGYAVGNVGLVLVAK |
| Ga0212119_10645992 | 3300022543 | Freshwater | MSSWLIGVIGLVYFAVAVDQFIKGGVGTGIMFLGYALGNVGLVMVAK |
| Ga0212088_100257785 | 3300022555 | Freshwater Lake Hypolimnion | MSTWLIAAMGAVYFYIACEQFWKGSMGTGIMFLGYAIGNIGLVMVAK |
| Ga0212088_100305615 | 3300022555 | Freshwater Lake Hypolimnion | MSTWLVAAMGMVYAVVALDQFIKGGMGTGIMFLGYAIGNIGLVLQVK |
| Ga0212088_103581842 | 3300022555 | Freshwater Lake Hypolimnion | MSTWLISLMGMVYFVVACDQFYKGGIGTGIMFLGYAIGNIGLVMVAK |
| Ga0236341_10172592 | 3300022591 | Freshwater | VSTWLIAAMGVVYFVVACDQFYKGGIGTGIMFLGYAMGNIGLVMVAK |
| Ga0236341_10863282 | 3300022591 | Freshwater | MSTWLIAAMGVVYFIVAIDQFMKGGIGTGIMFLGYSMGNVGLVMVAK |
| Ga0248169_1032057 | 3300022602 | Freshwater | MSAWLVGAMGMIYFYVACEQLYKGSIGTAIMFFGYAFGNVGIVLQVK |
| Ga0248169_1157698 | 3300022602 | Freshwater | MSAWLVVVTGIIYFVVSLDQFRKGSVGTGIMFLGYSIGNVGILLTVK |
| Ga0224559_12307102 | 3300023091 | Soil | VSSWLVVLTGTIYLIVAIDQFRKGSVGTGIMFLGYAIGNVGILLTVK |
| Ga0214921_100021615 | 3300023174 | Freshwater | MSTWLIAAMGVVYFVVAIDQFMKGGVGTGIMFIGYALGNVGLVMVAK |
| Ga0256681_111602832 | 3300023311 | Freshwater | MSTWLIAAMGVVYFIVAIDQFMKGGTGTGIMFLGYAMGNVGLVMVAK |
| Ga0244776_100494194 | 3300024348 | Estuarine | MSSWLIAVIGVVYFAVAIDQFIKGGVGTGIMFLGYAMGNVGLVMVAK |
| Ga0244776_105617072 | 3300024348 | Estuarine | MSSWLIAVIGLVYFAVAIDQFIKGGVGTGIMFLGYALGNVGLVMVAK |
| Ga0209616_10018263 | 3300025091 | Freshwater | MSTWLIGVIGVVYFAVAIDQFIKGGVGTGIMFLGYALGNVGLVMVAK |
| Ga0209616_10166232 | 3300025091 | Freshwater | MSSWLIGVIGVVYFAVAIDQFIKGGVGTGIMFLGYALGNVGLVMVAK |
| Ga0209616_10247771 | 3300025091 | Freshwater | AMGVVYFIVACDQFYKGGVGTGIMFLGYAMGNVGLVMVAK |
| Ga0208255_1053423 | 3300025353 | Freshwater | MSTWLIAAMGVVYFIVAMDQFYKGGIGTGIMFLGYAMGNVGLVMVAK |
| Ga0208383_100000786 | 3300025357 | Freshwater | MSTWLVAAMGLVYFVVAIDQVIKGAPWFGVMFLGYAIGNLGLTMQVK |
| Ga0208504_10249842 | 3300025358 | Freshwater | MSTWLIGAMGLVYFVVAIDQFIKGGIGTGIMFLGYAMGNVGLVMVAK |
| Ga0208504_10343231 | 3300025358 | Freshwater | YFIVAMDQFRKGGIGTGIMFLGYAMGNVGLVMVAK |
| Ga0208620_10000031 | 3300025368 | Freshwater | MSTWLIAAMGVVYFVVAIDQFMKGGIGTGIMFLGYAMGNVGLVMVAK |
| Ga0208738_10137392 | 3300025379 | Freshwater | MSTWLVAAMGLVYFVVAVDQFIKGGMGTGIMFLGYAVGNVG |
| Ga0208871_100025915 | 3300025381 | Freshwater | MSTWLVAAMGLVYFVVAVDQFIKGGMGTGIMFLGYAVGNVGLVLQVK |
| Ga0208871_10025156 | 3300025381 | Freshwater | CEGGLCMSTWLIAAMGVVYFIVAMDQFRKGGIGTGIMFLGYAMGNVGLVMVAK |
| Ga0208871_10209082 | 3300025381 | Freshwater | MSTWLIAAMGIVYFIVAMDQFRKGGIGTGIMFLGYAMGNVGLVMVAK |
| Ga0208256_10297263 | 3300025382 | Freshwater | MSTWLVATMGLVYFVVAIDQVIKGAPWIGVMFLGYAIGNLGLTMQVK |
| Ga0208256_10327071 | 3300025382 | Freshwater | VVYFIVAVDQFIKGGVGTGIMFLGYAMGNVGLVMVAK |
| Ga0208250_10175544 | 3300025383 | Freshwater | AMGVVYFIVAMDQFRKGGIGTGIMFLGYAMGNVGLVMVAK |
| Ga0208743_10439721 | 3300025390 | Freshwater | MSTWLIAAMGVVYFIVAVDQFIKGGVGTGIMFLGYAMGNVGLVM |
| Ga0208251_100015123 | 3300025398 | Freshwater | MGVVYFVVACDQFYKGGIGTGIMFLGYAMGNIGLVMVAK |
| Ga0208614_10063911 | 3300025413 | Freshwater | TWLIAAMGVVYFIVAMDQFRKGGIGTGIMFLGYAMGNVGLVMVAK |
| Ga0208616_10024155 | 3300025417 | Freshwater | MSTWLVAAMGLVYFVVAIDQVIKGGPWIGVMFLGYAIGNLGLTMQVK |
| Ga0208746_10460852 | 3300025423 | Freshwater | MSTWLIAAMGLVYLVVAIDQFIKGGIGTGIMFLGYAM |
| Ga0208746_10525231 | 3300025423 | Freshwater | MSTWLIALMGMVYFVVACDQFYKGGIGTSIMFLGYAIGNIGLVMVAK |
| Ga0208500_10056833 | 3300025429 | Freshwater | MSTWLVAAMGLVYFVVAIDQVIKGAPWIGVMFLGYAIGNLGLTMQVK |
| Ga0208622_10588782 | 3300025430 | Freshwater | MSTWLIAAMGVVYFVVAIDQFMKGGIGTGIMFLGYAMGNVGL |
| Ga0208622_10772762 | 3300025430 | Freshwater | MSTWLIAAMGLVYLVVAIDQFTKGGTGTGIMFLGYAIGNLGLIMVAK |
| Ga0208618_10326522 | 3300025435 | Freshwater | MSTWLIAAMGVVYFIVAMDQFRKGGVGTGIMFLGYAMGNVGLVMVAK |
| Ga0208744_10359611 | 3300025450 | Freshwater | STWLIAAMGVVYFIVAMDQFRKGGIGTGIMFLGYAMGNVGLVMVAK |
| Ga0208260_10776343 | 3300025467 | Freshwater | RRCEGGLCMSTWLVAAMGLVYFVVAVDQFIKGGMGTGIMFLGYAVGNVGLVLQVK |
| Ga0208248_11104652 | 3300025595 | Freshwater | MSTWLIAAMGVVYFVVAIDQFYKGGIGTGIMFLGYAMGNVGLVMVAK |
| Ga0207954_10548342 | 3300025606 | Freshwater | MSTWLIAAMGVVYFVVACDQFIKGGVGTGIMFLGYALGNMGLVMVAK |
| Ga0207954_11256482 | 3300025606 | Freshwater | MSTWLIAAMGVVYFIVAIDQFFKGGTGTGIMFLGYAMGNVGLVMVAK |
| Ga0208613_10188912 | 3300025616 | Freshwater | MSTWLIAAMGVVYFVVACDQFYKGGIGTGIMFLGYAMGNIGLVMVAK |
| Ga0208613_10390232 | 3300025616 | Freshwater | MSTWLIAAMGVVYFVVALDQFYKGGIGTGIMFLGYAMGNVGLVMVAK |
| Ga0208160_10569843 | 3300025647 | Aqueous | MSTWLIAAMGFVYFIVACDQFIKGGVGTGIMFLGYAIGNVGLVMVAK |
| Ga0208507_11834531 | 3300025648 | Freshwater | VAAMGLVYFVVAVDQFIKGGMGTGIMFLGYAVGNVGLVLQVK |
| Ga0208741_101004891 | 3300025723 | Freshwater | MSTWLIAAMGLVYLVVAIDQFIKGGIGTGIMFLGYAMGNVGLVM |
| Ga0208110_10085104 | 3300025777 | Freshwater | MGVVYFIVAMDQFYKGGIGTGIMFLGYAMGNVGLVMVAK |
| Ga0208388_10414053 | 3300025778 | Freshwater | LCMSTWLIAAMGAVYFYIACEQFWKGSIGTGIMFLGYAIGNIGLVMVAK |
| Ga0208867_10071991 | 3300025782 | Freshwater | ITAMGLVYLIVAIDQFIKGGIGTGIMFLGYAMGNVGLVMVAK |
| Ga0209551_10455371 | 3300027689 | Freshwater Lake | MSTWLLAAMGCVYFIVAIDQFMKGGIGTGIMFIGYAVGNV |
| Ga0209188_11178312 | 3300027708 | Freshwater Lake | MSTWLIAAMGVVYFYVACEQFWKGSAGTGIMFLGYALGNIGLVMVAK |
| Ga0209190_11486592 | 3300027736 | Freshwater Lake | MSTWLIAAMGVVYLYVAAEQMWKGSLGTAIMFLGYAIGNAGLVIVAK |
| Ga0209085_12288532 | 3300027741 | Freshwater Lake | MSTWLIAAMGVVYFIVAIDQFVKGGVGTGIMFLGYAMGNVGLVMVAK |
| Ga0209084_11724691 | 3300027749 | Freshwater Lake | RKRKRQGRFRVSTWLIAAMGLVYLVVAIDQFIKGGVGTGIMFLGYAIGNVGLVIVAK |
| Ga0209596_100013833 | 3300027754 | Freshwater Lake | MGLVYLVVAIDQFIKGGVGTGIMFLGYAIGNVGLVIVAK |
| Ga0209296_100969614 | 3300027759 | Freshwater Lake | MSTWLIAAMGFVYFIVACDQFWKGGVGTGIMFLGYAIGNIGLVLVAK |
| Ga0209088_100131374 | 3300027763 | Freshwater Lake | MSTWLIAAMGVVYFVVAIDQFMKGGIGTGIMFIGYAMGNVGLVMVAK |
| Ga0209829_1000072651 | 3300027777 | Freshwater Lake | MSTWLIAAMGLVYLVVAIDQFIKGGVGTGIMFLGYAIGNVGLVIVAK |
| Ga0209287_100458962 | 3300027792 | Freshwater Sediment | MSTWLVAAMGLVYFYISMEQFFKGSPGTGIMFLGYAIGNVGLILQVK |
| Ga0209287_103048222 | 3300027792 | Freshwater Sediment | MSTWLIGAMGIVYAVVSVDQFIKGGVGQGIMFMGYAIGNIGLVIVAK |
| Ga0209287_103771262 | 3300027792 | Freshwater Sediment | MSTWLIAAMGIVYFVVACDQFIKGGTGTGIMFLGYAIGNVGLVMVAK |
| Ga0209107_101960832 | 3300027797 | Freshwater And Sediment | MSTWLIAGMGLVYFIVAIDQFMKGGIGTGIMFIGYAVGNVGLVLVA |
| Ga0209358_1000041620 | 3300027804 | Freshwater Lake | MGLVYFIVAIDQFMKGGVGTGIMFIGYAIGNAGLVLVAK |
| Ga0209777_100992183 | 3300027896 | Freshwater Lake Sediment | MSTWLVAAMGMVYLVVAIDQFIKGGFGTGIMFLGYAIGNVGLVLQVK |
| Ga0209777_101817144 | 3300027896 | Freshwater Lake Sediment | MSTWLVAAMGLVYLVVAIDQFMKGGMGTGIMFLGYAIGNAGLVLQVK |
| Ga0209777_101848834 | 3300027896 | Freshwater Lake Sediment | MSTWLVAAMGFVYFVVACDQFMKGGMGTGIMFLGYAIGNVGLVLQVK |
| Ga0209777_103144772 | 3300027896 | Freshwater Lake Sediment | MSTWLIAAMGVVYFVVAIDQFMKGGIGTGIMFIGYATGNIGLVMVAK |
| Ga0209777_103270091 | 3300027896 | Freshwater Lake Sediment | FGGIMSTWLVATMGLVYFVVAIDQVIKGGPWIGVMFLGYAIGNLGLTMQVK |
| Ga0209777_104088232 | 3300027896 | Freshwater Lake Sediment | MSTWLIAAMGVVYFIVAMDQFRKGGIGTGIMFLGYAM |
| Ga0209777_111683861 | 3300027896 | Freshwater Lake Sediment | MSTWLVAAMGLVYFVVAIDQFIKGGMGTGIMFLGYAIGNVGLVLQVK |
| Ga0209668_103062372 | 3300027899 | Freshwater Lake Sediment | MSTWLIAAMGVVYFYVACEQFWKGSAGTGIMFLGYAMGNVGLVMVAK |
| Ga0209191_10280862 | 3300027969 | Freshwater Lake | MSTWLIAAMGVVYFYVACEQFWKGSTGTGIMFLGYAMGNVGLVMVAK |
| Ga0209299_11855421 | 3300027974 | Freshwater Lake | MSTWLIAAMGFVYFIVAIDQFMKGGVGTGIMFIGYALG |
| Ga0247723_11009013 | 3300028025 | Deep Subsurface Sediment | MSTWLIAGMGIVYFVVAMDQFYKGGVGTGIMFLGYALGNVGLVMVAK |
| Ga0315291_113393992 | 3300031707 | Sediment | MSTWLIAAMGVVYFIVALDQFWKGGVGTGIMFIGYALGNVGLVMVAK |
| Ga0315293_101112505 | 3300031746 | Sediment | MSTWLLAAMGCVYFIVAIDQFMKGGVGTGIMFIGYAVGNVGLVLVAK |
| Ga0316219_10018517 | 3300031759 | Freshwater | MSTWLIGAMGIVYAIVSIDQFIKGGVGQGIMFMGYAIGNIGLVIVAK |
| Ga0316219_10220102 | 3300031759 | Freshwater | MSSWLVVVTGTIYLVVSIDQFRKGSVGTGIMFLGYAIGNIGILLTVK |
| Ga0316219_10553164 | 3300031759 | Freshwater | MSTWLIGAMGVVYFVVALDQFRKGGIGTGIMFLGYAMGNVGLVMVAK |
| Ga0315288_112546271 | 3300031772 | Sediment | MSTWLIAAMGVVYFVVAIDQFVKGDVGTGIMFLGYAMGNVGLVMVAK |
| Ga0315899_113772431 | 3300031784 | Freshwater | AAMGLVYFIVAIDQFMKGGVGTGIMFIGYAIGNVGLILVAK |
| Ga0315900_100452882 | 3300031787 | Freshwater | MGLVYFIVAIDQFMKGGVGTGIMFIGYAIGNVGLILVAK |
| Ga0316220_10022826 | 3300031884 | Freshwater | MGIVYAIVSIDQFIKGGVGQGIMFMGYAIGNIGLVIVAK |
| Ga0316220_11227143 | 3300031884 | Freshwater | MSTWLIAAMGAVYFYIACEQFWKGSIGTGIMFLGYAIGNIGL |
| Ga0315284_118291731 | 3300032053 | Sediment | WLLAAMGCVYFIVAIDQFMKGGVGTGIMFIGYAVGNVGLVLVAK |
| Ga0316218_10943622 | 3300032117 | Freshwater | MSSWLIGAMGVVYFYVACEQFSKGGIGQGIMFMGYAIGNIGLVIVAK |
| Ga0315268_108917652 | 3300032173 | Sediment | MSTWLIAAMGVIYLVVAIDQFFKGGVGTGIMFLGYAIGNVGLVIVAK |
| Ga0316228_10354444 | 3300032579 | Freshwater | MSTWLIGAMGIVYAIVSIDQFIKGGVGQGIMFMGYAIGNIGLVI |
| Ga0316232_10999491 | 3300032605 | Freshwater | MSTWLIGAMGVVYFVVALDQFRKGGIGTGIMFLGYAMGNVGL |
| Ga0316221_10563923 | 3300032665 | Freshwater | MSNWLVGAMGLVYLIIAADQFRKGGIGQGIMFLGYAIGNGGMLLVVK |
| Ga0334980_0303310_503_619 | 3300033816 | Freshwater | MSTWLIAAMGFVYFIVAIDQFMKGGVGTGIMFIGYALGN |
| Ga0335029_0018496_2900_3043 | 3300034102 | Freshwater | MSTWLIAAMGLVYFIVACDQFLKGGVGTGIMFIGYALGNVGLVMVAK |
| ⦗Top⦘ |