| Basic Information | |
|---|---|
| Family ID | F012074 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 284 |
| Average Sequence Length | 46 residues |
| Representative Sequence | EQTELLTKVNRLTIPVRVFSIGSGVFLLVLVAMLIYQKLNEVQ |
| Number of Associated Samples | 218 |
| Number of Associated Scaffolds | 283 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.87 % |
| % of genes near scaffold ends (potentially truncated) | 94.01 % |
| % of genes from short scaffolds (< 2000 bps) | 85.21 % |
| Associated GOLD sequencing projects | 194 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (61.620 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (10.211 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.831 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.296 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.75% β-sheet: 0.00% Coil/Unstructured: 42.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 283 Family Scaffolds |
|---|---|---|
| PF01165 | Ribosomal_S21 | 2.12 |
| PF00034 | Cytochrom_C | 1.06 |
| PF15780 | ASH | 1.06 |
| PF12704 | MacB_PCD | 1.06 |
| PF13437 | HlyD_3 | 1.06 |
| PF04075 | F420H2_quin_red | 0.71 |
| PF13545 | HTH_Crp_2 | 0.71 |
| PF09286 | Pro-kuma_activ | 0.71 |
| PF12867 | DinB_2 | 0.71 |
| PF01053 | Cys_Met_Meta_PP | 0.35 |
| PF02368 | Big_2 | 0.35 |
| PF00701 | DHDPS | 0.35 |
| PF00285 | Citrate_synt | 0.35 |
| PF00239 | Resolvase | 0.35 |
| PF01833 | TIG | 0.35 |
| PF04240 | Caroten_synth | 0.35 |
| PF00248 | Aldo_ket_red | 0.35 |
| PF01075 | Glyco_transf_9 | 0.35 |
| PF01337 | Barstar | 0.35 |
| PF03372 | Exo_endo_phos | 0.35 |
| PF13243 | SQHop_cyclase_C | 0.35 |
| PF14441 | OTT_1508_deam | 0.35 |
| PF14588 | YjgF_endoribonc | 0.35 |
| PF07676 | PD40 | 0.35 |
| PF00691 | OmpA | 0.35 |
| PF02687 | FtsX | 0.35 |
| PF08240 | ADH_N | 0.35 |
| PF02353 | CMAS | 0.35 |
| PF12697 | Abhydrolase_6 | 0.35 |
| PF09828 | Chrome_Resist | 0.35 |
| PF07311 | Dodecin | 0.35 |
| PF11950 | DUF3467 | 0.35 |
| PF13007 | LZ_Tnp_IS66 | 0.35 |
| PF13669 | Glyoxalase_4 | 0.35 |
| PF01047 | MarR | 0.35 |
| PF13378 | MR_MLE_C | 0.35 |
| PF13492 | GAF_3 | 0.35 |
| PF10014 | 2OG-Fe_Oxy_2 | 0.35 |
| PF00072 | Response_reg | 0.35 |
| PF14690 | zf-ISL3 | 0.35 |
| PF13432 | TPR_16 | 0.35 |
| PF13548 | DUF4126 | 0.35 |
| PF01564 | Spermine_synth | 0.35 |
| PF00078 | RVT_1 | 0.35 |
| PF02744 | GalP_UDP_tr_C | 0.35 |
| PF00155 | Aminotran_1_2 | 0.35 |
| PF01042 | Ribonuc_L-PSP | 0.35 |
| PF13286 | HD_assoc | 0.35 |
| PF16576 | HlyD_D23 | 0.35 |
| PF01627 | Hpt | 0.35 |
| PF01522 | Polysacc_deac_1 | 0.35 |
| PF08450 | SGL | 0.35 |
| PF00041 | fn3 | 0.35 |
| PF00011 | HSP20 | 0.35 |
| PF00135 | COesterase | 0.35 |
| PF13302 | Acetyltransf_3 | 0.35 |
| PF07238 | PilZ | 0.35 |
| PF01609 | DDE_Tnp_1 | 0.35 |
| PF01842 | ACT | 0.35 |
| PF13466 | STAS_2 | 0.35 |
| PF01435 | Peptidase_M48 | 0.35 |
| PF02954 | HTH_8 | 0.35 |
| PF02350 | Epimerase_2 | 0.35 |
| PF12728 | HTH_17 | 0.35 |
| PF13431 | TPR_17 | 0.35 |
| COG ID | Name | Functional Category | % Frequency in 283 Family Scaffolds |
|---|---|---|---|
| COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 2.12 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
| COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 0.71 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.35 |
| COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 0.35 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.35 |
| COG2324 | Uncharacterized membrane protein | Function unknown [S] | 0.35 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.35 |
| COG2732 | Barstar, RNAse (barnase) inhibitor | Transcription [K] | 0.35 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.35 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.35 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.35 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.35 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.35 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.35 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.35 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.35 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.35 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.35 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.35 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.35 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.35 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.35 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.35 |
| COG0372 | Citrate synthase | Energy production and conversion [C] | 0.35 |
| COG0381 | UDP-N-acetylglucosamine 2-epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.35 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.35 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.35 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.35 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.35 |
| COG0707 | UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase | Cell wall/membrane/envelope biogenesis [M] | 0.35 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.35 |
| COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.35 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.35 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.35 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.35 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.35 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.35 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.62 % |
| Unclassified | root | N/A | 38.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918007|ConsensusfromContig118158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101503476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1596 | Open in IMG/M |
| 3300000567|JGI12270J11330_10230329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300000789|JGI1027J11758_12803471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1373 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100836807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300002647|Ga0005469J37257_103302 | Not Available | 597 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10464466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 511 | Open in IMG/M |
| 3300004082|Ga0062384_100710226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
| 3300004082|Ga0062384_101219121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300004092|Ga0062389_100223244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1879 | Open in IMG/M |
| 3300004092|Ga0062389_103100277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 622 | Open in IMG/M |
| 3300004102|Ga0058888_1430951 | Not Available | 592 | Open in IMG/M |
| 3300004152|Ga0062386_100266164 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
| 3300004152|Ga0062386_100570769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 923 | Open in IMG/M |
| 3300004474|Ga0068968_1473232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300004474|Ga0068968_1508084 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300004615|Ga0068926_1322984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 540 | Open in IMG/M |
| 3300004631|Ga0058899_10162232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300004631|Ga0058899_10189304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300005167|Ga0066672_10466603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 823 | Open in IMG/M |
| 3300005176|Ga0066679_11012801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas citri group → Xanthomonas citri → Xanthomonas citri pv. mangiferaeindicae → Xanthomonas citri pv. mangiferaeindicae LMG 941 | 517 | Open in IMG/M |
| 3300005332|Ga0066388_104756259 | Not Available | 691 | Open in IMG/M |
| 3300005434|Ga0070709_10967093 | Not Available | 676 | Open in IMG/M |
| 3300005435|Ga0070714_101291937 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300005435|Ga0070714_101691566 | Not Available | 618 | Open in IMG/M |
| 3300005437|Ga0070710_10647396 | Not Available | 740 | Open in IMG/M |
| 3300005439|Ga0070711_100345171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1195 | Open in IMG/M |
| 3300005468|Ga0070707_101552783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 629 | Open in IMG/M |
| 3300005530|Ga0070679_101509055 | Not Available | 619 | Open in IMG/M |
| 3300005534|Ga0070735_10000109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 103788 | Open in IMG/M |
| 3300005534|Ga0070735_10004972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 11098 | Open in IMG/M |
| 3300005538|Ga0070731_10117085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1765 | Open in IMG/M |
| 3300005541|Ga0070733_10833132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas citri group → Xanthomonas citri → Xanthomonas citri pv. mangiferaeindicae → Xanthomonas citri pv. mangiferaeindicae LMG 941 | 620 | Open in IMG/M |
| 3300005541|Ga0070733_10997190 | Not Available | 562 | Open in IMG/M |
| 3300005541|Ga0070733_11160365 | Not Available | 518 | Open in IMG/M |
| 3300005542|Ga0070732_10201417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1190 | Open in IMG/M |
| 3300005554|Ga0066661_10029874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2997 | Open in IMG/M |
| 3300005555|Ga0066692_10456150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 814 | Open in IMG/M |
| 3300005578|Ga0068854_102168492 | Not Available | 514 | Open in IMG/M |
| 3300005602|Ga0070762_11138118 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300005610|Ga0070763_10132899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1285 | Open in IMG/M |
| 3300005610|Ga0070763_10610007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 633 | Open in IMG/M |
| 3300005712|Ga0070764_10268033 | Not Available | 977 | Open in IMG/M |
| 3300005764|Ga0066903_105991185 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300005764|Ga0066903_108880846 | Not Available | 510 | Open in IMG/M |
| 3300005876|Ga0075300_1048039 | Not Available | 610 | Open in IMG/M |
| 3300005887|Ga0075292_1033057 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300005887|Ga0075292_1044216 | Not Available | 635 | Open in IMG/M |
| 3300005921|Ga0070766_10383580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 918 | Open in IMG/M |
| 3300005921|Ga0070766_11059913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 559 | Open in IMG/M |
| 3300006028|Ga0070717_10076025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2810 | Open in IMG/M |
| 3300006028|Ga0070717_11398622 | Not Available | 635 | Open in IMG/M |
| 3300006052|Ga0075029_101177073 | Not Available | 535 | Open in IMG/M |
| 3300006059|Ga0075017_101026978 | Not Available | 642 | Open in IMG/M |
| 3300006059|Ga0075017_101537084 | Not Available | 525 | Open in IMG/M |
| 3300006102|Ga0075015_100213676 | Not Available | 1032 | Open in IMG/M |
| 3300006102|Ga0075015_100888625 | Not Available | 540 | Open in IMG/M |
| 3300006162|Ga0075030_100917251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 690 | Open in IMG/M |
| 3300006163|Ga0070715_11038517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 513 | Open in IMG/M |
| 3300006172|Ga0075018_10204763 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300006173|Ga0070716_100007562 | All Organisms → cellular organisms → Bacteria | 5359 | Open in IMG/M |
| 3300006173|Ga0070716_101481301 | Not Available | 554 | Open in IMG/M |
| 3300006174|Ga0075014_100056035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1711 | Open in IMG/M |
| 3300006175|Ga0070712_100081750 | All Organisms → cellular organisms → Bacteria | 2341 | Open in IMG/M |
| 3300006175|Ga0070712_101786763 | Not Available | 538 | Open in IMG/M |
| 3300006176|Ga0070765_101980683 | Not Available | 545 | Open in IMG/M |
| 3300006893|Ga0073928_10006584 | All Organisms → cellular organisms → Bacteria | 15550 | Open in IMG/M |
| 3300006893|Ga0073928_11070916 | Not Available | 547 | Open in IMG/M |
| 3300006903|Ga0075426_10463719 | Not Available | 939 | Open in IMG/M |
| 3300006903|Ga0075426_11526986 | Not Available | 508 | Open in IMG/M |
| 3300006914|Ga0075436_100496087 | Not Available | 893 | Open in IMG/M |
| 3300006969|Ga0075419_11326286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300009038|Ga0099829_10150622 | Not Available | 1856 | Open in IMG/M |
| 3300009088|Ga0099830_11577935 | Not Available | 547 | Open in IMG/M |
| 3300009093|Ga0105240_11061066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
| 3300009093|Ga0105240_11455481 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300009174|Ga0105241_10393094 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300009520|Ga0116214_1401669 | Not Available | 535 | Open in IMG/M |
| 3300009522|Ga0116218_1045753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1979 | Open in IMG/M |
| 3300009522|Ga0116218_1240902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300009523|Ga0116221_1012339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 4864 | Open in IMG/M |
| 3300009523|Ga0116221_1281080 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300009524|Ga0116225_1030267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2694 | Open in IMG/M |
| 3300009524|Ga0116225_1226634 | Not Available | 842 | Open in IMG/M |
| 3300009618|Ga0116127_1088581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 826 | Open in IMG/M |
| 3300009623|Ga0116133_1162518 | Not Available | 589 | Open in IMG/M |
| 3300009637|Ga0116118_1178171 | Not Available | 675 | Open in IMG/M |
| 3300009640|Ga0116126_1017872 | Not Available | 3189 | Open in IMG/M |
| 3300009645|Ga0116106_1033681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1751 | Open in IMG/M |
| 3300009645|Ga0116106_1237944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300009672|Ga0116215_1472734 | Not Available | 542 | Open in IMG/M |
| 3300009698|Ga0116216_10992218 | Not Available | 502 | Open in IMG/M |
| 3300009700|Ga0116217_10144645 | Not Available | 1592 | Open in IMG/M |
| 3300009700|Ga0116217_10249492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1152 | Open in IMG/M |
| 3300009792|Ga0126374_11799622 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300009824|Ga0116219_10312573 | Not Available | 884 | Open in IMG/M |
| 3300009839|Ga0116223_10006269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 9813 | Open in IMG/M |
| 3300010043|Ga0126380_10151526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1486 | Open in IMG/M |
| 3300010048|Ga0126373_11658649 | Not Available | 704 | Open in IMG/M |
| 3300010339|Ga0074046_10030090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 3712 | Open in IMG/M |
| 3300010339|Ga0074046_10031124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3640 | Open in IMG/M |
| 3300010341|Ga0074045_10217938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1272 | Open in IMG/M |
| 3300010358|Ga0126370_10354241 | Not Available | 1187 | Open in IMG/M |
| 3300010361|Ga0126378_10564594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1252 | Open in IMG/M |
| 3300010361|Ga0126378_12204649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300010361|Ga0126378_12682600 | Not Available | 569 | Open in IMG/M |
| 3300010376|Ga0126381_101649099 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 926 | Open in IMG/M |
| 3300010379|Ga0136449_100239928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3382 | Open in IMG/M |
| 3300010379|Ga0136449_100308238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2879 | Open in IMG/M |
| 3300010379|Ga0136449_100432947 | All Organisms → cellular organisms → Bacteria | 2316 | Open in IMG/M |
| 3300010379|Ga0136449_102502413 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300010379|Ga0136449_103988949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300010379|Ga0136449_103991761 | Not Available | 551 | Open in IMG/M |
| 3300011074|Ga0138559_1045692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300011120|Ga0150983_10709772 | Not Available | 510 | Open in IMG/M |
| 3300011120|Ga0150983_11550358 | Not Available | 523 | Open in IMG/M |
| 3300011120|Ga0150983_14838439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300011120|Ga0150983_14839867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300011271|Ga0137393_10123771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2136 | Open in IMG/M |
| 3300011271|Ga0137393_11212821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300012198|Ga0137364_11420190 | Not Available | 513 | Open in IMG/M |
| 3300012201|Ga0137365_10605353 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300012203|Ga0137399_11108914 | Not Available | 666 | Open in IMG/M |
| 3300012205|Ga0137362_10901701 | Not Available | 755 | Open in IMG/M |
| 3300012351|Ga0137386_10089258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2168 | Open in IMG/M |
| 3300012351|Ga0137386_11034843 | Not Available | 583 | Open in IMG/M |
| 3300012469|Ga0150984_103211302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300012469|Ga0150984_120030159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
| 3300012683|Ga0137398_10428892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 902 | Open in IMG/M |
| 3300012948|Ga0126375_10372963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1021 | Open in IMG/M |
| 3300012971|Ga0126369_13597209 | Not Available | 508 | Open in IMG/M |
| 3300013296|Ga0157374_10631281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1082 | Open in IMG/M |
| 3300013307|Ga0157372_10169470 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2526 | Open in IMG/M |
| 3300014152|Ga0181533_1160744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 907 | Open in IMG/M |
| 3300014165|Ga0181523_10050088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2599 | Open in IMG/M |
| 3300014168|Ga0181534_10367405 | Not Available | 789 | Open in IMG/M |
| 3300014489|Ga0182018_10007699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8182 | Open in IMG/M |
| 3300014489|Ga0182018_10065465 | Not Available | 2184 | Open in IMG/M |
| 3300014638|Ga0181536_10076958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans | 2001 | Open in IMG/M |
| 3300014654|Ga0181525_10543729 | Not Available | 645 | Open in IMG/M |
| 3300014657|Ga0181522_10180625 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300015241|Ga0137418_10919653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300015374|Ga0132255_101043641 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300017823|Ga0187818_10178102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 927 | Open in IMG/M |
| 3300017933|Ga0187801_10233096 | Not Available | 736 | Open in IMG/M |
| 3300017934|Ga0187803_10140321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 950 | Open in IMG/M |
| 3300017940|Ga0187853_10423364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300017943|Ga0187819_10602339 | Not Available | 622 | Open in IMG/M |
| 3300017943|Ga0187819_10860307 | Not Available | 508 | Open in IMG/M |
| 3300017946|Ga0187879_10127247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1450 | Open in IMG/M |
| 3300017955|Ga0187817_10675846 | Not Available | 659 | Open in IMG/M |
| 3300017961|Ga0187778_10460415 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
| 3300017970|Ga0187783_11404177 | Not Available | 503 | Open in IMG/M |
| 3300017972|Ga0187781_11245469 | Not Available | 548 | Open in IMG/M |
| 3300017973|Ga0187780_10649248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
| 3300017995|Ga0187816_10297063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas citri group → Xanthomonas citri → Xanthomonas citri pv. mangiferaeindicae → Xanthomonas citri pv. mangiferaeindicae LMG 941 | 708 | Open in IMG/M |
| 3300018006|Ga0187804_10444970 | Not Available | 578 | Open in IMG/M |
| 3300018008|Ga0187888_1074025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1499 | Open in IMG/M |
| 3300018017|Ga0187872_10027676 | Not Available | 3205 | Open in IMG/M |
| 3300018022|Ga0187864_10020860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4042 | Open in IMG/M |
| 3300018023|Ga0187889_10479899 | Not Available | 531 | Open in IMG/M |
| 3300018038|Ga0187855_10094965 | All Organisms → cellular organisms → Bacteria | 1805 | Open in IMG/M |
| 3300018038|Ga0187855_10260868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1016 | Open in IMG/M |
| 3300018046|Ga0187851_10216839 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300018062|Ga0187784_10514823 | Not Available | 964 | Open in IMG/M |
| 3300018062|Ga0187784_11529942 | Not Available | 528 | Open in IMG/M |
| 3300018088|Ga0187771_10201356 | All Organisms → cellular organisms → Bacteria | 1652 | Open in IMG/M |
| 3300018088|Ga0187771_10701323 | Not Available | 858 | Open in IMG/M |
| 3300018090|Ga0187770_10667856 | Not Available | 828 | Open in IMG/M |
| 3300018431|Ga0066655_11025353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300018433|Ga0066667_11373473 | Not Available | 619 | Open in IMG/M |
| 3300018433|Ga0066667_11373473 | Not Available | 619 | Open in IMG/M |
| 3300019275|Ga0187798_1356050 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300019888|Ga0193751_1032575 | All Organisms → cellular organisms → Bacteria | 2421 | Open in IMG/M |
| 3300020580|Ga0210403_10292426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1335 | Open in IMG/M |
| 3300020580|Ga0210403_10910052 | Not Available | 693 | Open in IMG/M |
| 3300020581|Ga0210399_10464838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1053 | Open in IMG/M |
| 3300020582|Ga0210395_10467115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 949 | Open in IMG/M |
| 3300020583|Ga0210401_10009681 | All Organisms → cellular organisms → Bacteria | 9466 | Open in IMG/M |
| 3300021046|Ga0215015_10257701 | Not Available | 1252 | Open in IMG/M |
| 3300021170|Ga0210400_10906532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300021170|Ga0210400_11282400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300021180|Ga0210396_10443952 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300021181|Ga0210388_10862202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 782 | Open in IMG/M |
| 3300021181|Ga0210388_11088357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300021377|Ga0213874_10393688 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300021401|Ga0210393_10197508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1625 | Open in IMG/M |
| 3300021405|Ga0210387_10626868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 955 | Open in IMG/M |
| 3300021407|Ga0210383_10582989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 964 | Open in IMG/M |
| 3300021407|Ga0210383_10644877 | Not Available | 912 | Open in IMG/M |
| 3300021420|Ga0210394_10269009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1492 | Open in IMG/M |
| 3300021445|Ga0182009_10340900 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 763 | Open in IMG/M |
| 3300021474|Ga0210390_11232956 | Not Available | 602 | Open in IMG/M |
| 3300021474|Ga0210390_11624308 | Not Available | 508 | Open in IMG/M |
| 3300021474|Ga0210390_11635484 | Not Available | 506 | Open in IMG/M |
| 3300021477|Ga0210398_10432502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1073 | Open in IMG/M |
| 3300021479|Ga0210410_10057122 | All Organisms → cellular organisms → Bacteria | 3405 | Open in IMG/M |
| 3300022510|Ga0242652_1028012 | Not Available | 636 | Open in IMG/M |
| 3300022522|Ga0242659_1089766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas citri group → Xanthomonas citri → Xanthomonas citri pv. mangiferaeindicae → Xanthomonas citri pv. mangiferaeindicae LMG 941 | 595 | Open in IMG/M |
| 3300022557|Ga0212123_10814926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300023255|Ga0224547_1030745 | Not Available | 691 | Open in IMG/M |
| 3300023672|Ga0247553_112063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas citri group → Xanthomonas citri → Xanthomonas citri pv. mangiferaeindicae → Xanthomonas citri pv. mangiferaeindicae LMG 941 | 508 | Open in IMG/M |
| 3300025412|Ga0208194_1019631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1084 | Open in IMG/M |
| 3300025496|Ga0208191_1036538 | Not Available | 1106 | Open in IMG/M |
| 3300025500|Ga0208686_1117254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300025905|Ga0207685_10751615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300025906|Ga0207699_10616378 | Not Available | 791 | Open in IMG/M |
| 3300025910|Ga0207684_11362590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300025916|Ga0207663_10003051 | All Organisms → cellular organisms → Bacteria | 8110 | Open in IMG/M |
| 3300025916|Ga0207663_10241000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1326 | Open in IMG/M |
| 3300025921|Ga0207652_11111242 | Not Available | 691 | Open in IMG/M |
| 3300025922|Ga0207646_11226565 | Not Available | 657 | Open in IMG/M |
| 3300025929|Ga0207664_11985435 | Not Available | 505 | Open in IMG/M |
| 3300025981|Ga0207640_11970268 | Not Available | 529 | Open in IMG/M |
| 3300026015|Ga0208286_1016777 | Not Available | 580 | Open in IMG/M |
| 3300026020|Ga0208531_1014789 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300026527|Ga0209059_1026039 | All Organisms → cellular organisms → Bacteria | 2651 | Open in IMG/M |
| 3300026890|Ga0207781_1024813 | Not Available | 591 | Open in IMG/M |
| 3300027497|Ga0208199_1040303 | Not Available | 1008 | Open in IMG/M |
| 3300027583|Ga0209527_1142248 | Not Available | 532 | Open in IMG/M |
| 3300027676|Ga0209333_1023857 | All Organisms → cellular organisms → Bacteria | 1729 | Open in IMG/M |
| 3300027773|Ga0209810_1243761 | Not Available | 694 | Open in IMG/M |
| 3300027867|Ga0209167_10770562 | Not Available | 524 | Open in IMG/M |
| 3300027869|Ga0209579_10736083 | Not Available | 533 | Open in IMG/M |
| 3300027884|Ga0209275_10205608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1066 | Open in IMG/M |
| 3300027905|Ga0209415_10348890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1234 | Open in IMG/M |
| 3300027908|Ga0209006_10064703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3266 | Open in IMG/M |
| 3300027908|Ga0209006_10809871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300027910|Ga0209583_10302579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300027911|Ga0209698_10842036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 691 | Open in IMG/M |
| 3300027911|Ga0209698_11442753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300027986|Ga0209168_10000797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 27715 | Open in IMG/M |
| 3300028381|Ga0268264_11791700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300028776|Ga0302303_10160446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas citri group → Xanthomonas citri → Xanthomonas citri pv. mangiferaeindicae → Xanthomonas citri pv. mangiferaeindicae LMG 941 | 792 | Open in IMG/M |
| 3300028800|Ga0265338_10102073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 2333 | Open in IMG/M |
| 3300028800|Ga0265338_10504871 | Not Available | 851 | Open in IMG/M |
| 3300028871|Ga0302230_10065771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas citri group → Xanthomonas citri → Xanthomonas citri pv. mangiferaeindicae → Xanthomonas citri pv. mangiferaeindicae LMG 941 | 1500 | Open in IMG/M |
| 3300028906|Ga0308309_11648605 | Not Available | 545 | Open in IMG/M |
| 3300029883|Ga0311327_10054076 | All Organisms → cellular organisms → Bacteria | 3154 | Open in IMG/M |
| 3300029943|Ga0311340_10548900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1022 | Open in IMG/M |
| 3300029944|Ga0311352_10613749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300029955|Ga0311342_10070928 | All Organisms → cellular organisms → Bacteria | 3861 | Open in IMG/M |
| 3300029986|Ga0302188_10187411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 879 | Open in IMG/M |
| 3300030020|Ga0311344_11447217 | Not Available | 501 | Open in IMG/M |
| 3300030524|Ga0311357_11585458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas citri group → Xanthomonas citri → Xanthomonas citri pv. mangiferaeindicae → Xanthomonas citri pv. mangiferaeindicae LMG 941 | 551 | Open in IMG/M |
| 3300030706|Ga0310039_10273106 | Not Available | 646 | Open in IMG/M |
| 3300030730|Ga0307482_1299634 | Not Available | 517 | Open in IMG/M |
| 3300030842|Ga0075404_11433566 | Not Available | 512 | Open in IMG/M |
| 3300030940|Ga0265740_1026460 | Not Available | 624 | Open in IMG/M |
| 3300031022|Ga0138301_1417242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300031027|Ga0302308_10193328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1310 | Open in IMG/M |
| 3300031128|Ga0170823_14943512 | Not Available | 501 | Open in IMG/M |
| 3300031231|Ga0170824_102446860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1077 | Open in IMG/M |
| 3300031231|Ga0170824_113182346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| 3300031231|Ga0170824_119191394 | Not Available | 740 | Open in IMG/M |
| 3300031236|Ga0302324_100742169 | Not Available | 1377 | Open in IMG/M |
| 3300031525|Ga0302326_10197821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3361 | Open in IMG/M |
| 3300031711|Ga0265314_10565247 | Not Available | 590 | Open in IMG/M |
| 3300031718|Ga0307474_10934675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300031753|Ga0307477_10321047 | Not Available | 1067 | Open in IMG/M |
| 3300031754|Ga0307475_10072695 | All Organisms → cellular organisms → Bacteria | 2632 | Open in IMG/M |
| 3300031754|Ga0307475_11265831 | Not Available | 572 | Open in IMG/M |
| 3300031820|Ga0307473_11323586 | Not Available | 540 | Open in IMG/M |
| 3300031823|Ga0307478_10343266 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300031823|Ga0307478_10380001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1167 | Open in IMG/M |
| 3300031823|Ga0307478_11517086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300031962|Ga0307479_10178980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 2085 | Open in IMG/M |
| 3300031962|Ga0307479_10278489 | Not Available | 1653 | Open in IMG/M |
| 3300032035|Ga0310911_10051096 | All Organisms → cellular organisms → Bacteria | 2153 | Open in IMG/M |
| 3300032160|Ga0311301_10604491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1579 | Open in IMG/M |
| 3300032160|Ga0311301_11301094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 919 | Open in IMG/M |
| 3300032180|Ga0307471_103852646 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300032180|Ga0307471_103921962 | Not Available | 526 | Open in IMG/M |
| 3300032180|Ga0307471_104237488 | Not Available | 506 | Open in IMG/M |
| 3300032782|Ga0335082_10386346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1265 | Open in IMG/M |
| 3300032782|Ga0335082_10830551 | Not Available | 786 | Open in IMG/M |
| 3300032892|Ga0335081_10549134 | Not Available | 1439 | Open in IMG/M |
| 3300032897|Ga0335071_10923683 | Not Available | 820 | Open in IMG/M |
| 3300032898|Ga0335072_10077284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4343 | Open in IMG/M |
| 3300033158|Ga0335077_10134523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli | 2857 | Open in IMG/M |
| 3300033402|Ga0326728_10051146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 6026 | Open in IMG/M |
| 3300033486|Ga0316624_10156420 | All Organisms → cellular organisms → Bacteria | 1708 | Open in IMG/M |
| 3300033887|Ga0334790_056765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1428 | Open in IMG/M |
| 3300033888|Ga0334792_141386 | Not Available | 621 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 10.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.99% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.93% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.23% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.87% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.52% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.17% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.17% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.17% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.17% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.82% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.46% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.46% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.11% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.11% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.41% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.41% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.41% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.41% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.41% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.06% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.06% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.06% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.06% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.06% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.06% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.06% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.70% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.70% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.35% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.35% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.35% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.35% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.35% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.35% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.35% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002647 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF118 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004102 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF212 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004474 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004615 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 11 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005876 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 | Environmental | Open in IMG/M |
| 3300005887 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009618 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011074 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300023255 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14 | Environmental | Open in IMG/M |
| 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025496 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026015 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 (SPAdes) | Environmental | Open in IMG/M |
| 3300026020 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026890 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 51 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028871 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029986 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1 | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030842 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030940 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031022 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| 3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A_all_C_00229570 | 2140918007 | Soil | EQTELLAKVNRLTIPVRVFSIGSGVFLLVLVAMWIYQKLNAVQ |
| INPhiseqgaiiFebDRAFT_1015034765 | 3300000364 | Soil | ASSHMHAEQTELLAKVNRLTIPVRAFGIGSGVFLLVLVAMLIYQKLNEVQ* |
| JGI12270J11330_102303291 | 3300000567 | Peatlands Soil | LDDASSHMHEEQTELLAKVNRLTIPVRVFSIGSGVFLLVLVAMLIYQNLNAVQ* |
| JGI1027J11758_128034711 | 3300000789 | Soil | MQEEQTELLVKVNKLTLPMRVFSIGSGVFLLAFLAMLIYQKLNEVQ* |
| JGIcombinedJ26739_1008368072 | 3300002245 | Forest Soil | LTKVNRLTIPVRVFSIGSGVFLLVLVAMLIYQKLNEVQ* |
| Ga0005469J37257_1033021 | 3300002647 | Forest Soil | DDASSHMHAEQTELLSKMSHLILPVRVFGMGSGVFFLVLVAMLIYQKLNAVQ* |
| JGIcombinedJ51221_104644661 | 3300003505 | Forest Soil | LFLDDNNSHMQEEQTELLVKVNRLTVPMWVFSIGSGVFLLVLVAMVIYQKLNEVQ* |
| Ga0062384_1007102261 | 3300004082 | Bog Forest Soil | ASSHMHEEQTELLAKVNRLTIPTRVFSIGAGVFLMVLAAMWFYQKLNAVQ* |
| Ga0062384_1012191212 | 3300004082 | Bog Forest Soil | QLFLDDASSHMHEEQTELLALPSRFACFSIGSGVFLLVLVAMSLNQKLTAVQ* |
| Ga0062389_1002232441 | 3300004092 | Bog Forest Soil | LLTKVSRLTIPVRVFSMGSGVFLLVLVAMLIYQKLNEVQ* |
| Ga0062389_1031002771 | 3300004092 | Bog Forest Soil | HMQEEQTELLTKVNRLTIPVRVFSIGSGVFLLVLVAMLIYQKLNEVQ* |
| Ga0058888_14309513 | 3300004102 | Forest Soil | EQTELLSKVRHLILPVRVFAMGSGVFFLVLVAMLIYQKLNAAQ* |
| Ga0062386_1002661641 | 3300004152 | Bog Forest Soil | LFLDDASSHMHDEQTELLAKVNRLTIPVRVFSIGSGVFLLVLVAMWIYQKLNAAQ* |
| Ga0062386_1005707692 | 3300004152 | Bog Forest Soil | DDASSHMHDEQTELLAKVNRIRIPMRVLSVGSAVFLLLFVGLWFYQKLNAVQ* |
| Ga0068968_14732321 | 3300004474 | Peatlands Soil | LDDASSHMHEEQTELLAKLNRLIIPVRVFGAGSGIFMVVLVAMVIYQKLNEIQ* |
| Ga0068968_15080842 | 3300004474 | Peatlands Soil | DASSHMHEEQTELLAKVNRLTVPVRVFSIGSGVFLLVLVAMLIYQQLNAVQ* |
| Ga0068926_13229841 | 3300004615 | Peatlands Soil | NSHMQEEQTELLVKVNRLTLPVRIFSIGSGVFLLVLVAMVIYQKLNEVQ* |
| Ga0058899_101622322 | 3300004631 | Forest Soil | LDDASSHMHEEQTELLAKVNRLTIPMRVFSIGSGVFLMVLSAMWLYQKLNVVQ* |
| Ga0058899_101893041 | 3300004631 | Forest Soil | LDDASSHMHEEQTELLAKVNRLTIPMRVFSIGSGVFLMVLAAMWFYQKLNAVL* |
| Ga0066672_104666032 | 3300005167 | Soil | SHMHEEQTELLAKVNRLTIPVRVFGAGSGVFLLVFVGMLIYQKLNAVQ* |
| Ga0066679_110128013 | 3300005176 | Soil | FLDDANSHMQEEQTELLTKVNKLTLPLRVFAAGSGVFLLLLAGMYIYQKLNEVQ* |
| Ga0066388_1047562591 | 3300005332 | Tropical Forest Soil | AEQTELLAKVNRLIIPTRVFSIGSGAFLMLLLAMWLYQKLNAVQ* |
| Ga0070709_109670931 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | FLDEANSHMQEEQTELLTKVNRLTLPVRVFSVGSGVFLLAFLALLIYQKLNEVQ* |
| Ga0070714_1012919372 | 3300005435 | Agricultural Soil | FLDDANSHMQEEQTELLTKVNKLTVPMRVFSIGSGVFLLAFLAMLIYQKLNEVQ* |
| Ga0070714_1016915662 | 3300005435 | Agricultural Soil | EQTELLAKVNRLTIPVRVFSIGSGVFLLVLLAMLIYRQLNAVQ* |
| Ga0070710_106473962 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | EQTELLVKVNKLTVPMRVFSIGSGVFLLAFLALLIYQKLNEVQ* |
| Ga0070711_1003451711 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | HMHQEQTELLAKVNRLTVPVRVLSIGSGVFLMLLAATWFYQKLLAVQ* |
| Ga0070707_1015527831 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | HMQEEQTELLTKVNKLVLPVRVFSIGSGIFLLVLVAMLIYQKLNEVQ* |
| Ga0070679_1015090551 | 3300005530 | Corn Rhizosphere | SSHMHEEQTELLAKVNRLTIPVRVFGAGSGVFLLVFVGMLIYQKLNAVQ* |
| Ga0070735_1000010996 | 3300005534 | Surface Soil | DNNSHMHEEQTELLVKVNKLTIPMRVFSIGSGVFLLAFLALLIYQKLNEVQ* |
| Ga0070735_100049726 | 3300005534 | Surface Soil | MHRDDQLFLDNASSHMHEEQTELLAKVNGLTIPMRVFSIGLAAMWFYEKLKAVQ* |
| Ga0070731_101170853 | 3300005538 | Surface Soil | MQEEQTELLTKVNRLTLPMRVFSIGSGVFLLAFLALLIYQKLNEVQ* |
| Ga0070733_108331321 | 3300005541 | Surface Soil | TELLTKVNRLTLPMRVFSIGSGVFLLAFLALLIYQKLNEVQ* |
| Ga0070733_109971901 | 3300005541 | Surface Soil | ELLAKVNRLTIPVRVFSIGSAVFLMVLVAMWLYQRLNGVQ* |
| Ga0070733_111603651 | 3300005541 | Surface Soil | NRLTIPMRVFSIGSGVFLMALTAMWLYQKLNGVQ* |
| Ga0070732_102014173 | 3300005542 | Surface Soil | QLFLDDASSHMHEEQTELLAKVNRLTIPMRVFGIGSGVFLMVLAAMWFYEKLSAV* |
| Ga0066661_100298745 | 3300005554 | Soil | LLTKLNRLTIPVRVFSIGSGVFLLVLAGVWIYQGLNAV* |
| Ga0066692_104561502 | 3300005555 | Soil | LLVKVNRLRLPVWVVGAGSGVLLLVIGGMMIYQKLNEMQ* |
| Ga0068854_1021684922 | 3300005578 | Corn Rhizosphere | MQEEQTELLTKVNKLTLPMRVFSIGSGVFLLAFLALLIYQKLNEVQ* |
| Ga0070762_111381181 | 3300005602 | Soil | ELLVKVNRLTVPVWVFGTGFGVFLLVLAGMFIYQGLNAVQ* |
| Ga0070763_101328993 | 3300005610 | Soil | QEEQTELLVKVNRLTVPMWVFSIGSGVFLLVLVAMLIYQKLNEVQ* |
| Ga0070763_106100071 | 3300005610 | Soil | LAKFNRLTIPVRVFNIGSGVFLMVLVAMLLYQKLN |
| Ga0070764_102680333 | 3300005712 | Soil | EEQTELLVKVNRLTVPMWVFSIGSGVFLLVLVAMVIYQKLNEVQ* |
| Ga0066903_1059911851 | 3300005764 | Tropical Forest Soil | QEEQTELLTKVNKLTLPMRVFSIGSGVFLLAFLAMLIYQKLNEVQ* |
| Ga0066903_1088808461 | 3300005764 | Tropical Forest Soil | ELLTKVNRLTIPMRVFSIGSGVFLLAFLAMLIYQKLNEVQ* |
| Ga0075300_10480392 | 3300005876 | Rice Paddy Soil | LFLDTTNSHMQEEQTELLTKVNKLTLPMRVFSIGSGVFLLAFLALLIYQKLNEVQ* |
| Ga0075292_10330571 | 3300005887 | Rice Paddy Soil | SSHMHEEQTQLLAKVNRLTIPVRAFGIGSGVFLLVLVAMLIYQNLNQVQ* |
| Ga0075292_10442162 | 3300005887 | Rice Paddy Soil | DDTSSHMHAEQTELLAKVNRLIIPVRVFSIGSGVFLLVFVAMLIYQKLNQLQ* |
| Ga0070766_103835801 | 3300005921 | Soil | ASSHMHEEQTELLAKVNRLTIPVRVFSIGSGIFLLVLVAMLIYQKLNALQ* |
| Ga0070766_110599131 | 3300005921 | Soil | NSHMQEEQTELLTKVNRLTIPVRVFTIGSGVFLLVLVAMLIYQKLNEVQ* |
| Ga0070717_100760251 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LDDASSHMREEQTELLVKVDRLTIPVWVFGAGSGVLLLVLAGMFIYQGLNAVQ* |
| Ga0070717_113986221 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | FLDDANSHMQEEQTELLTKVSRLTLPMRVFSIGSGVFLLAFLALLIYQKLNEVQ* |
| Ga0075029_1011770731 | 3300006052 | Watersheds | SSHMHEEQTELLAKVNRLTIPVRLFSIGSGVFLMVLVAMLFYQKLNALQ* |
| Ga0075017_1010269782 | 3300006059 | Watersheds | ANSHMQEEQTELLVKVNRLTIPMRVASIGSGVFLLAFLAMLIYQKLNEVQ* |
| Ga0075017_1015370842 | 3300006059 | Watersheds | VNRLTIPVRVFSIGSGIFLLVLVAMLLYQKLNALQ* |
| Ga0075015_1002136762 | 3300006102 | Watersheds | ASSHMHEEQTELLSKVNRLTIPVRVLSIGSGVFLLVLGAMLLYQKLNALQ* |
| Ga0075015_1008886252 | 3300006102 | Watersheds | TELLAKVNRLTIPVRVFSIGSGIFLLVLVAMLLYQKLNALQ* |
| Ga0075030_1009172512 | 3300006162 | Watersheds | ELLAKVNRLTIPMRVFSIGSGVFLMALTAMWLYQKLNAIQ* |
| Ga0070715_110385171 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LFLDDASSHMHNEQTELLAKVNRLTIPLHVCSIGSGVFLLVLVAMLIYQKLNELQ* |
| Ga0075018_102047632 | 3300006172 | Watersheds | ELLAKVNRLTIPVRAFSIGSGVFLMVLVAMLIYQKLSEIP* |
| Ga0070716_1000075628 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | QTELLTKVNKLTIPMRVFSIGSGVFLLAFLALLIYQKLNEVQ* |
| Ga0070716_1014813011 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | DDASSHMHQEQLELLAKVNRLAIPVRVFSIGSGGFLLVLASMLLYERLNALQ* |
| Ga0075014_1000560354 | 3300006174 | Watersheds | LSDVSYRLTIPVRVFSIGSGVFLMVLAAMWFYQKLNAVQ* |
| Ga0070712_1000817501 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LDDASSHMHQEQTELLAKVNRLTVPVRVLSIGSGVFLMLLAATWFYQKLLAVQ* |
| Ga0070712_1017867631 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ELLVKVNRLTVPMRVFSIGSGVFLLAFLALLIYQKLNEVQ* |
| Ga0070765_1019806833 | 3300006176 | Soil | MQEEQTELLTKVNRLVLPVRVFSVGSGVFLLVLVAMLIYQKLNEVQ* |
| Ga0073928_100065841 | 3300006893 | Iron-Sulfur Acid Spring | QTELLTKVNRLTIPVRVFSIGSGVFLLVLVAMLIYQKLNEDQ* |
| Ga0073928_110709161 | 3300006893 | Iron-Sulfur Acid Spring | QTELLTKVNRLTIPVRVFSIGSGVFLLVLVAMLIYQKLNEVQ* |
| Ga0075426_104637191 | 3300006903 | Populus Rhizosphere | TMHKNEQLFLDGASSLMHAEQTELLIKVNRLTLPVRVFGMGSGLFFLALVAMWI* |
| Ga0075426_115269861 | 3300006903 | Populus Rhizosphere | NKLTIPMRVFSIGSGVFLLAFVAMLIYQKLNEVQ* |
| Ga0075436_1004960873 | 3300006914 | Populus Rhizosphere | LDGASSLMHAEQTELLIKVNRLTLPVRVFGMGSGLFFLALVAMWI* |
| Ga0075419_113262861 | 3300006969 | Populus Rhizosphere | LTMHRDEQLFLDDTSSHMHAEQTKLLAKVNRITIPMRVFSIGSGVFLMVFAAMWFYQKLSGVQ* |
| Ga0099829_101506221 | 3300009038 | Vadose Zone Soil | VNRLTIPLRVFAAGSGVFLLVLIGMWISQKLNEVQ* |
| Ga0099830_115779351 | 3300009088 | Vadose Zone Soil | LDDASSHMREEQTELLVKVDRLTVPVWVFGAGSGVLLLVLAGMFIYQGLNAVQ* |
| Ga0105240_110610661 | 3300009093 | Corn Rhizosphere | KVSRLTLPMRVFSIGSGVFLLAFLALLIYQKLNEVQ* |
| Ga0105240_114554812 | 3300009093 | Corn Rhizosphere | NDASSLMQAEQTELSTKVNRLTLPVRVFGMGSGLFFLVLVAMWIYQKLN* |
| Ga0105241_103930941 | 3300009174 | Corn Rhizosphere | SSLMQAEQTELSTKVNRLTLPVRVFGMGSGLFFLVLVAMWIYQKLN* |
| Ga0116214_14016691 | 3300009520 | Peatlands Soil | VSRLILPVRVFSIGSGVFLLVLVAMLIYQNLNAVQ* |
| Ga0116218_10457531 | 3300009522 | Peatlands Soil | NNSHMQEEQTELLVKVNRLTVPMWVFSIGSGVFLLVLVAMVIYQKLNEVQ* |
| Ga0116218_12409023 | 3300009522 | Peatlands Soil | FLDDASSHMHEEQTELLAKLNRLIIPVRVFGAGSGIFMVVLVAMVIYQKLNEIQ* |
| Ga0116221_10123391 | 3300009523 | Peatlands Soil | LFLDDANSHMQGEQTELLSKVNRLTIPVRVFSIGSGVFLLVLVAMLIYQKLNEVQ* |
| Ga0116221_12810801 | 3300009523 | Peatlands Soil | QAEQTELLVKVNRLTIPVWVFGAGSGVLLLVLAGMFIYQGLNAVQ* |
| Ga0116225_10302674 | 3300009524 | Peatlands Soil | TELLVKVNRLTIPVWVFGAGSGVLLLVLAGMFIYQGLNNVQ* |
| Ga0116225_12266343 | 3300009524 | Peatlands Soil | LLVKVNRLTVPMWVFSIGSGVFLLVLVAMVIYQKLNEVQ* |
| Ga0116127_10885811 | 3300009618 | Peatland | TELLAKVNRLTIPVRVFSIGSGVFLLVLVAMWLYQKLNAVQ* |
| Ga0116133_11625181 | 3300009623 | Peatland | SHMHEEQTELLAKVNRLTIPMRVFSIGSGVFLMVLTAMWIYQNLNQLQ* |
| Ga0116118_11781713 | 3300009637 | Peatland | LVKVNRLTKPVWVFGAGSGVLLLVLLGMFIYQGLNAVQ* |
| Ga0116126_10178721 | 3300009640 | Peatland | KVNRLTIPVRVFSIGSGVFLLVLVAMWLYQKLNAVQ* |
| Ga0116106_10336813 | 3300009645 | Peatland | KVNRLTKPVWVFGAGSGVLLLVLLGMFIYQGLNAVQ* |
| Ga0116106_12379441 | 3300009645 | Peatland | EQTELLVKVNRLTKPVWVFGAGSGVLLLVLLGMFIYQGLNAVQ* |
| Ga0116215_14727341 | 3300009672 | Peatlands Soil | HMQKEQTELITKVNRLTVPVWVFGAGSGVLLLVLAGMFIYQGLNAVQ* |
| Ga0116216_109922181 | 3300009698 | Peatlands Soil | HMQQEQTELLVKVNRLTLPVRIFSIGSGVFLLVLVAMIIY* |
| Ga0116217_101446451 | 3300009700 | Peatlands Soil | LLVKVNRLTLPVRIFSIGSGVFLLVLVAMIIYQKLNEVQ* |
| Ga0116217_102494924 | 3300009700 | Peatlands Soil | LAKVNRLTIPVRVFSIGSGVFLLVLVAMLIYQKLNAVQ* |
| Ga0126374_117996222 | 3300009792 | Tropical Forest Soil | TKVNKLTLPMRVFSIGSGVFLLAFLAMLIYQKLNEVQ* |
| Ga0116219_103125732 | 3300009824 | Peatlands Soil | LDDHNSHMQEEQTELLSKVNRLTIPVRVFSIGSGVFLLVLVAMLIYQKLNEVQ* |
| Ga0116223_100062691 | 3300009839 | Peatlands Soil | LFLDDASSHMHDEQTELLAKLNRLTIPMRVFSIGSGVFLLVLVAMWIYQKLNAVQ* |
| Ga0126380_101515262 | 3300010043 | Tropical Forest Soil | FLDDASSHMHAEQTELLAKVNRLNIPMRILSVGSGVFLLVLVAMWVYQKLSAVE* |
| Ga0126373_116586491 | 3300010048 | Tropical Forest Soil | QTELLAKVNRLNIPMRILSVGSGVFLLVLLAMLLYQKLSAVE* |
| Ga0074046_100300903 | 3300010339 | Bog Forest Soil | ELLVKVNRLTIPVWVFGAGSGVLLLVLAGMFIYQGLNAVQ* |
| Ga0074046_100311241 | 3300010339 | Bog Forest Soil | LFLDDASSHMHDEQTELLAKLNRLIIPVRVFSIGSGVFLLVLTGIWLYQSLNAV* |
| Ga0074045_102179382 | 3300010341 | Bog Forest Soil | SHMHEEQTELLVKVNRLTVPMWVFSIGSGVFALVLVAMLIYQKLNEVQ* |
| Ga0126370_103542411 | 3300010358 | Tropical Forest Soil | LDDANSHMQEEQTELLQKVNRLTLPVRVFGVGSGIFALAFLALFIYQKLNEVQ* |
| Ga0126378_105645941 | 3300010361 | Tropical Forest Soil | LDEANSHLQEEQTELLTKVSKLTIPMRVFSIGSGVFLLAFLAMLIYQKLNEVQ* |
| Ga0126378_122046491 | 3300010361 | Tropical Forest Soil | HLQEEQTELLTKVNKLALPMRVFSIGSGVFLLAFLALLIYQKLNEVQ* |
| Ga0126378_126826001 | 3300010361 | Tropical Forest Soil | HMQEEQTELLTKVNRLTIPMRVFSIGSGVFLLAFLAMLIYQKLNEVQ* |
| Ga0126381_1016490991 | 3300010376 | Tropical Forest Soil | KVNRLTIPMRVFSIGSGVFLLAFLAMLIYQKLNEVQ* |
| Ga0136449_1002399286 | 3300010379 | Peatlands Soil | LAKVNRLIIPIRVFSIGSGVFLLALVAMWIYQKLNTIE* |
| Ga0136449_1003082381 | 3300010379 | Peatlands Soil | QEEQTELLVKVNKLVLPVRVFSVGSGVFLLVLVAMLIYQKLNEVQ* |
| Ga0136449_1004329471 | 3300010379 | Peatlands Soil | ASSHMHAEQTELLARVNRLIIPVRVLSVGSGVFLMVLVAMWLYQKLNAA* |
| Ga0136449_1025024132 | 3300010379 | Peatlands Soil | HQEQTELLAKVNRLTIPVRVFSIGSGIFLLVLVAMLIYQKLNAVQ* |
| Ga0136449_1039889491 | 3300010379 | Peatlands Soil | LFLDDASSHMHEEQTELLAKLKGLIVPMRVFATGSGIFMLVLVAMLIYQKLNEIQ* |
| Ga0136449_1039917611 | 3300010379 | Peatlands Soil | KVNRLTIPVRVFSIGSGVFLLVLVAMLIYQKLNEVQ* |
| Ga0138559_10456921 | 3300011074 | Peatlands Soil | MHAEQMELLTKVSRLILPVRVFSIGSGVFLLVLVAMLIYRQLNAVQ* |
| Ga0150983_107097721 | 3300011120 | Forest Soil | EEQTELLTKVNRLVLPVRVFSVGSGVFLLVLVAMLIYQKLNEVQ* |
| Ga0150983_115503581 | 3300011120 | Forest Soil | EQTELLAKVNRLTIPVRVFSMGSGVFLLVLVAMMIYQKLSEVQ* |
| Ga0150983_148384392 | 3300011120 | Forest Soil | FLDDASSHMHEEQTELLAKVNRLTIPMRVFSIGSGVFLMVLSAMWLYQKLNVVQ* |
| Ga0150983_148398672 | 3300011120 | Forest Soil | FLDDASSHMHEEQTELLAKVNRLTIPMRVFSIGSGVFLMVLAAMWFYQKLNAVL* |
| Ga0137393_101237711 | 3300011271 | Vadose Zone Soil | QTELLVKVNRLRLPVWVVGAGSGVLLLVIGGMLIYQKLNEMQ* |
| Ga0137393_112128211 | 3300011271 | Vadose Zone Soil | LVKVDRLTVPVWVFGAGSGVLLLVLAGMFIYQGLNAVQ* |
| Ga0137364_114201901 | 3300012198 | Vadose Zone Soil | TELLTRVNKLTVPMRVFSIGSGVFLLAFLAMLIYQKLNEVQ* |
| Ga0137365_106053531 | 3300012201 | Vadose Zone Soil | EQTELLTKVNRLTIPVRVFSIGSGVFLLVLVAMLIYQKLNEVQ* |
| Ga0137399_111089141 | 3300012203 | Vadose Zone Soil | VNRLRLPVWVVGAGSGVLLLVIGGMLIYQKLNEMQ* |
| Ga0137362_109017011 | 3300012205 | Vadose Zone Soil | EQTELLVKVDRLTIPVWVFGAGFGVFLLVLAGMFIYQGLNAVQ* |
| Ga0137386_100892581 | 3300012351 | Vadose Zone Soil | HDEQTELLKKVNRLRVPVWVFGGGSSLFLLIMVGMWIFQQLSEVQ* |
| Ga0137386_110348431 | 3300012351 | Vadose Zone Soil | LFLDDHNSHMQDEQTELLSKVNRLTIPVRVFSIGSGIFLLVLVAMLIYQKLNEVQ* |
| Ga0150984_1032113022 | 3300012469 | Avena Fatua Rhizosphere | HMQEEQTELLTRVGKLTIPMRVFSIGSGVFLLAFLALLIYQKLNEVQ* |
| Ga0150984_1200301591 | 3300012469 | Avena Fatua Rhizosphere | MQEEQTELLTRVGKLTIPMRVFSIGSGVFLLAFLALLIYQKLNEVQ* |
| Ga0137398_104288921 | 3300012683 | Vadose Zone Soil | QLFLNDASSHMQEEQTQLVTKVARLRIPVWVFGGGSGVFLLILVGMWISQKLSEVQ* |
| Ga0126375_103729633 | 3300012948 | Tropical Forest Soil | MDNTISHMHDEQTELLAKVNRLTIPVRAFGIGTGVFLLVLVGMLIYQNLNQAQ* |
| Ga0126369_135972091 | 3300012971 | Tropical Forest Soil | HMQEEQTELLTKVSKLTLPMRVFSIGSGVFLLAFLAMLIYQKLNEVQ* |
| Ga0157374_106312811 | 3300013296 | Miscanthus Rhizosphere | LDDASSHMHEEQTELLAKVNRLTIPIRVFSIGSGVFLTVLAAMWFYQMLSAVE* |
| Ga0157372_101694707 | 3300013307 | Corn Rhizosphere | MHKNEQLFLDGASSLMHAEQTELLIKVNRLTLPVRVFGMGSGLFFLALVAMWI* |
| Ga0181533_11607442 | 3300014152 | Bog | VNRLTIPVRVFSIGSGVFLLVLVAMWLYQKLNAVQ* |
| Ga0181523_100500881 | 3300014165 | Bog | NSHMQEEQTELLSKVNRLVIPVRVFSIGSGVFLLVLVAMLIYQKLNEVQ* |
| Ga0181534_103674052 | 3300014168 | Bog | VKVNRLTVPMWVFSIGSGVFLLVLVAMVIYQKLNEVQ* |
| Ga0182018_100076991 | 3300014489 | Palsa | SHMQQEQTELLVKVNRLTKPVWVFGAGSGVLLLVLLGMFIYQGLNAVQ* |
| Ga0182018_100654652 | 3300014489 | Palsa | LVKVNRLTVPVWVFGAGFGVFLLVLAGMFIYQGLNAVQ* |
| Ga0181536_100769581 | 3300014638 | Bog | NRLTIPVRVFSIGSGVFLLVLVAMWLYQKLNAVQ* |
| Ga0181525_105437291 | 3300014654 | Bog | KVNRLTIPMWVFSIGSGVFLLVLVAMVIYQKLNEVQ* |
| Ga0181522_101806253 | 3300014657 | Bog | MHEEQTELLGKLNRLIIPMRVFSVGSGVFLVALAALWFYQKMNAVQ* |
| Ga0137418_109196532 | 3300015241 | Vadose Zone Soil | MHEDEQLYLDDASSHMREEQTELLVKVDRLTIPVWVFGAGFGVFLLVLAGMFIYQGLNAVQ* |
| Ga0132255_1010436412 | 3300015374 | Arabidopsis Rhizosphere | FLDDASSHMHAEQTELLAMVNRQIIPTRVFSIGSGVFLTLLTSIWLYQKLDGVQ* |
| Ga0187818_101781021 | 3300017823 | Freshwater Sediment | LLAKVNRLTIPVRVFSIGSGVFLLVLVAMWLYQKLNAVQ |
| Ga0187801_102330961 | 3300017933 | Freshwater Sediment | ASSHMHEEQTELLAKVNRLTIPVRVCSIGSGILLLVLVAMLLYQKLNALQ |
| Ga0187803_101403211 | 3300017934 | Freshwater Sediment | LAKVNRLTIPLRVFSIGSGVFLLVLVAMWLYQKLNAVQ |
| Ga0187853_104233641 | 3300017940 | Peatland | LLVKVNRLTKPVWVFGAGSGVLLLVLLGMFIYQGLNAVQ |
| Ga0187819_106023392 | 3300017943 | Freshwater Sediment | SHMQEEQTELLTKVSKLTIPMRVFSIGSGVFLLAFLAMLIYQKLNEVQ |
| Ga0187819_108603071 | 3300017943 | Freshwater Sediment | ASSHMHEEQTELLAKVNRLTIPMRVFSIGSGVFLIVLAAMWLYEKLNAA |
| Ga0187879_101272471 | 3300017946 | Peatland | DDNNSHMQEEQTELLVKVNRLTVPMWVFSIGSGVFLLVLVAMVIYQKLNEVQ |
| Ga0187817_106758461 | 3300017955 | Freshwater Sediment | KVNRLTIPVRVFSIGSGVFLLVLVAMLIYQKLNEVQ |
| Ga0187778_104604152 | 3300017961 | Tropical Peatland | EQTELLTKVNRLVLPVRVFSIGSGVFLLVLVAMVIYQKLTEVQ |
| Ga0187783_114041771 | 3300017970 | Tropical Peatland | LQEEQTELLTKVNKLTIPMRVLSIGSGVFLLAFLALLIYQKLNEVQ |
| Ga0187781_112454691 | 3300017972 | Tropical Peatland | EEQTELLTKVNRLTLPVRVFSIGSGVFLLVLVALVIYQKLNEVQ |
| Ga0187780_106492481 | 3300017973 | Tropical Peatland | QTELLTKVNRLTIPVRVASIGSGIFLLAFLAMLIYQKLNEVQ |
| Ga0187816_102970631 | 3300017995 | Freshwater Sediment | ASAHMQQEQTELLVKVERLTKPVWVFGAGSGVLLLVLVGMFIYQGLNEVQ |
| Ga0187804_104449702 | 3300018006 | Freshwater Sediment | DDASAHMQQEQTELLVKVERLTKPVWVFGAGSGVLLLVLVGMFIYQGLNAVQ |
| Ga0187888_10740251 | 3300018008 | Peatland | KVNRLTIPVRVFSIGSGVFLLVLVAMWLYQKLNAVQ |
| Ga0187872_100276763 | 3300018017 | Peatland | VNRLTIPVRVFSIGSGVFLLVLVAMWLYQKLNAVQ |
| Ga0187864_100208601 | 3300018022 | Peatland | NSHMQQEQTELLVKVNRLTKPVWVFGAGSGVLLLVLLGMFIYQGLNAVQ |
| Ga0187889_104798991 | 3300018023 | Peatland | ELLVKVSRLTKPVWVFGAGSGVLLLVLLGMFIYQGLNAVQ |
| Ga0187855_100949651 | 3300018038 | Peatland | KVNRLTIPMRVFSIGSGVFLMVLTAMWIYQNLNQLQ |
| Ga0187855_102608682 | 3300018038 | Peatland | MHRDDQLFLDDASSHMHEEQTELLALPSRFACFSIGSGVFLLVLVAMSLNQKLTAVQ |
| Ga0187851_102168392 | 3300018046 | Peatland | LDDASSHMHAEQTELLAKVNRLTIPMRVFSIGSGVFLMVLTAMWIYQNLNQLQ |
| Ga0187784_105148232 | 3300018062 | Tropical Peatland | TELLVKVNRLTVPVWVAGAGSGVLLLVLAGMFIYQGLNAVQ |
| Ga0187784_115299421 | 3300018062 | Tropical Peatland | ELLTKVNKLTIPMRVFSIGSGVFLLAFLALLIYQKLNEVQ |
| Ga0187771_102013561 | 3300018088 | Tropical Peatland | QTELLVKVDRLRVPVWVFGAGSGVLLLVLAGMFIYQGLNAVQ |
| Ga0187771_107013231 | 3300018088 | Tropical Peatland | EEQTELLTKVNRLVLPVRVFSIGSGVFLLVLVAMIIYQKLNEVQ |
| Ga0187770_106678561 | 3300018090 | Tropical Peatland | NSHMQEEQTELLTKVNRLVLPVRVFSIGSGVFLLVLVALLIYQKLNEVQ |
| Ga0066655_110253531 | 3300018431 | Grasslands Soil | VTRLTIPERVFGARSGVFLLLFVGMLIYQKLNAVQ |
| Ga0066667_113734731 | 3300018433 | Grasslands Soil | ASSHMHEEQTELLAKVNRLTIPVRVFGAGSGVFLLVFVGMLIHQKLNAVQ |
| Ga0066667_113734732 | 3300018433 | Grasslands Soil | ASSHMHEEQTELLAKVNRLTIPVRVFGAGSGVFLLVFVGMLIYQKLNAVQ |
| Ga0187798_13560501 | 3300019275 | Peatland | MHDEQTELLAKLNRLTIPVRVLSIGSGVFLLVLVAMLIYQKLNEIQ |
| Ga0193751_10325752 | 3300019888 | Soil | QTELLVKVNRLRLPVWVVGAGSGVLLLVIGGMLIYQKLNEMQ |
| Ga0210403_102924262 | 3300020580 | Soil | LTKVNRLTIPVRVFTIGSGVFLLVLVAMLIYQKLNEVQ |
| Ga0210403_109100521 | 3300020580 | Soil | NSHMQDEQTELLVKVNRLTIPVRVFSIGSGVFLLVLVAMLIYQKLNEVQ |
| Ga0210399_104648382 | 3300020581 | Soil | SHMHEEQTELLAKVNRLIIPMRVFSIGSGVFLMALTAMWLYQKLNGVQ |
| Ga0210395_104671151 | 3300020582 | Soil | VFLDDASSHMHEEQAELLAKVNRLTIPVRVFSIGSGIFLLVLVAMLLYQKLNALQ |
| Ga0210401_100096816 | 3300020583 | Soil | LFLDDASSHMHAEQTELLSKVNHLILPVRVFGMGSGVFFLVLVAMLIYQKLNAAQ |
| Ga0215015_102577011 | 3300021046 | Soil | QMQQEQTELLVKVNRLRLPVWVVGAGSGVLLLVIGGMLIYQKLNEMQ |
| Ga0210400_109065322 | 3300021170 | Soil | LFLDDASSHMHEEQTELLSKLSRLTIPVRVFSTGAGVFFLTLVAMLIYKSLNQVE |
| Ga0210400_112824002 | 3300021170 | Soil | MHEEQTELLSKLSRLTIPVRVFSTGAGVFFLTLVAML |
| Ga0210396_104439522 | 3300021180 | Soil | MHEDEQLFLDDASSHMRAEQTELLSKVSHLIFPVRVFGLGSGVFFLVLVAMLIYQS |
| Ga0210388_108622023 | 3300021181 | Soil | LLAKVNRITIPVRVFSMGSGVFFLALVAMLIYQKLNAVQ |
| Ga0210388_110883571 | 3300021181 | Soil | HLHEEQTELLAKVNRLTIPVRVFGIGSGIFLLVLVAMLVYQKLNALQ |
| Ga0213874_103936881 | 3300021377 | Plant Roots | QAEQTELAAKVNRLNIPVRILSVGSTVLLLILVAMFIYQKMSAAQ |
| Ga0210393_101975084 | 3300021401 | Soil | HMHEEQTELLAKVNRLTIPVRVFSIGSGIFLLVLVAMLVYQKLNALQ |
| Ga0210387_106268682 | 3300021405 | Soil | HEEQTELLAKVNRLTIPLRVFSIGSGVFLLVLVAMLIYQKLNAVQ |
| Ga0210383_105829891 | 3300021407 | Soil | DASSHMHEEQTELLAKVNRLTIPVRVFSIGSGIFLLVLVAMLVYQKLNALQ |
| Ga0210383_106448771 | 3300021407 | Soil | TELLVKVNRLTVPVWVFGAGSGVLLLVLAGLFIYQGLNAVQ |
| Ga0210394_102690092 | 3300021420 | Soil | NSHMEEEQTELLVKVNRLTVPMRVLSIGSGVFLLAFLALLIYQKLNEVQ |
| Ga0182009_103409001 | 3300021445 | Soil | SHMHEEQTELLAKVNRLTIPLRAFGIASGISLLVLMAMLIYQNLNQIQ |
| Ga0210390_112329561 | 3300021474 | Soil | LFLDDNNSHMQEEQTELLVKVNRLTVPMWVFSIGSGVFLLVLVAMVIYQKLNEVQ |
| Ga0210390_116243082 | 3300021474 | Soil | ELLTKVNRLTIPVRVFTIGSGVFLLVLVAMLIYQKLNEVQ |
| Ga0210390_116354841 | 3300021474 | Soil | TELLTKVNRLTIPVRVFSIGSGVFLLVLVAMLIYQKLNEVQ |
| Ga0210398_104325023 | 3300021477 | Soil | MHEDEQLYLDDANSHMQQEQTELLVKVDRLTKPVWVFGAGSGVLLLVLVGMFIYQGLNAV |
| Ga0210410_100571223 | 3300021479 | Soil | MHAEQTELLSKVNHLILPVRVFGMGSGVFFLVLVAMLIYQKLNAAQ |
| Ga0242652_10280122 | 3300022510 | Soil | DNNSHMQEEQTELLVKVNRLTIPVRVFSIGSGVFLLVLVAMLIYQKLNEVQ |
| Ga0242659_10897662 | 3300022522 | Soil | LVKVNRLTIPLRVFAAGSGVFLLLLTGMYIYQKLNEVQ |
| Ga0212123_108149262 | 3300022557 | Iron-Sulfur Acid Spring | LFLDDASSHMHEEQTELLALPSRFACFSIGSGVFLLVLVAMSLNQKLTAVQ |
| Ga0224547_10307451 | 3300023255 | Soil | MHEDEQLYLDDANSHMQQEQTELLVRVNRLTKPVWVFGAGSGVLLLVLLGMFIYQGLNAV |
| Ga0247553_1120632 | 3300023672 | Soil | ANSHMQEEQTELLVKVNRLTLPLRVFAAGSGVFLLVLAGMYIYQRLNEVQ |
| Ga0208194_10196314 | 3300025412 | Peatland | ANSHMQQEQTELLVKVNRLTKPVWVFGAGSGVLLLVLLGMFIYQGLNAVQ |
| Ga0208191_10365381 | 3300025496 | Peatland | LVKVNRLTKPVWVFGAGSGVLLLVLLGMFIYQGLNAVQ |
| Ga0208686_11172543 | 3300025500 | Peatland | VNRLTKPVWVFGAGSGVLLLVLLGMFIYQGLNAVQ |
| Ga0207685_107516151 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | LFLDDASSHMHNEQTELLAKVNRLTIPLHVCSIGSGVFLLVLVAMLFSQKLNELQ |
| Ga0207699_106163782 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | SHMQEEQTELLTKVNRLTLPVRVFSVGSGVFLLAFLALLIYQKLNEVQ |
| Ga0207684_113625901 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | DASSHMQEEQTELVTKVNRLRVPVWVFGSGSGVFLLILVGMWISQKLSEVQ |
| Ga0207663_100030511 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AKVNRLTIPMRVFSIGSGVFLMALTAMLLYQKLNAAQ |
| Ga0207663_102410001 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | HMHQEQTELLAKVNRLTVPVRVLSIGSGVFLMLLAATWFYQKLLAVQ |
| Ga0207652_111112422 | 3300025921 | Corn Rhizosphere | SSHMHEEQTELLAKVNRLTIPVRVFGAGSGVFLLVFVGMLIYQKLNAVQ |
| Ga0207646_112265651 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | NSHMQEEQTELLTKVNKLVLPVRVFSIGSGIFLLVLVAMLIYQKLNEVQ |
| Ga0207664_119854351 | 3300025929 | Agricultural Soil | FLDDANSHMQEEQTELLTKVNKLTVPMRVFSIGSGVFLLAFLAMLIYQKLNEVQ |
| Ga0207640_119702681 | 3300025981 | Corn Rhizosphere | MQEEQTELLTKVNKLTLPMRVFSIGSGVFLLAFLALLIYQKLNEVQ |
| Ga0208286_10167771 | 3300026015 | Rice Paddy Soil | LFLDTTNSHMQEEQTELLTKVNKLTLPMRVFSIGSGVFLLAFLALLIYQKLNEVQ |
| Ga0208531_10147891 | 3300026020 | Rice Paddy Soil | QTQLLAKVNRLTIPVRAFGIGSGVFLLVLVAMLIYQNLNQVQ |
| Ga0209059_10260394 | 3300026527 | Soil | MQEEQTELLTKVSKLTLPMRVFGIGSGVFLLAFLAMLIYQKLNEVQ |
| Ga0207781_10248131 | 3300026890 | Tropical Forest Soil | ANSHMQEEQTELLTKVNRLTIPVRVFSIGSGVFLLVLVAMLIYQKLNEVQ |
| Ga0208199_10403032 | 3300027497 | Peatlands Soil | VNRLIIPVRVFSIGSGVFLVVLVAIWLYQKLNEVQ |
| Ga0209527_11422481 | 3300027583 | Forest Soil | LVKVNRLTLPVWVFGAGSGVLLLVLAGMFIYQGLNAVQ |
| Ga0209333_10238573 | 3300027676 | Forest Soil | VNRLTMPVWVFGAGSGVLLLVLVGMFIYQGLSAVQ |
| Ga0209810_12437611 | 3300027773 | Surface Soil | QTELLTKVSKLTVPMRVFSIGSGVFLLAFLAMLIYQKLNEVQ |
| Ga0209167_107705621 | 3300027867 | Surface Soil | ASSHMHEEQTELLAKVNRLTIPMRVFSIGSGVFLMALTAMWLYQKLNGVQ |
| Ga0209579_107360832 | 3300027869 | Surface Soil | VKVNRLTIPMRVFSIGSGVFLLAFLALLIYQKLNEVQ |
| Ga0209275_102056083 | 3300027884 | Soil | LITKVNRLTLPVWIFGTGFGVLLLVLAGMFIYQGLNAVQ |
| Ga0209415_103488901 | 3300027905 | Peatlands Soil | ELLAKVNRLTIPLRVFSIGSGVFLLVLVAMLIYQKLNAVQ |
| Ga0209006_100647036 | 3300027908 | Forest Soil | FLDDASSHMHDEQTELLTKVNRLTIPVRVFSIGLGVFLLVIVAMLIY |
| Ga0209006_108098712 | 3300027908 | Forest Soil | EDEQLYLDDANSHMQQEQTELLVRVDRLTKPVWVFGAGSGVLLLVLLGMFIYQGLNAVQ |
| Ga0209583_103025791 | 3300027910 | Watersheds | FLDDASSHMHEEQTELLAKVNRLTIPVRVFSIGSGVFLLVLVAMLIYQKLNEVQ |
| Ga0209698_108420362 | 3300027911 | Watersheds | ELLAKVNRLTIPMRVFSIGSGVFLMALTAMWLYQKLNAIQ |
| Ga0209698_114427532 | 3300027911 | Watersheds | FLDDASSHMHDEQTELLAKVNRLTIPVRVLSIGSGIFLLVLVAMWFYQKLNAVQ |
| Ga0209168_100007977 | 3300027986 | Surface Soil | MHRDDQLFLDNASSHMHEEQTELLAKVNGLTIPMRVFSIGLAAMWFYEKLKAVQ |
| Ga0268264_117917002 | 3300028381 | Switchgrass Rhizosphere | KVNRLTVPMRVFSIGSAVFLMVLSAMWLYQKLNPLH |
| Ga0302303_101604462 | 3300028776 | Palsa | HNSHMQEEQTELLVKVNRLTIPLRVFAAGSGVFLLLLTGMYIYQKLNEVQ |
| Ga0265338_101020733 | 3300028800 | Rhizosphere | LTKVNRLVLPVRVFSIGSGVFLLVLVAMLIYQKLNEVQ |
| Ga0265338_105048712 | 3300028800 | Rhizosphere | DDHNSHMQEEQTELLTKVNRLVLPVRVFSIGSGVFLLVLVAMLIYQKLNEVQ |
| Ga0302230_100657711 | 3300028871 | Palsa | ELLVKVDRLTKPVWVFGAGSGVLLLVLVGMFIYQGLNAVQ |
| Ga0308309_116486052 | 3300028906 | Soil | MQEEQTELLTKVNRLVLPVRVFSVGSGVFLLVLVAMLIYQKLNEVQ |
| Ga0311327_100540764 | 3300029883 | Bog | DQTELLVKVDRLTIPVWVFGAGSGVLLLVLAGMFIYQGLNAVQ |
| Ga0311340_105489003 | 3300029943 | Palsa | ELLVKVNRLTVPMWVFSIGSGVFLLVLVAMLIYQKLNEVQ |
| Ga0311352_106137491 | 3300029944 | Palsa | SHMQQEQTELLVKVNRLTKPVWVFGAGSGVLLLVLLGMFIYQGLNAVQ |
| Ga0311342_100709287 | 3300029955 | Bog | NSHMQKEQTELLVKVNRLTKPVWVFGAGSGVLLLVLLGMFIYQGLNAVQ |
| Ga0302188_101874111 | 3300029986 | Bog | TELLVKVNRLTIPVWVFGAGSGVLLLVLAGMFIYQGLNAVQ |
| Ga0311344_114472172 | 3300030020 | Bog | ANSHMQKEQTELLVKVNRLTKPVWVFGAGSGVLLLVLLGMFIYQGLNAVQ |
| Ga0311357_115854581 | 3300030524 | Palsa | HMQQEQTELLVKVDRLTKPVWVFGAGSGVLLLVLVGMFIYQGLNAVQ |
| Ga0310039_102731061 | 3300030706 | Peatlands Soil | EEQTELLSKVNRLTIPVRVFSIGSGVFLLVLVAMLIYQKLNEVQ |
| Ga0307482_12996342 | 3300030730 | Hardwood Forest Soil | QTELLAKVNRLTVPVRVFSMGSGLFLIALAGIWLYQFMGTHSWR |
| Ga0075404_114335661 | 3300030842 | Soil | KEQTELLVKVERLTVPVWVFGAGSGVLLLVLAGMFIYQGLNAVQ |
| Ga0265740_10264601 | 3300030940 | Soil | SHMQEEQTELLVKVNRLTVPMWVFSIGSGVFLLVLVAMLIYQKLNEVQ |
| Ga0138301_14172421 | 3300031022 | Soil | DVNSHMQEEQTELLMKVSKLTIPMRVFSIGSGVFLIAFLALLIYQKLNEVQ |
| Ga0302308_101933284 | 3300031027 | Palsa | KVNRLTKPVWVFGAGSGVLLLVLLGMFIYQGLNAVQ |
| Ga0170823_149435121 | 3300031128 | Forest Soil | GIFAVGLIMDDHNSHMQEEQTELLTKVNRLTLPVRVFSIGSGVFLLVLVAMLIYQKLNEV |
| Ga0170824_1024468601 | 3300031231 | Forest Soil | ASSHMHEEQTELLSKVNRLTIPMRVFSIGSGVFLMALTAIWLYQKLNAIQ |
| Ga0170824_1131823462 | 3300031231 | Forest Soil | DDASSHMHEEQTELLAKVNRLTIPMRVFSIGSGVFLIVLAAMWLYQKLNAV |
| Ga0170824_1191913941 | 3300031231 | Forest Soil | VKVNRLTLPVWVFGAGSGVLLLVLAGLFIYQGLNAVQ |
| Ga0302324_1007421692 | 3300031236 | Palsa | ASAHMQQEQTELLVKVNRLTVPVWVFGAGFGVFLLVLAGMFIYQGLNAVQ |
| Ga0302326_101978215 | 3300031525 | Palsa | LLVKVNRLTVPVWVFGAGFGVFLLVLAGMFIYQGLNAVQ |
| Ga0265314_105652471 | 3300031711 | Rhizosphere | TELLTKVNRLTIPVRVFTIGSGVFLLVLVAMLIYQKLNEVQ |
| Ga0307474_109346753 | 3300031718 | Hardwood Forest Soil | TELLAKVNRLTIPVRVFSIGSGIFLLVLVAMLVYQKLNALQ |
| Ga0307477_103210471 | 3300031753 | Hardwood Forest Soil | KVNRLTVPVWVFGAGSGVLLLVLAGLFIYQGLNAVQ |
| Ga0307475_100726954 | 3300031754 | Hardwood Forest Soil | SSHMHEEQTELLAKVNRLTIPVRVFSIGSGVFLLVLVAMLIYQKLNEVQ |
| Ga0307475_112658313 | 3300031754 | Hardwood Forest Soil | EDEQLFLDDASSHMHAEQTELLSKVSHLILPVRVFGMGSGVFFLVLVAMLIYQKLNAAQ |
| Ga0307473_113235861 | 3300031820 | Hardwood Forest Soil | QEEQTELLTKVNKLTLPMRVFSIGSGVFLLAFLALLIYQKLNEVQ |
| Ga0307478_103432663 | 3300031823 | Hardwood Forest Soil | FLDDASSHMHEEQTELLAKVNRLTIPMRVFSIGSGVFLMLLAAMWFYEKLNAVQ |
| Ga0307478_103800011 | 3300031823 | Hardwood Forest Soil | DDNNSHMQEEQTELLVKVNRLTIPVRVFSIGSGVFLLVLVAMLIYQKLNEVQ |
| Ga0307478_115170861 | 3300031823 | Hardwood Forest Soil | LIYKSTPIMHEDEQLFLDDASSHMHAEQTELLSKVSHLIFPVRVFGLGSGVFFLVLVAILIYQS |
| Ga0307479_101789801 | 3300031962 | Hardwood Forest Soil | LAKVNRLTIPVRVFSIGSGVFLLVLVAMLIYQKLNEVQ |
| Ga0307479_102784893 | 3300031962 | Hardwood Forest Soil | EQTELLAKVNRLTIPMRVFSIGSGVFLMVLAAMWFYQKLNAVL |
| Ga0310911_100510961 | 3300032035 | Soil | KVNRLNIPLRILSVGSGVFLLVLVAMWLYQKLSAVQ |
| Ga0311301_106044911 | 3300032160 | Peatlands Soil | KVNRLTIPVWVFGAGSGVLLLVLAGMFIYQGLNAVQ |
| Ga0311301_113010941 | 3300032160 | Peatlands Soil | FLDDASSHMQDEQTELLAKVNRLIIPIRVFSIGSGVFLLALVAMWIYQKLNTIE |
| Ga0307471_1038526462 | 3300032180 | Hardwood Forest Soil | LDDASSHMHAEQTELLAKVNRLTIPMRVFSIGSGVFLMVFAAMWLYEKLNAV |
| Ga0307471_1039219621 | 3300032180 | Hardwood Forest Soil | NSHMQEEQTELLTKVNKLTLPMRVFSIGSGVFLLAFLAMLIYQKLNEVQ |
| Ga0307471_1042374882 | 3300032180 | Hardwood Forest Soil | AKLNRLTVPVRVFSIGSGVFLLVLVGVWLYQGLNAV |
| Ga0335082_103863461 | 3300032782 | Soil | EANSHMQEEQTELLTKVNRLTVPVRVFSVGSGVFLLAFLALLIYQKLNEVQ |
| Ga0335082_108305511 | 3300032782 | Soil | QTELLTKVNKLVLPMRVFSIGSGVFLLAFLALLIYQKLNEVQ |
| Ga0335081_105491342 | 3300032892 | Soil | QTELLVKVNRLTIPVWVFGAGSGLLLLVLAGMFIYQGLNAVQ |
| Ga0335071_109236831 | 3300032897 | Soil | MQEEQTELLTKVNRLTVPVRVFSVGSGVFLLAFLALLIYQKLNEVQ |
| Ga0335072_100772841 | 3300032898 | Soil | TQLLTKVNRLTIPVRVFATGSGVFLLLLAGMYIYQKLNEVQ |
| Ga0335077_101345235 | 3300033158 | Soil | HMHEEQTELLAKVNQLTIPMRVFSIGSGLFLMMLTAMWLYQKLNAVQ |
| Ga0326728_100511461 | 3300033402 | Peat Soil | RVNRLVLPVRVFSIGSGVFLLVLVAMIIYQKLNEVQ |
| Ga0316624_101564201 | 3300033486 | Soil | AEQTELLAKVNRLVIPTRVFSIGSGVFLMVLTAMWLYQKLNVLQ |
| Ga0334790_056765_1294_1428 | 3300033887 | Soil | DEQTELLAKLNRLTIPVRVFSIGSGVFLLVLVAMWLYQKLNAVQ |
| Ga0334792_141386_8_124 | 3300033888 | Soil | LAKVNRLTIPVRVFSIGSGIFLLALVAMVLYQKLNALQ |
| ⦗Top⦘ |