| Basic Information | |
|---|---|
| Family ID | F012027 |
| Family Type | Metagenome |
| Number of Sequences | 284 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MGRKKAASKSQAAFVDEESSLSVIENQEFMAMRAAQKVW |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 284 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.35 % |
| % of genes near scaffold ends (potentially truncated) | 37.32 % |
| % of genes from short scaffolds (< 2000 bps) | 100.00 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (62.676 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (92.958 % of family members) |
| Environment Ontology (ENVO) | Unclassified (93.662 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (93.662 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.25% β-sheet: 0.00% Coil/Unstructured: 50.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 284 Family Scaffolds |
|---|---|---|
| PF04195 | Transposase_28 | 3.17 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 62.68 % |
| All Organisms | root | All Organisms | 37.32 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005338|Ga0068868_100776822 | Not Available | 862 | Open in IMG/M |
| 3300005459|Ga0068867_102277892 | Not Available | 515 | Open in IMG/M |
| 3300005459|Ga0068867_102334990 | Not Available | 508 | Open in IMG/M |
| 3300005614|Ga0068856_102318444 | Not Available | 545 | Open in IMG/M |
| 3300005718|Ga0068866_10567029 | Not Available | 761 | Open in IMG/M |
| 3300005718|Ga0068866_10570256 | Not Available | 760 | Open in IMG/M |
| 3300005718|Ga0068866_11434307 | Not Available | 506 | Open in IMG/M |
| 3300006358|Ga0068871_102065332 | Not Available | 543 | Open in IMG/M |
| 3300011119|Ga0105246_11789827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 586 | Open in IMG/M |
| 3300013296|Ga0157374_11818238 | Not Available | 635 | Open in IMG/M |
| 3300013296|Ga0157374_12727529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 522 | Open in IMG/M |
| 3300013297|Ga0157378_10817461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 958 | Open in IMG/M |
| 3300013297|Ga0157378_11230879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 789 | Open in IMG/M |
| 3300014969|Ga0157376_12271856 | Not Available | 581 | Open in IMG/M |
| 3300015267|Ga0182122_1040024 | Not Available | 594 | Open in IMG/M |
| 3300015267|Ga0182122_1072540 | Not Available | 502 | Open in IMG/M |
| 3300015268|Ga0182154_1019645 | Not Available | 720 | Open in IMG/M |
| 3300015268|Ga0182154_1022552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 696 | Open in IMG/M |
| 3300015268|Ga0182154_1068943 | Not Available | 512 | Open in IMG/M |
| 3300015268|Ga0182154_1072742 | Not Available | 504 | Open in IMG/M |
| 3300015268|Ga0182154_1073154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 503 | Open in IMG/M |
| 3300015269|Ga0182113_1026666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 738 | Open in IMG/M |
| 3300015269|Ga0182113_1038384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 665 | Open in IMG/M |
| 3300015269|Ga0182113_1041488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 650 | Open in IMG/M |
| 3300015269|Ga0182113_1072664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 551 | Open in IMG/M |
| 3300015274|Ga0182188_1020228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 674 | Open in IMG/M |
| 3300015274|Ga0182188_1020813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 669 | Open in IMG/M |
| 3300015274|Ga0182188_1030017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 609 | Open in IMG/M |
| 3300015274|Ga0182188_1036055 | Not Available | 582 | Open in IMG/M |
| 3300015275|Ga0182172_1017632 | Not Available | 756 | Open in IMG/M |
| 3300015275|Ga0182172_1062746 | Not Available | 535 | Open in IMG/M |
| 3300015276|Ga0182170_1008744 | Not Available | 917 | Open in IMG/M |
| 3300015276|Ga0182170_1021243 | Not Available | 725 | Open in IMG/M |
| 3300015276|Ga0182170_1046568 | Not Available | 584 | Open in IMG/M |
| 3300015276|Ga0182170_1050128 | Not Available | 572 | Open in IMG/M |
| 3300015276|Ga0182170_1054164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 559 | Open in IMG/M |
| 3300015276|Ga0182170_1076060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 505 | Open in IMG/M |
| 3300015277|Ga0182128_1004744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 1092 | Open in IMG/M |
| 3300015277|Ga0182128_1022893 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 715 | Open in IMG/M |
| 3300015277|Ga0182128_1043323 | Not Available | 600 | Open in IMG/M |
| 3300015277|Ga0182128_1048938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 580 | Open in IMG/M |
| 3300015277|Ga0182128_1071574 | Not Available | 519 | Open in IMG/M |
| 3300015277|Ga0182128_1072823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 516 | Open in IMG/M |
| 3300015277|Ga0182128_1076410 | Not Available | 509 | Open in IMG/M |
| 3300015279|Ga0182174_1004124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 1172 | Open in IMG/M |
| 3300015279|Ga0182174_1021712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 745 | Open in IMG/M |
| 3300015279|Ga0182174_1041454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 624 | Open in IMG/M |
| 3300015279|Ga0182174_1059881 | Not Available | 561 | Open in IMG/M |
| 3300015279|Ga0182174_1064077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 550 | Open in IMG/M |
| 3300015279|Ga0182174_1070456 | Not Available | 535 | Open in IMG/M |
| 3300015279|Ga0182174_1074989 | Not Available | 524 | Open in IMG/M |
| 3300015281|Ga0182160_1014567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 819 | Open in IMG/M |
| 3300015281|Ga0182160_1037306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 635 | Open in IMG/M |
| 3300015281|Ga0182160_1061351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 552 | Open in IMG/M |
| 3300015282|Ga0182124_1019337 | Not Available | 753 | Open in IMG/M |
| 3300015282|Ga0182124_1029361 | Not Available | 674 | Open in IMG/M |
| 3300015282|Ga0182124_1041507 | Not Available | 614 | Open in IMG/M |
| 3300015283|Ga0182156_1030857 | Not Available | 682 | Open in IMG/M |
| 3300015283|Ga0182156_1037198 | Not Available | 647 | Open in IMG/M |
| 3300015283|Ga0182156_1059214 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 567 | Open in IMG/M |
| 3300015283|Ga0182156_1083491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 510 | Open in IMG/M |
| 3300015285|Ga0182186_1035509 | Not Available | 645 | Open in IMG/M |
| 3300015286|Ga0182176_1013792 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 898 | Open in IMG/M |
| 3300015286|Ga0182176_1018860 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 808 | Open in IMG/M |
| 3300015286|Ga0182176_1020882 | Not Available | 782 | Open in IMG/M |
| 3300015286|Ga0182176_1027224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 719 | Open in IMG/M |
| 3300015286|Ga0182176_1077496 | Not Available | 519 | Open in IMG/M |
| 3300015286|Ga0182176_1083982 | Not Available | 505 | Open in IMG/M |
| 3300015287|Ga0182171_1013439 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 852 | Open in IMG/M |
| 3300015288|Ga0182173_1071020 | Not Available | 533 | Open in IMG/M |
| 3300015289|Ga0182138_1004307 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1167 | Open in IMG/M |
| 3300015289|Ga0182138_1021907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 750 | Open in IMG/M |
| 3300015289|Ga0182138_1049769 | Not Available | 598 | Open in IMG/M |
| 3300015289|Ga0182138_1071583 | Not Available | 538 | Open in IMG/M |
| 3300015289|Ga0182138_1090676 | Not Available | 500 | Open in IMG/M |
| 3300015291|Ga0182125_1022898 | Not Available | 758 | Open in IMG/M |
| 3300015292|Ga0182141_1055213 | Not Available | 590 | Open in IMG/M |
| 3300015292|Ga0182141_1066783 | Not Available | 558 | Open in IMG/M |
| 3300015292|Ga0182141_1076616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 536 | Open in IMG/M |
| 3300015292|Ga0182141_1078370 | Not Available | 532 | Open in IMG/M |
| 3300015292|Ga0182141_1090421 | Not Available | 509 | Open in IMG/M |
| 3300015294|Ga0182126_1048161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 618 | Open in IMG/M |
| 3300015294|Ga0182126_1056221 | Not Available | 591 | Open in IMG/M |
| 3300015294|Ga0182126_1065127 | Not Available | 565 | Open in IMG/M |
| 3300015294|Ga0182126_1071894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 549 | Open in IMG/M |
| 3300015294|Ga0182126_1081183 | Not Available | 529 | Open in IMG/M |
| 3300015295|Ga0182175_1024342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 756 | Open in IMG/M |
| 3300015295|Ga0182175_1036861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 673 | Open in IMG/M |
| 3300015295|Ga0182175_1051538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 612 | Open in IMG/M |
| 3300015295|Ga0182175_1097384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 504 | Open in IMG/M |
| 3300015296|Ga0182157_1031268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 715 | Open in IMG/M |
| 3300015296|Ga0182157_1093405 | Not Available | 519 | Open in IMG/M |
| 3300015296|Ga0182157_1097991 | Not Available | 511 | Open in IMG/M |
| 3300015298|Ga0182106_1046449 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 640 | Open in IMG/M |
| 3300015298|Ga0182106_1055031 | Not Available | 610 | Open in IMG/M |
| 3300015298|Ga0182106_1060843 | Not Available | 591 | Open in IMG/M |
| 3300015298|Ga0182106_1067052 | Not Available | 574 | Open in IMG/M |
| 3300015298|Ga0182106_1090886 | Not Available | 523 | Open in IMG/M |
| 3300015299|Ga0182107_1023532 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 780 | Open in IMG/M |
| 3300015299|Ga0182107_1064159 | Not Available | 585 | Open in IMG/M |
| 3300015299|Ga0182107_1072590 | Not Available | 563 | Open in IMG/M |
| 3300015299|Ga0182107_1076456 | Not Available | 555 | Open in IMG/M |
| 3300015300|Ga0182108_1024175 | Not Available | 781 | Open in IMG/M |
| 3300015300|Ga0182108_1038384 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 685 | Open in IMG/M |
| 3300015300|Ga0182108_1104164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 506 | Open in IMG/M |
| 3300015302|Ga0182143_1014855 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 883 | Open in IMG/M |
| 3300015302|Ga0182143_1051563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 624 | Open in IMG/M |
| 3300015302|Ga0182143_1103707 | Not Available | 503 | Open in IMG/M |
| 3300015303|Ga0182123_1022237 | Not Available | 766 | Open in IMG/M |
| 3300015303|Ga0182123_1035441 | Not Available | 675 | Open in IMG/M |
| 3300015303|Ga0182123_1047683 | Not Available | 622 | Open in IMG/M |
| 3300015303|Ga0182123_1066819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 565 | Open in IMG/M |
| 3300015303|Ga0182123_1091831 | Not Available | 514 | Open in IMG/M |
| 3300015304|Ga0182112_1010626 | Not Available | 969 | Open in IMG/M |
| 3300015304|Ga0182112_1022882 | Not Available | 788 | Open in IMG/M |
| 3300015304|Ga0182112_1053571 | Not Available | 618 | Open in IMG/M |
| 3300015304|Ga0182112_1070123 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 571 | Open in IMG/M |
| 3300015304|Ga0182112_1096816 | Not Available | 517 | Open in IMG/M |
| 3300015305|Ga0182158_1028884 | Not Available | 734 | Open in IMG/M |
| 3300015305|Ga0182158_1068867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 572 | Open in IMG/M |
| 3300015307|Ga0182144_1025543 | Not Available | 772 | Open in IMG/M |
| 3300015307|Ga0182144_1036565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 697 | Open in IMG/M |
| 3300015308|Ga0182142_1057435 | Not Available | 624 | Open in IMG/M |
| 3300015308|Ga0182142_1073813 | Not Available | 578 | Open in IMG/M |
| 3300015308|Ga0182142_1076431 | Not Available | 572 | Open in IMG/M |
| 3300015308|Ga0182142_1086678 | Not Available | 550 | Open in IMG/M |
| 3300015308|Ga0182142_1099046 | Not Available | 527 | Open in IMG/M |
| 3300015314|Ga0182140_1027699 | Not Available | 770 | Open in IMG/M |
| 3300015314|Ga0182140_1111543 | Not Available | 509 | Open in IMG/M |
| 3300015314|Ga0182140_1117432 | Not Available | 500 | Open in IMG/M |
| 3300015321|Ga0182127_1052994 | Not Available | 658 | Open in IMG/M |
| 3300015321|Ga0182127_1054593 | Not Available | 652 | Open in IMG/M |
| 3300015321|Ga0182127_1072241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 599 | Open in IMG/M |
| 3300015321|Ga0182127_1088628 | Not Available | 562 | Open in IMG/M |
| 3300015321|Ga0182127_1103715 | Not Available | 533 | Open in IMG/M |
| 3300015322|Ga0182110_1061383 | Not Available | 628 | Open in IMG/M |
| 3300015323|Ga0182129_1025588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 787 | Open in IMG/M |
| 3300015323|Ga0182129_1035780 | Not Available | 715 | Open in IMG/M |
| 3300015323|Ga0182129_1058871 | Not Available | 618 | Open in IMG/M |
| 3300015323|Ga0182129_1096378 | Not Available | 533 | Open in IMG/M |
| 3300015341|Ga0182187_1079220 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 700 | Open in IMG/M |
| 3300015341|Ga0182187_1101286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 643 | Open in IMG/M |
| 3300015341|Ga0182187_1106138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 632 | Open in IMG/M |
| 3300015342|Ga0182109_1098635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 683 | Open in IMG/M |
| 3300015342|Ga0182109_1124561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 628 | Open in IMG/M |
| 3300015342|Ga0182109_1156313 | Not Available | 577 | Open in IMG/M |
| 3300015342|Ga0182109_1223911 | Not Available | 501 | Open in IMG/M |
| 3300015343|Ga0182155_1211847 | Not Available | 514 | Open in IMG/M |
| 3300015344|Ga0182189_1035206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 983 | Open in IMG/M |
| 3300015344|Ga0182189_1056161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 840 | Open in IMG/M |
| 3300015344|Ga0182189_1193383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 537 | Open in IMG/M |
| 3300015344|Ga0182189_1200978 | Not Available | 529 | Open in IMG/M |
| 3300015345|Ga0182111_1085713 | Not Available | 749 | Open in IMG/M |
| 3300015345|Ga0182111_1206617 | Not Available | 537 | Open in IMG/M |
| 3300015345|Ga0182111_1210081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 534 | Open in IMG/M |
| 3300015346|Ga0182139_1062750 | Not Available | 840 | Open in IMG/M |
| 3300015346|Ga0182139_1121969 | Not Available | 659 | Open in IMG/M |
| 3300015347|Ga0182177_1109942 | Not Available | 687 | Open in IMG/M |
| 3300015347|Ga0182177_1161712 | Not Available | 594 | Open in IMG/M |
| 3300015347|Ga0182177_1185929 | Not Available | 563 | Open in IMG/M |
| 3300015347|Ga0182177_1186144 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 563 | Open in IMG/M |
| 3300015347|Ga0182177_1212318 | Not Available | 535 | Open in IMG/M |
| 3300015351|Ga0182161_1103571 | Not Available | 731 | Open in IMG/M |
| 3300015351|Ga0182161_1162619 | Not Available | 614 | Open in IMG/M |
| 3300015351|Ga0182161_1201029 | Not Available | 564 | Open in IMG/M |
| 3300015351|Ga0182161_1227618 | Not Available | 536 | Open in IMG/M |
| 3300015351|Ga0182161_1233032 | Not Available | 531 | Open in IMG/M |
| 3300015351|Ga0182161_1253005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 514 | Open in IMG/M |
| 3300015355|Ga0182159_1111973 | Not Available | 819 | Open in IMG/M |
| 3300015355|Ga0182159_1150998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 724 | Open in IMG/M |
| 3300015355|Ga0182159_1163925 | Not Available | 699 | Open in IMG/M |
| 3300015355|Ga0182159_1234804 | Not Available | 600 | Open in IMG/M |
| 3300015355|Ga0182159_1254335 | Not Available | 579 | Open in IMG/M |
| 3300015355|Ga0182159_1255622 | Not Available | 578 | Open in IMG/M |
| 3300015355|Ga0182159_1257094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 576 | Open in IMG/M |
| 3300015355|Ga0182159_1262931 | Not Available | 571 | Open in IMG/M |
| 3300015355|Ga0182159_1280283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 555 | Open in IMG/M |
| 3300015355|Ga0182159_1287183 | Not Available | 549 | Open in IMG/M |
| 3300015355|Ga0182159_1289284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 547 | Open in IMG/M |
| 3300015355|Ga0182159_1294109 | Not Available | 543 | Open in IMG/M |
| 3300015355|Ga0182159_1297073 | Not Available | 541 | Open in IMG/M |
| 3300015355|Ga0182159_1339254 | Not Available | 510 | Open in IMG/M |
| 3300015355|Ga0182159_1341958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 508 | Open in IMG/M |
| 3300015361|Ga0182145_1003937 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 1640 | Open in IMG/M |
| 3300015361|Ga0182145_1072704 | Not Available | 699 | Open in IMG/M |
| 3300015361|Ga0182145_1099085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 631 | Open in IMG/M |
| 3300015361|Ga0182145_1132617 | Not Available | 572 | Open in IMG/M |
| 3300015361|Ga0182145_1179361 | Not Available | 516 | Open in IMG/M |
| 3300015361|Ga0182145_1194818 | Not Available | 502 | Open in IMG/M |
| 3300017404|Ga0182203_1124656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 551 | Open in IMG/M |
| 3300017404|Ga0182203_1130412 | Not Available | 543 | Open in IMG/M |
| 3300017404|Ga0182203_1158701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 507 | Open in IMG/M |
| 3300017407|Ga0182220_1046572 | Not Available | 638 | Open in IMG/M |
| 3300017407|Ga0182220_1080055 | Not Available | 549 | Open in IMG/M |
| 3300017407|Ga0182220_1081379 | Not Available | 546 | Open in IMG/M |
| 3300017409|Ga0182204_1019169 | Not Available | 864 | Open in IMG/M |
| 3300017409|Ga0182204_1021958 | Not Available | 831 | Open in IMG/M |
| 3300017409|Ga0182204_1087559 | Not Available | 555 | Open in IMG/M |
| 3300017409|Ga0182204_1121256 | Not Available | 500 | Open in IMG/M |
| 3300017410|Ga0182207_1030151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 892 | Open in IMG/M |
| 3300017410|Ga0182207_1057749 | Not Available | 728 | Open in IMG/M |
| 3300017410|Ga0182207_1125182 | Not Available | 566 | Open in IMG/M |
| 3300017410|Ga0182207_1133296 | Not Available | 554 | Open in IMG/M |
| 3300017410|Ga0182207_1159831 | Not Available | 520 | Open in IMG/M |
| 3300017411|Ga0182208_1056984 | Not Available | 649 | Open in IMG/M |
| 3300017411|Ga0182208_1069020 | Not Available | 613 | Open in IMG/M |
| 3300017411|Ga0182208_1070185 | Not Available | 610 | Open in IMG/M |
| 3300017411|Ga0182208_1090934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 563 | Open in IMG/M |
| 3300017411|Ga0182208_1098192 | Not Available | 549 | Open in IMG/M |
| 3300017411|Ga0182208_1113765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 524 | Open in IMG/M |
| 3300017413|Ga0182222_1018168 | Not Available | 795 | Open in IMG/M |
| 3300017413|Ga0182222_1069676 | Not Available | 565 | Open in IMG/M |
| 3300017413|Ga0182222_1077006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 550 | Open in IMG/M |
| 3300017413|Ga0182222_1094961 | Not Available | 520 | Open in IMG/M |
| 3300017415|Ga0182202_1014218 | Not Available | 1009 | Open in IMG/M |
| 3300017415|Ga0182202_1071819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 623 | Open in IMG/M |
| 3300017415|Ga0182202_1104309 | Not Available | 553 | Open in IMG/M |
| 3300017415|Ga0182202_1104950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 552 | Open in IMG/M |
| 3300017417|Ga0182230_1073541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 613 | Open in IMG/M |
| 3300017417|Ga0182230_1074098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 611 | Open in IMG/M |
| 3300017417|Ga0182230_1079374 | Not Available | 593 | Open in IMG/M |
| 3300017420|Ga0182228_1111141 | Not Available | 531 | Open in IMG/M |
| 3300017420|Ga0182228_1127070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 506 | Open in IMG/M |
| 3300017424|Ga0182219_1086976 | Not Available | 584 | Open in IMG/M |
| 3300017425|Ga0182224_1029606 | Not Available | 857 | Open in IMG/M |
| 3300017425|Ga0182224_1031375 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 843 | Open in IMG/M |
| 3300017425|Ga0182224_1041841 | Not Available | 775 | Open in IMG/M |
| 3300017425|Ga0182224_1076561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 644 | Open in IMG/M |
| 3300017425|Ga0182224_1107287 | Not Available | 579 | Open in IMG/M |
| 3300017425|Ga0182224_1110079 | Not Available | 575 | Open in IMG/M |
| 3300017425|Ga0182224_1149603 | Not Available | 519 | Open in IMG/M |
| 3300017427|Ga0182190_1071585 | Not Available | 669 | Open in IMG/M |
| 3300017427|Ga0182190_1076501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 654 | Open in IMG/M |
| 3300017427|Ga0182190_1111915 | Not Available | 575 | Open in IMG/M |
| 3300017427|Ga0182190_1113692 | Not Available | 572 | Open in IMG/M |
| 3300017427|Ga0182190_1124770 | Not Available | 554 | Open in IMG/M |
| 3300017427|Ga0182190_1145406 | Not Available | 525 | Open in IMG/M |
| 3300017427|Ga0182190_1159185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 508 | Open in IMG/M |
| 3300017427|Ga0182190_1164722 | Not Available | 502 | Open in IMG/M |
| 3300017430|Ga0182192_1049223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 775 | Open in IMG/M |
| 3300017430|Ga0182192_1113051 | Not Available | 584 | Open in IMG/M |
| 3300017430|Ga0182192_1116966 | Not Available | 577 | Open in IMG/M |
| 3300017430|Ga0182192_1143399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 537 | Open in IMG/M |
| 3300017433|Ga0182206_1134195 | Not Available | 531 | Open in IMG/M |
| 3300017433|Ga0182206_1151700 | Not Available | 510 | Open in IMG/M |
| 3300017436|Ga0182209_1074778 | Not Available | 660 | Open in IMG/M |
| 3300017436|Ga0182209_1140052 | Not Available | 540 | Open in IMG/M |
| 3300017436|Ga0182209_1161695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 514 | Open in IMG/M |
| 3300017436|Ga0182209_1166165 | Not Available | 509 | Open in IMG/M |
| 3300017438|Ga0182191_1094278 | Not Available | 629 | Open in IMG/M |
| 3300017438|Ga0182191_1160560 | Not Available | 526 | Open in IMG/M |
| 3300017442|Ga0182221_1048757 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 739 | Open in IMG/M |
| 3300017442|Ga0182221_1067551 | Not Available | 670 | Open in IMG/M |
| 3300017442|Ga0182221_1105365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 585 | Open in IMG/M |
| 3300017442|Ga0182221_1149662 | Not Available | 524 | Open in IMG/M |
| 3300017442|Ga0182221_1151211 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 522 | Open in IMG/M |
| 3300017442|Ga0182221_1158328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 514 | Open in IMG/M |
| 3300017443|Ga0182193_1124304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 591 | Open in IMG/M |
| 3300017443|Ga0182193_1130633 | Not Available | 581 | Open in IMG/M |
| 3300017443|Ga0182193_1164665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 536 | Open in IMG/M |
| 3300017680|Ga0182233_1072926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 617 | Open in IMG/M |
| 3300017680|Ga0182233_1091124 | Not Available | 559 | Open in IMG/M |
| 3300017680|Ga0182233_1111038 | Not Available | 512 | Open in IMG/M |
| 3300017682|Ga0182229_1047075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 731 | Open in IMG/M |
| 3300017682|Ga0182229_1062349 | Not Available | 636 | Open in IMG/M |
| 3300017682|Ga0182229_1085917 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria | 550 | Open in IMG/M |
| 3300017683|Ga0182218_1086186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 602 | Open in IMG/M |
| 3300017683|Ga0182218_1104452 | Not Available | 567 | Open in IMG/M |
| 3300017683|Ga0182218_1126065 | Not Available | 535 | Open in IMG/M |
| 3300017683|Ga0182218_1141010 | Not Available | 516 | Open in IMG/M |
| 3300017683|Ga0182218_1150497 | Not Available | 506 | Open in IMG/M |
| 3300017684|Ga0182225_1067765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 636 | Open in IMG/M |
| 3300017684|Ga0182225_1074290 | Not Available | 618 | Open in IMG/M |
| 3300017685|Ga0182227_1104732 | Not Available | 555 | Open in IMG/M |
| 3300017686|Ga0182205_1113598 | Not Available | 579 | Open in IMG/M |
| 3300017686|Ga0182205_1140886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 537 | Open in IMG/M |
| 3300017686|Ga0182205_1151730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 524 | Open in IMG/M |
| 3300017690|Ga0182223_1036715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 703 | Open in IMG/M |
| 3300021060|Ga0182232_1055064 | Not Available | 657 | Open in IMG/M |
| 3300021060|Ga0182232_1060197 | Not Available | 625 | Open in IMG/M |
| 3300025899|Ga0207642_11127300 | Not Available | 508 | Open in IMG/M |
| 3300025940|Ga0207691_10228570 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus → Candidatus Nitrosocosmicus oleophilus | 1611 | Open in IMG/M |
| 3300026089|Ga0207648_10572689 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 1039 | Open in IMG/M |
| 3300026089|Ga0207648_11250847 | Not Available | 697 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 92.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.17% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.76% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 0.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.35% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015267 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015282 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015285 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015286 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015305 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017417 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017680 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017682 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017685 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300021060 | Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0068868_1007768221 | 3300005338 | Miscanthus Rhizosphere | MGKKKTASKSQATFIDEESSLSLIENQEFVAMRAAQKVWPAPTTSEDQLR |
| Ga0068867_1022778922 | 3300005459 | Miscanthus Rhizosphere | MGWKKAASKSQAAFVDEESSLSVIENQEFMAMRAAQKVWP |
| Ga0068867_1023349902 | 3300005459 | Miscanthus Rhizosphere | MGKKKTASKSQATFVDEESSLSLIENLEFVAMRAAQKVWPAPTTSEDQL |
| Ga0068856_1023184441 | 3300005614 | Corn Rhizosphere | MGKKKTASKSQATFVDEESSLSLIENQEFVAMRAAQKVWPAPTTSEDQ |
| Ga0068866_105670291 | 3300005718 | Miscanthus Rhizosphere | MGKKKTTSKSQATFVDEESSLSLIENQEFVAMRAAQKVWPAPTTSED |
| Ga0068866_105702562 | 3300005718 | Miscanthus Rhizosphere | MGRKKSASKSQAAFVDEEASLSVIENQEFMAMRAAQKIWPAPTTT |
| Ga0068866_114343072 | 3300005718 | Miscanthus Rhizosphere | MGRKKSASKSQATFVDEEASLSVIENQEFMAMRAAQKIWL |
| Ga0068871_1020653321 | 3300006358 | Miscanthus Rhizosphere | MGRKKAASKSQAAFVDEESSLSVIENQEFMAMRAAQKVW |
| Ga0105246_117898271 | 3300011119 | Miscanthus Rhizosphere | MGKKKTASKSQAAFVDEESSLSLIENQEFVAMRAAQKVWPSPTTSED* |
| Ga0157374_118182381 | 3300013296 | Miscanthus Rhizosphere | MCRKKSASKSQAAFVDEEASLFVIENQEFMAMRAAQKI* |
| Ga0157374_127275292 | 3300013296 | Miscanthus Rhizosphere | RKKSASKSQTTFVDKEASLSMIENQEFMAMRAAQKI* |
| Ga0157378_108174612 | 3300013297 | Miscanthus Rhizosphere | MGKKKTASKSQATFVDEESSLSLIENLEFVAMRAAQKVWPAPTTSED* |
| Ga0157378_112308791 | 3300013297 | Miscanthus Rhizosphere | MGKKKAASKSQATFVDEELSLFVIENQEFVAMRAA* |
| Ga0157376_122718561 | 3300014969 | Miscanthus Rhizosphere | MGKKKAVNKSQAAFVDEESSLSVIENQEFMAMRAA* |
| Ga0182122_10400241 | 3300015267 | Miscanthus Phyllosphere | MGKKKTTSKSQAAFVDEESSLSLIENQEFMAMRAA* |
| Ga0182122_10725402 | 3300015267 | Miscanthus Phyllosphere | MGRKKTVSKSQAAFVDEESSLSLIENQEFVAMRAA* |
| Ga0182154_10196451 | 3300015268 | Miscanthus Phyllosphere | MGRKKSTSKSQATFVDEEASLSVTENQEFMAMRAAQKV* |
| Ga0182154_10225521 | 3300015268 | Miscanthus Phyllosphere | MGKKKTASKSQATFVDEESSLSLIENQEFVGMRAAQKVWPAPTTSED* |
| Ga0182154_10689431 | 3300015268 | Miscanthus Phyllosphere | MGRKKSASKSQATFVDEKASLSMIENQEFMAMRAAQKIWPAPTMTEDQL |
| Ga0182154_10727422 | 3300015268 | Miscanthus Phyllosphere | MGKKKTASKSQATFVDEESSLSLIENQEFVAMRAAQKVWPAPTT |
| Ga0182154_10731542 | 3300015268 | Miscanthus Phyllosphere | MGRKKSASKSQATFVDEEASLSVIENQEFMAMRAA* |
| Ga0182113_10266661 | 3300015269 | Miscanthus Phyllosphere | MGRKKSASKSQATFVDEEASLSVIENQEFMAMRAAQKIWPAPTTTED* |
| Ga0182113_10383841 | 3300015269 | Miscanthus Phyllosphere | MGRKKAVSKSQATFVDEESSLSVIENQEFVAMRAAQKAWPAPTTTKD* |
| Ga0182113_10414881 | 3300015269 | Miscanthus Phyllosphere | MGRKKATSKSQATFVDEESSLSMIENQEFVAIRAAQKSWPAPTTTED* |
| Ga0182113_10726642 | 3300015269 | Miscanthus Phyllosphere | MGRKKSASKSQATFVDEEASLSMIENQEFMAMRAA* |
| Ga0182188_10202283 | 3300015274 | Miscanthus Phyllosphere | MGRKKSASKSQATFVDEESSLSMIENQEFMAMRAAQKAWPAPTTTKD* |
| Ga0182188_10208132 | 3300015274 | Miscanthus Phyllosphere | MGRKKAASKSQVAFVDEESSLFVIENQEFMAMRAAQKVWLAPTMTKD* |
| Ga0182188_10300171 | 3300015274 | Miscanthus Phyllosphere | MGRKKSASKSQVAFVDEEASLSVIENQEFMAMRAAQKI* |
| Ga0182188_10360552 | 3300015274 | Miscanthus Phyllosphere | MGRKKLASKSQATFVNEEASISVIENQEFMAMRAAQKVWPA |
| Ga0182172_10176322 | 3300015275 | Miscanthus Phyllosphere | GRKKSVSKSQATFVDKEALFSTIENQEFMAMRAA* |
| Ga0182172_10627463 | 3300015275 | Miscanthus Phyllosphere | MGRKKSASKSQATFVDEEASLSVIENQEFMAMRAAQKI* |
| Ga0182170_10087442 | 3300015276 | Miscanthus Phyllosphere | MGKNKTMSKSQSNFVDEESSLFVIENQEFMAMRAAQKAWPAPM |
| Ga0182170_10212431 | 3300015276 | Miscanthus Phyllosphere | MGKKKTASKSQATFVDEESSLSLIQNQEFVAMRAAQKVWPAPTTNEDQL |
| Ga0182170_10465681 | 3300015276 | Miscanthus Phyllosphere | MGRKKLASKSQAAFVDEETSLSVIENQEFKAMRATQKIWP |
| Ga0182170_10501281 | 3300015276 | Miscanthus Phyllosphere | MGRKKSASKSQATFVDEEASLSVIENQEFMAMRVAQKVWPA |
| Ga0182170_10541642 | 3300015276 | Miscanthus Phyllosphere | MGRKKSASKSQAAFVDEEGSLSMIENQEFMAIRAA* |
| Ga0182170_10760602 | 3300015276 | Miscanthus Phyllosphere | MGRKKSASKSQVAFVDEEASLSVIENQELMAMRVAQKI* |
| Ga0182128_10047442 | 3300015277 | Miscanthus Phyllosphere | MGRKKSASKSQATFVDEEASLSVIENQEFMAMRAAQKVWPAPTTTED* |
| Ga0182128_10228932 | 3300015277 | Miscanthus Phyllosphere | MGRKKPASKSQAAFVDEESSLSGIENQEFMAMRAA* |
| Ga0182128_10433231 | 3300015277 | Miscanthus Phyllosphere | MGRKKSTSKSQATFVDEEASLSVIENQEFIAMRAAQKIWPAPT |
| Ga0182128_10489381 | 3300015277 | Miscanthus Phyllosphere | MGRKKSASKSQATFVDEEASLSIIENQEFMAMRVAQKI* |
| Ga0182128_10715742 | 3300015277 | Miscanthus Phyllosphere | MGRMKATSKSQATFVDKESSLFVIENKEFVAMRLPRKLGCL |
| Ga0182128_10728231 | 3300015277 | Miscanthus Phyllosphere | MGRKKSASQSQATFVDEEASLSVIENQEFMAMRAAQKI* |
| Ga0182128_10764101 | 3300015277 | Miscanthus Phyllosphere | MGRKKTVSKSQAAFVDKESSLSVIENQEFVAMRAA* |
| Ga0182174_10041242 | 3300015279 | Miscanthus Phyllosphere | MGRKKSASKSQAAFVDEEASLSVIENQEFMAMRAAQKI* |
| Ga0182174_10217122 | 3300015279 | Miscanthus Phyllosphere | MGRKKAMSKSQAAFVDEESSLFMIENQEFMAMRVAQKVWSAPTTTED* |
| Ga0182174_10414542 | 3300015279 | Miscanthus Phyllosphere | MGKKKAVSKSQSTFVDEESSLSMIENQEFMAMRAA* |
| Ga0182174_10598811 | 3300015279 | Miscanthus Phyllosphere | MGRKKSASKSQATFVDEEASLFVIENQEFMAMRAAQKVWP |
| Ga0182174_10640771 | 3300015279 | Miscanthus Phyllosphere | MGKKKTASKSQATFVDEESSLSLIENQEFVAMRAAQKVWPTPTTSED* |
| Ga0182174_10704561 | 3300015279 | Miscanthus Phyllosphere | MGRKKVTSKSQAAFVDEESSLSVIENQEFMAMRAA* |
| Ga0182174_10749891 | 3300015279 | Miscanthus Phyllosphere | MGRKKLASKSQAAFVDEETSLSVIENQEFMAMRAAQKIWLAPT |
| Ga0182160_10145672 | 3300015281 | Miscanthus Phyllosphere | MGRKKSASKSQAAFVDEEASLSMIENQEFMAMRAAQKIWPALTTTED* |
| Ga0182160_10373062 | 3300015281 | Miscanthus Phyllosphere | MGRKKSASKSQATFVDEEASLSVIENQEFMAMRAT* |
| Ga0182160_10613511 | 3300015281 | Miscanthus Phyllosphere | MGRKKSASKSQATFVNEEASLSVIENQEFMAMRAA* |
| Ga0182124_10193371 | 3300015282 | Miscanthus Phyllosphere | MGRKKATSKSQAAFVDEESSLSVIENQEFMAIRAAQKVWPALTMTED* |
| Ga0182124_10293611 | 3300015282 | Miscanthus Phyllosphere | MGKKKTTSKSQATFVDEESSLSLIQNQEFVAMRAAQKV |
| Ga0182124_10415071 | 3300015282 | Miscanthus Phyllosphere | MGRKKSASKSQAAFVDEEASLSVIENQEFMAMRAAQKIWPAP |
| Ga0182156_10308571 | 3300015283 | Miscanthus Phyllosphere | MGRKKSASKSQATFVDEEASLSVIENQEFMAMRAAQKV* |
| Ga0182156_10371981 | 3300015283 | Miscanthus Phyllosphere | MGRKKSASKSQAAFVDEEASLSVIENQEFMAMRAAQKIWPAPTTTE |
| Ga0182156_10592142 | 3300015283 | Miscanthus Phyllosphere | MGRKKATSKSQAAFVDEESSLFVIENQEFMAMRAA* |
| Ga0182156_10834911 | 3300015283 | Miscanthus Phyllosphere | MGRKKLTSKSQAAFVDEEASLFVIENQEFMAMRAA* |
| Ga0182186_10355091 | 3300015285 | Miscanthus Phyllosphere | MGRKKSASKSQTTFVDEEASLSVIENQEFMAMRAAQKIWPAPTMTKD* |
| Ga0182176_10137921 | 3300015286 | Miscanthus Phyllosphere | MGRKKATSKSQATFMDEESSLSVIENQEFVTMRAT* |
| Ga0182176_10188604 | 3300015286 | Miscanthus Phyllosphere | AASKSQATFVDEESSLSVIENHEFVAMRAAQKAWPTPTTTED* |
| Ga0182176_10208821 | 3300015286 | Miscanthus Phyllosphere | MGRKKAASKSQATFVDEESSLSVIENQEFVAMRVAQKAWPAPTMT |
| Ga0182176_10272241 | 3300015286 | Miscanthus Phyllosphere | MGRKKATSKSQATFVDEESSLSVIENQEFVAMRAAQKAWPAPTTTED* |
| Ga0182176_10774961 | 3300015286 | Miscanthus Phyllosphere | MGKKKTASKSQTTFVDEESSLTLIENQEFVAMRAAQKVWPAPT |
| Ga0182176_10839821 | 3300015286 | Miscanthus Phyllosphere | MGKKKTASKSQSSFMDEESSLSVIENQEFVAMRAAQKSW |
| Ga0182171_10134391 | 3300015287 | Miscanthus Phyllosphere | MGRKKAASKSQASFVDEESSLSMIENQEFMAMRAA* |
| Ga0182173_10710202 | 3300015288 | Miscanthus Phyllosphere | MGKKKTASKSQSSFVDEETSLPVIENQEFVAMRAAQKSWSAPTTTEE* |
| Ga0182138_10043071 | 3300015289 | Miscanthus Phyllosphere | MGRKKSASKSQATFVDEEASLSVIENQEFMAMRAPQKIWPAPTTTED* |
| Ga0182138_10219071 | 3300015289 | Miscanthus Phyllosphere | MGRKKSTNKSQATFVDEEASFFVIENQEFMAMRAAQKIWPALTMTKD* |
| Ga0182138_10497692 | 3300015289 | Miscanthus Phyllosphere | MGRKKSASKSQAAFVDEEASLSVIDNQEFMAMRAA* |
| Ga0182138_10715831 | 3300015289 | Miscanthus Phyllosphere | MGKKKAASKSQAAFVDEESSLSLIENQEFVAMRAAQKV |
| Ga0182138_10906761 | 3300015289 | Miscanthus Phyllosphere | MGRKKSVSNSQATFVDEEASLSVIENQEFMVMRAAQKIWPTPTTTKD* |
| Ga0182125_10228981 | 3300015291 | Miscanthus Phyllosphere | MGRKKAASKSQATFVDKESSLFMIENQEFMAMRAAQKVWPAPTMNEDQ |
| Ga0182141_10552131 | 3300015292 | Miscanthus Phyllosphere | MGKKKTTSKSQSSFVVEESSLSVIENQEFVAMRAAQKS* |
| Ga0182141_10667831 | 3300015292 | Miscanthus Phyllosphere | MGKKKTASKSQATFMDEESSLSLIENQEFVAMRAAQKVWPAP |
| Ga0182141_10766162 | 3300015292 | Miscanthus Phyllosphere | MGRRKAASKSQATSVDEESSLSMIENQEFVAMRAA* |
| Ga0182141_10783701 | 3300015292 | Miscanthus Phyllosphere | MGRKKSASKSQAAFVDEEASLSVIENKKFMAMRGAQKV* |
| Ga0182141_10904211 | 3300015292 | Miscanthus Phyllosphere | MGKKKTASKSQVTFVDEESSLSLIENQEFMAMRAAQKVW |
| Ga0182126_10481612 | 3300015294 | Miscanthus Phyllosphere | MGRKKATSKFQAAFVDEEASLSVIENQEFMAMRAAQKI* |
| Ga0182126_10562211 | 3300015294 | Miscanthus Phyllosphere | MGKKKTTSKSQSSFVDEESSLSVIENQEFVAMRAA* |
| Ga0182126_10651272 | 3300015294 | Miscanthus Phyllosphere | MGRKKAASKSQAAFVDEESSLSVIENQEFMAMRAA* |
| Ga0182126_10718941 | 3300015294 | Miscanthus Phyllosphere | MGKKKAASKSQSTFVDEESSLSVIENQEFVAMRAAQKSWPALTSTEE* |
| Ga0182126_10811831 | 3300015294 | Miscanthus Phyllosphere | MGRKKAASKSQATFMDEESSLSVIENQEFMAMRAA* |
| Ga0182175_10243421 | 3300015295 | Miscanthus Phyllosphere | MGRKKSASKSQATFVDEEASLSVIENQEFMAMRAAQKIWLAPTTTED* |
| Ga0182175_10368611 | 3300015295 | Miscanthus Phyllosphere | MGRKKAASKSQATFVDEEASLSLIENQEFVAMRAAQKIWPTLTTTED* |
| Ga0182175_10515381 | 3300015295 | Miscanthus Phyllosphere | MGRKKTASKSPATFVDEESSLSMIENQEFVAMRATQKAWPAPTTTED* |
| Ga0182175_10973842 | 3300015295 | Miscanthus Phyllosphere | MCRKKSASKSQATFVDEEASLSVIEKQEFMAMRAAQKI* |
| Ga0182157_10312681 | 3300015296 | Miscanthus Phyllosphere | MGRKKATSKSQAAFVDEESSLFVIENQKFMAMRAA* |
| Ga0182157_10934051 | 3300015296 | Miscanthus Phyllosphere | MGRKKAASKSQASFVDEESSLSVIENQEFVAMRAAQKAWSAPTTTED* |
| Ga0182157_10979911 | 3300015296 | Miscanthus Phyllosphere | MGRKKSASKSQATFVDEEASFSVIENQEFMAIGAAQKVWPALTMTED* |
| Ga0182106_10464492 | 3300015298 | Miscanthus Phyllosphere | MGRKKTASKSQATFVDEESSLSMIENQEFMAMRAAQKVWSAPTTTED* |
| Ga0182106_10550311 | 3300015298 | Miscanthus Phyllosphere | MGRKKSASKSQAAFVDEEASLFMIENQEFMAMRAAQKIWPALT |
| Ga0182106_10608432 | 3300015298 | Miscanthus Phyllosphere | MGKKKTASKSQATFIDEESSLSLIENQEFVAMRAAQKVWPA |
| Ga0182106_10670521 | 3300015298 | Miscanthus Phyllosphere | MGRKKSASKSQAAFVDEEASLSVIENQEFMAMRAAQKIWPAPTITED* |
| Ga0182106_10908862 | 3300015298 | Miscanthus Phyllosphere | MGKKKTASKSQATFVDEESSLSLIQNQEFVAMRAAQKVWPAPTTN |
| Ga0182107_10235322 | 3300015299 | Miscanthus Phyllosphere | MGKKKATSKSQSTFVDEESSLSVIENQEFVAMRAT* |
| Ga0182107_10641591 | 3300015299 | Miscanthus Phyllosphere | MGKKKTTSKSQATFVDEESSVSLIENQEFVAIRAAQKVWPA |
| Ga0182107_10725901 | 3300015299 | Miscanthus Phyllosphere | MGRKKSASKSHATFVDEEASLSMIENQEFMAMRAAQKVWPAPTTTEDQLRE |
| Ga0182107_10764561 | 3300015299 | Miscanthus Phyllosphere | MGRKKSASKSQAAFVDEEASLSMIENQEFMAMRAAQKIW |
| Ga0182108_10241751 | 3300015300 | Miscanthus Phyllosphere | MGKKKTASKSQSSFMDEESLLFVIENQEFVAMRAAQKSWPTP |
| Ga0182108_10383841 | 3300015300 | Miscanthus Phyllosphere | KSQATFVDEESSLSMIENQEFVAMRAAQKSWPAPTTTED* |
| Ga0182108_11041641 | 3300015300 | Miscanthus Phyllosphere | MGRKKAASKSQAAFVDEESSLSVIENQEFVAMRAA* |
| Ga0182143_10148552 | 3300015302 | Miscanthus Phyllosphere | MGKKKAASKSQSTFIDEESSLSVIENQEFVATRAA* |
| Ga0182143_10515632 | 3300015302 | Miscanthus Phyllosphere | MGRKKSASKSQTTFVDEEASLSMIQNQEFMAMRAAQKVWPAPTTTED* |
| Ga0182143_11037072 | 3300015302 | Miscanthus Phyllosphere | MGRKNAMSKSQATFVDEESSLSVIENQEFMAMRAA* |
| Ga0182123_10222371 | 3300015303 | Miscanthus Phyllosphere | MGKKKTASKSQAAFVDEESSLSLIKNQEFVAMRAA |
| Ga0182123_10354411 | 3300015303 | Miscanthus Phyllosphere | MGKKKTASKSQATFVDEESSLSLIENQEFMAMRAAQKVWPAPTTSEDQ |
| Ga0182123_10476832 | 3300015303 | Miscanthus Phyllosphere | MGRKKSVSKSQATFVDEEASLSVIENQEFMAMRAAQKIWPAPT |
| Ga0182123_10668192 | 3300015303 | Miscanthus Phyllosphere | MSRKKSTSKSQATFVDEEASLSIIENQEFMAMRAAQKIWLALTTTED* |
| Ga0182123_10918311 | 3300015303 | Miscanthus Phyllosphere | MGRKKSASKPQATFVDKEASLSMIENQEFMAMRAA* |
| Ga0182112_10106262 | 3300015304 | Miscanthus Phyllosphere | MGRKKATSTSQAAFVDEESSLSVIKNQEFMAMKAA* |
| Ga0182112_10228821 | 3300015304 | Miscanthus Phyllosphere | MGKKKTASKSQATFVDEESSLSLIQNQEFVAMRAAQKVW |
| Ga0182112_10535711 | 3300015304 | Miscanthus Phyllosphere | MGRKKAASKSQATFVDEESSLSVIENQEFMAMRAA* |
| Ga0182112_10701231 | 3300015304 | Miscanthus Phyllosphere | MGRKKSASKSQATFVDEEASLSVIENQEFMAMGAA* |
| Ga0182112_10968161 | 3300015304 | Miscanthus Phyllosphere | MGRKKSASKSHATFVDEEASLSVIENQEFVAMRAAQKIW |
| Ga0182158_10288841 | 3300015305 | Miscanthus Phyllosphere | MGRKKSASKFQEAFVDEEASLSMIENQEFMAMRAA* |
| Ga0182158_10688672 | 3300015305 | Miscanthus Phyllosphere | MGKKKTASKSQSSFVDEESSLSMIENQEFVAMRAA* |
| Ga0182144_10255431 | 3300015307 | Miscanthus Phyllosphere | MGKKKAASKSQSSFVDEESSLSVIENQEFVAMRAAQKSWLTPTTTEE |
| Ga0182144_10365652 | 3300015307 | Miscanthus Phyllosphere | MGRKKSASKFQAAFVDEEASLSVIDNQEFMAMRAA* |
| Ga0182142_10574352 | 3300015308 | Miscanthus Phyllosphere | MGRKKATSKSQATFVDEESSLSVIENQEFVAMRAA* |
| Ga0182142_10738131 | 3300015308 | Miscanthus Phyllosphere | MGKKKAASKSQAAFVDEESSLSLIEKQEFVAMRDAQKVW |
| Ga0182142_10764311 | 3300015308 | Miscanthus Phyllosphere | MGRKKSASKSQTTFVDEEASLFVIENQEFMAMRATQK |
| Ga0182142_10866782 | 3300015308 | Miscanthus Phyllosphere | MGKKKTASKSQATFVDKESSLSLIENQEFVAMRAAQKVWLAPTTSED* |
| Ga0182142_10990461 | 3300015308 | Miscanthus Phyllosphere | MGKKKTTSKSQSSFMDEESSLSVIENQEFVAMRAA* |
| Ga0182140_10276991 | 3300015314 | Miscanthus Phyllosphere | MGRKKATRKSQAAFVDEESSLSVIENQEFVAMRAAQKAWPALITTED* |
| Ga0182140_11115432 | 3300015314 | Miscanthus Phyllosphere | MGRKKSASKSQTTFVDEESSLSMIENQEFMAMRAA* |
| Ga0182140_11174321 | 3300015314 | Miscanthus Phyllosphere | MGRKKSVSKSQTTFVDEEASLSVIENQEFMAMRVAQKIWPALTTTEDQ |
| Ga0182127_10529941 | 3300015321 | Miscanthus Phyllosphere | MGRKKAASKSQATFVDEESSLSVIENQEFVAMRAAQKAWPAPTTTED* |
| Ga0182127_10545931 | 3300015321 | Miscanthus Phyllosphere | MGKKKTVSKAQSSFVDEESSLSMIENQEFVAMRAAQKS* |
| Ga0182127_10722412 | 3300015321 | Miscanthus Phyllosphere | MGRKKATSKSQATFVDEESSLSVIENQEFVAMRAT* |
| Ga0182127_10886281 | 3300015321 | Miscanthus Phyllosphere | MGRKKSASKSQAAFVDEEASLSVIENQEFMVIRVAQKIWPALPTAE |
| Ga0182127_11037151 | 3300015321 | Miscanthus Phyllosphere | MGKKKTASKSQSSFVDEESSLSVIENQEFVAMRAA |
| Ga0182110_10613831 | 3300015322 | Miscanthus Phyllosphere | MGQKKSASKSQATFVDEEVSLSVIENQEFMAMRAAQKVWPAPTTTED* |
| Ga0182129_10255881 | 3300015323 | Miscanthus Phyllosphere | MGRKKVVSKSQAAFVDEESSLSVIENQEFMAMRAAQKV* |
| Ga0182129_10357801 | 3300015323 | Miscanthus Phyllosphere | MGKKKTASKSQATFVDEESSLSLIENQEFVAMRAAQKVWPAPTTSED |
| Ga0182129_10588712 | 3300015323 | Miscanthus Phyllosphere | MGRKKTASKSQVAFVDEESSLSVIENQESVAMRAA* |
| Ga0182129_10963782 | 3300015323 | Miscanthus Phyllosphere | MGRKKATSKSQATFVDEESSLSVIENQEFMAMRAA |
| Ga0182187_10792202 | 3300015341 | Miscanthus Phyllosphere | YMGKKKTASKSQSSFVDEESSLSLIENQEFVAMRAAQKFWPAPTTTEA* |
| Ga0182187_11012863 | 3300015341 | Miscanthus Phyllosphere | MGRKKATSKSQATFVDEESSLSMIENQEFMAMRATQKSWLAPTTTED* |
| Ga0182187_11061381 | 3300015341 | Miscanthus Phyllosphere | MGRKKATSKSQATFVDEESSLSVIENQEFMAMRAAQKF* |
| Ga0182109_10986352 | 3300015342 | Miscanthus Phyllosphere | MGRKKPVSKSQVAFVDEETSLSVIENREFMAMRDA* |
| Ga0182109_11245612 | 3300015342 | Miscanthus Phyllosphere | MGKKKTVSKAQSSFVDEESSLSMIENQEFVAMRAA* |
| Ga0182109_11563131 | 3300015342 | Miscanthus Phyllosphere | MGKKKTTSKSQATFVDEESSVSLIENQEFVAMRAAQKVWPAPTTSEDQLRE |
| Ga0182109_12239111 | 3300015342 | Miscanthus Phyllosphere | MGRKKTASKSQATFVDEESSLSVIENQEFVAMRAA* |
| Ga0182155_12118471 | 3300015343 | Miscanthus Phyllosphere | MGRKKAVSKSQTAFVDEGSSLSVIENQEFMAMRAA* |
| Ga0182189_10352062 | 3300015344 | Miscanthus Phyllosphere | MGKKKTTSKSQSSFVDEESSLSMIENQEFIAMRAAQKSWLTPTTTEE* |
| Ga0182189_10561611 | 3300015344 | Miscanthus Phyllosphere | MGRKKLASKSQATFVDEEALLSVIENQEFMAMRAA* |
| Ga0182189_11933832 | 3300015344 | Miscanthus Phyllosphere | MGRKKSASKSQAAFVDEEASLSVIEKQEFLTMRAA* |
| Ga0182189_12009781 | 3300015344 | Miscanthus Phyllosphere | MGRKKSVRKSQAAFVDEEASLSMIENQEFIAMRAA* |
| Ga0182111_10857131 | 3300015345 | Miscanthus Phyllosphere | MGRKKTTSKSQVAFVDEESSLSVIENQEFMAMMAAQKVWPAPTTTEV* |
| Ga0182111_12066171 | 3300015345 | Miscanthus Phyllosphere | MGKKKAASKSQATFVDEESSLSVIKNQEFMAMRAA* |
| Ga0182111_12100811 | 3300015345 | Miscanthus Phyllosphere | MGRKKLVSKSQPTFVDEEASLSVIENQEFMAMRAAQKIWPAPTMTKD* |
| Ga0182139_10627501 | 3300015346 | Miscanthus Phyllosphere | MGRKKTTSKSQATFVDAESSLSVIENREFIAMRATQKVW |
| Ga0182139_11219691 | 3300015346 | Miscanthus Phyllosphere | MGKKKTVGKSHATFVDEESSLAVIENREFMAMRAAQKVWPAPTTTEDQL |
| Ga0182177_11099421 | 3300015347 | Miscanthus Phyllosphere | MGKKKTTSKSQAAFVDEESSLSLIENQEFVAMRAA* |
| Ga0182177_11617121 | 3300015347 | Miscanthus Phyllosphere | MGRKKAASKSQAAFVDEESSLFVIENQEFMAMRTA* |
| Ga0182177_11859291 | 3300015347 | Miscanthus Phyllosphere | MGRKKSTSKSQATFVDEEPSLSVIENQEFMVMRAAQ |
| Ga0182177_11861443 | 3300015347 | Miscanthus Phyllosphere | MGKKKAASKSQSTFVDKESSLSVIENQEFIAMRAAQKSWPAPTTTED* |
| Ga0182177_12123181 | 3300015347 | Miscanthus Phyllosphere | MGRKKSTSKSQVTFVDEEASLSVIENREFMAMRAAPKI* |
| Ga0182161_11035711 | 3300015351 | Miscanthus Phyllosphere | MGRKKSASKSQAAFVDEEASLCVIKNQEFMAMRAAQKIWPAPTTTED* |
| Ga0182161_11626191 | 3300015351 | Miscanthus Phyllosphere | MGKKKAASKSQAAFVDEESSLSLIENQEFVAMRAAQKVW |
| Ga0182161_12010291 | 3300015351 | Miscanthus Phyllosphere | MGKKKTASKSQSSFVDEESSLSVIENQEFVAMRAAQKSWPTPTTTKE* |
| Ga0182161_12276181 | 3300015351 | Miscanthus Phyllosphere | MGRKKSASKSQAAFVDEEASLSVFENQEFMAMWAAQKIWSAVTTT |
| Ga0182161_12330322 | 3300015351 | Miscanthus Phyllosphere | MGKKKTASKSQSSFMDEESLLFVIENQEFVAMRAAQKSWPTPTTT |
| Ga0182161_12530052 | 3300015351 | Miscanthus Phyllosphere | MGRKKAASKSQATFVDEESSLSMIENQEFMAMRAA* |
| Ga0182159_11119731 | 3300015355 | Miscanthus Phyllosphere | MGRTKAASKSQATFMDEESSLSVIENQEFMAMRAT* |
| Ga0182159_11509981 | 3300015355 | Miscanthus Phyllosphere | MGTKKLASKSQASFVDEEALLSVIENQEFMAMRAAQKIWPTPTTTED* |
| Ga0182159_11639251 | 3300015355 | Miscanthus Phyllosphere | MGRKKAANKSQAAFVDEESSLSLIENQEFVAMRAAQKVWLA |
| Ga0182159_12348041 | 3300015355 | Miscanthus Phyllosphere | MGRKKSASKSQASFVDEEASLSVIENQEFMAMRAAQKI* |
| Ga0182159_12543351 | 3300015355 | Miscanthus Phyllosphere | MGKKKTVSKSQIAFVDEESSLSLIENQEFVAMRVA* |
| Ga0182159_12556221 | 3300015355 | Miscanthus Phyllosphere | MGKKKTASKSQATFVDEESSLSLIENLEFVAMRAAQKVWPAPTTSED |
| Ga0182159_12570941 | 3300015355 | Miscanthus Phyllosphere | MGRKKSVSKSQAAFVDEEASLSVIENQEFMAMRAAQKIWPAPTTTED* |
| Ga0182159_12629312 | 3300015355 | Miscanthus Phyllosphere | MGRKKSASKSQATFVDEEASLSIIENQEFMAMRAAQKIWSAPTTTEVSFTSSLVMV* |
| Ga0182159_12802833 | 3300015355 | Miscanthus Phyllosphere | MGRKKAMSKSQVAFVDEETSLSVIENREFMAMRDA* |
| Ga0182159_12871831 | 3300015355 | Miscanthus Phyllosphere | MGRKKSAIKSQATFVDEEASLSVIENQEFMAMRAA* |
| Ga0182159_12892843 | 3300015355 | Miscanthus Phyllosphere | MGRKKPASKSHATFVDEEASLSVIENQELMAMRAAQKIWPAPTTTED* |
| Ga0182159_12941092 | 3300015355 | Miscanthus Phyllosphere | MGKKKTAGKSQASFVDEESSLPVIDNQEFMAMRAAQKAWPAPTTTEDQL |
| Ga0182159_12970731 | 3300015355 | Miscanthus Phyllosphere | MGRKKAASKSQATFVDKESSLSVIENQEFVAMRAAQKAWLAPTTTED* |
| Ga0182159_13392541 | 3300015355 | Miscanthus Phyllosphere | MGRKKLVSKSQPTFVDEEASLSVIENQEFMAMRAAQKIW |
| Ga0182159_13419582 | 3300015355 | Miscanthus Phyllosphere | MGRKKSARKSQAAFVDEEASLSVIENQEFMAMRAA* |
| Ga0182145_10039371 | 3300015361 | Miscanthus Phyllosphere | MGQKKSASKSQATFVDEEVSLSVIENQEFMAMRAAQKV* |
| Ga0182145_10727041 | 3300015361 | Miscanthus Phyllosphere | MGRKKSASKSQVAFVDEETSLFVIENQEFMAMRAAQKIWLAPT |
| Ga0182145_10990852 | 3300015361 | Miscanthus Phyllosphere | MGRKKAASKSQAAFVDEESSLPVIENQEFMAMRAA* |
| Ga0182145_11326171 | 3300015361 | Miscanthus Phyllosphere | MGRKKSASKSQATFVDEEASLSMIENQEFMAVRAAQKIWPALTTTED* |
| Ga0182145_11793612 | 3300015361 | Miscanthus Phyllosphere | MGKKKTVGKSHATFVDEESSLAVIENREFMAMRAAQKVWPAPTT |
| Ga0182145_11948181 | 3300015361 | Miscanthus Phyllosphere | MGRKKAASKSQAAFVDEESSLSVIENQEFMAMRAAQKVWPAPT |
| Ga0182203_11246562 | 3300017404 | Miscanthus Phyllosphere | KSQAAFVDEEASLSVVENQVFKAMRAAQKIWLALTTIED |
| Ga0182203_11304123 | 3300017404 | Miscanthus Phyllosphere | MGRKKSASKSQATFVDEEASLSMIENQEFMAMRAAQKVWPALT |
| Ga0182203_11587012 | 3300017404 | Miscanthus Phyllosphere | MGRKKAASKSQAAFVDKESSLSVIENQEFMAMRAAQKFWPAPTTTED |
| Ga0182220_10465722 | 3300017407 | Miscanthus Phyllosphere | MGRKKTTSKSQAAFVDEESSLSVIENQEFMAMRAT |
| Ga0182220_10800551 | 3300017407 | Miscanthus Phyllosphere | MGKKKAASKSQATFVGEESSLSVIENQKFVAMRVA |
| Ga0182220_10813792 | 3300017407 | Miscanthus Phyllosphere | MGKKKTASKSQSSFVDEESSLSLIENQEFVAMRAAQKFWPAPTTTEA |
| Ga0182204_10191693 | 3300017409 | Miscanthus Phyllosphere | MGKKKTASKSQATFVDEESSLSLIQNQEFVAMRAAQKVWPAPT |
| Ga0182204_10219581 | 3300017409 | Miscanthus Phyllosphere | MGRKKATSKSQATFMDKESSLFVIENQEFVAMRAA |
| Ga0182204_10875592 | 3300017409 | Miscanthus Phyllosphere | MGRKKSASKSQATFVDEEASLSMIENQEFMAMRAA |
| Ga0182204_11212561 | 3300017409 | Miscanthus Phyllosphere | MGKKKTASKSQSNFVDEESSLSLIENQEFVAMRATQKVWPA |
| Ga0182207_10301511 | 3300017410 | Miscanthus Phyllosphere | MGRKKSASKSQATFVDEEASLSVIENQKFMAMRAAQKVWPVQL |
| Ga0182207_10577491 | 3300017410 | Miscanthus Phyllosphere | MGRKKATSKSQAAFVDEESSLSVIENQEFMAMRAAQKVWPAPTTTEDQLRE |
| Ga0182207_11251821 | 3300017410 | Miscanthus Phyllosphere | MGKKKTASKSQATFVDEESSLSLIQNQEFVAMRAA |
| Ga0182207_11332961 | 3300017410 | Miscanthus Phyllosphere | MGRKKAASKSQATFVDEESSLSVIENQEFVAMRAAQKSWPAPTTTEDQL |
| Ga0182207_11598311 | 3300017410 | Miscanthus Phyllosphere | MGKKKTTSKSQSSFMDEESSLSVIENQEFVAMRAA |
| Ga0182208_10569841 | 3300017411 | Miscanthus Phyllosphere | MGRKKATTKSQATFVDEESSLSMIENQEFVAMRATQKAWPAPTTTED |
| Ga0182208_10690201 | 3300017411 | Miscanthus Phyllosphere | MRRKKSASKSQATFVDEEASLSVIENQEFMAMRAAQKIWPATTTTED |
| Ga0182208_10701851 | 3300017411 | Miscanthus Phyllosphere | MGRKKAASKSQATFMDEESSLSVIENQEFVAMRAA |
| Ga0182208_10909343 | 3300017411 | Miscanthus Phyllosphere | MGRKKATSKSQATFMDEESSLSMIENQEFVPMRAT |
| Ga0182208_10981921 | 3300017411 | Miscanthus Phyllosphere | MGRKKAVSKSQAAFVDEDSSLSMIKNQEFMAMRAAQKVWLAPTMTKD |
| Ga0182208_11137651 | 3300017411 | Miscanthus Phyllosphere | MGRKKSTSKSQVTFVDEEASLSVIENQEFMAMRAAQKIWPAPTMTED |
| Ga0182222_10181681 | 3300017413 | Miscanthus Phyllosphere | MGKKKATSKSQSTFVDEESSLSVIENQEFVAMRVAQK |
| Ga0182222_10696762 | 3300017413 | Miscanthus Phyllosphere | MGKKKTASKSQATFVDEESSLSVIENREFMATRAAQKDWLAPTTTED |
| Ga0182222_10770062 | 3300017413 | Miscanthus Phyllosphere | KKSASKSQAAFVDEEASLSVIENQEFMAMRAAHKI |
| Ga0182222_10949611 | 3300017413 | Miscanthus Phyllosphere | MGRKKATSKSQAAFVDEESSLSVIENQEFMAMRAAQKVWPAPTTTEDQL |
| Ga0182202_10142183 | 3300017415 | Miscanthus Phyllosphere | MGKKKTVSKSQATFVDKESSLSLIENQEFVAMRAAQKVWPAPTT |
| Ga0182202_10718191 | 3300017415 | Miscanthus Phyllosphere | MGRKKAVSKSQAAFVDEESSLSVIENQESVAMRAAQKAWPAPTTTED |
| Ga0182202_11043092 | 3300017415 | Miscanthus Phyllosphere | MGRKKATSKSQATFVDKESSLSVIENQEFVAMRAAQKAWPAPMTTEDQL |
| Ga0182202_11049502 | 3300017415 | Miscanthus Phyllosphere | MGRKKSVSKSQATFVDEEASLSVIENQEFMAMRAAQKI |
| Ga0182230_10735412 | 3300017417 | Miscanthus Phyllosphere | MGRKNAMSKSQATFVDEESSLYVIENQEFVAMRAA |
| Ga0182230_10740983 | 3300017417 | Miscanthus Phyllosphere | MGRKKSASKSQATFVDEEASLSVIENQEFMAMRAAQKIWSGPTTTED |
| Ga0182230_10793741 | 3300017417 | Miscanthus Phyllosphere | MGRKKSASKSQATFVDEEASLSVIENQEFMAMRATQKIWLAPTTTED |
| Ga0182228_11111412 | 3300017420 | Miscanthus Phyllosphere | MGRKKSASKSQAAFVDEEASLSVIENQEFVAMRAAQKIWPAPTTTEDQLR |
| Ga0182228_11270702 | 3300017420 | Miscanthus Phyllosphere | MGRKKLVSNSQATFVDEEASLSVIENQEFMAMRAA |
| Ga0182219_10869761 | 3300017424 | Miscanthus Phyllosphere | MGRKKSASKSQEAFVDEEASLFVIENQEFMAMRAAQKIWPAP |
| Ga0182224_10296061 | 3300017425 | Miscanthus Phyllosphere | MGRKKATSKSQATFVDEESSLSVIENQEFMAMRAAQKFWLAPRTTQD |
| Ga0182224_10313752 | 3300017425 | Miscanthus Phyllosphere | MGRKKSASKSQATFVDEEASLSVIENQEFMAMRAAQKIWPAPTMTKD |
| Ga0182224_10418412 | 3300017425 | Miscanthus Phyllosphere | MGRKKSASKSQAIFVDEEASLFVIENQEFMAMWAAQKVWPAPTTTEDQLR |
| Ga0182224_10765611 | 3300017425 | Miscanthus Phyllosphere | MGRKKATSKSQATFVDEESSLSMIENQEFVAIRAAQKSWPAPTTTED |
| Ga0182224_11072871 | 3300017425 | Miscanthus Phyllosphere | MGKKKSASKSQATFEDEEASLSVIENQEFMAMRAAQKV |
| Ga0182224_11100791 | 3300017425 | Miscanthus Phyllosphere | MGRKKAANKSQAAFVDEESSLSLIENQEFVAMWAAQKVWPAP |
| Ga0182224_11496031 | 3300017425 | Miscanthus Phyllosphere | MGKKKTASKSLSSFVDGESSLPVIENQEFVAMRAAQKSWPTPTT |
| Ga0182190_10715851 | 3300017427 | Miscanthus Phyllosphere | MGRKKAASKSQAAFVDEESSLSVIENQEFMAMRAA |
| Ga0182190_10765011 | 3300017427 | Miscanthus Phyllosphere | MGKKKSASKSQATFVDEEASLSMIENQEFMAMRAA |
| Ga0182190_11119152 | 3300017427 | Miscanthus Phyllosphere | MGRKKAANKPQAAFVDEESSLSLIENQEFVAMRAA |
| Ga0182190_11136922 | 3300017427 | Miscanthus Phyllosphere | MGRKKSASKSQTAFVDEEASLSMIENQEFMALRAA |
| Ga0182190_11247702 | 3300017427 | Miscanthus Phyllosphere | MGRKKSASKSQAAFVDEEASLSVIENQGFMAMRAAQKIWPA |
| Ga0182190_11454061 | 3300017427 | Miscanthus Phyllosphere | MGKKKTASKSQTAFVDEESSLSLIENEEFVAMRAAQKVWSAPTTE |
| Ga0182190_11591852 | 3300017427 | Miscanthus Phyllosphere | MGKKKAASKSQSSFVDEESSLSVIENQEFVAMRATQKSWLTPTTTEE |
| Ga0182190_11647221 | 3300017427 | Miscanthus Phyllosphere | MGKKKAANKSQAAFVDEESSLSLIVNQEFVAMRAAQKVWPAPTTTED |
| Ga0182192_10492232 | 3300017430 | Miscanthus Phyllosphere | MGRKKAASKSQAAFVDEEASLSVIENQEFMAMRARQ |
| Ga0182192_11130511 | 3300017430 | Miscanthus Phyllosphere | MGRKKAVSKSQAAFVDEESSLSVIENQEFMAMRAAQKIWPAPTTTAD |
| Ga0182192_11169661 | 3300017430 | Miscanthus Phyllosphere | MGKKKAANKSQAAFVDEESSLSLIKNQEFVAMRAAQKVWPAPTTTED |
| Ga0182192_11433992 | 3300017430 | Miscanthus Phyllosphere | MGRKKSASKSQATFVDEEASLSMIENQEFMAMRAAQKIWPAPTMIED |
| Ga0182206_11341952 | 3300017433 | Miscanthus Phyllosphere | MGRKKATSKSQATFVDEESSLSVIENQEFVAMRAT |
| Ga0182206_11517001 | 3300017433 | Miscanthus Phyllosphere | MGKKKSASKSQAAFVDEEASLSVIENQEFMSMRAAQKIWPA |
| Ga0182209_10747781 | 3300017436 | Miscanthus Phyllosphere | MGRKKAASKSQAAFVDEEASLFVIENQEFMAMRAA |
| Ga0182209_11400521 | 3300017436 | Miscanthus Phyllosphere | MGKKKTTSKSQATFVDKESSLSLIENQEFVAMRAAQKVWPA |
| Ga0182209_11616951 | 3300017436 | Miscanthus Phyllosphere | SKSQSSFMDEESSLSVIENQEFVAMRATQKSWLTPTTTEE |
| Ga0182209_11661652 | 3300017436 | Miscanthus Phyllosphere | MGRKKAMSNSHVAFVDDEASLSVIENQEFMAMRAA |
| Ga0182191_10942781 | 3300017438 | Miscanthus Phyllosphere | MGKKKTMSKSQSNFVDEESSLSVIENQEFMAMRAAQKAWPA |
| Ga0182191_11605602 | 3300017438 | Miscanthus Phyllosphere | MGRNKATSKSQATFVDEESSLSVIENQEFVAMRAAQKAWPAPTTTED |
| Ga0182221_10487571 | 3300017442 | Miscanthus Phyllosphere | YMGKKKTASKSQSSFVDEESSLSLIENQEFVAMRAAQKFWPAPTTTEA |
| Ga0182221_10675511 | 3300017442 | Miscanthus Phyllosphere | MGRKKLASKSQAAFVDEEASLSVIENQEFMAMRAAQKIWPAPTTTEDQL |
| Ga0182221_11053651 | 3300017442 | Miscanthus Phyllosphere | MGRKKTASKSQATFVDEESSLSVIENQEFVAMRAA |
| Ga0182221_11496621 | 3300017442 | Miscanthus Phyllosphere | MGRKKAAIKSQVAFVDEEASLSVIENQEFMAMRAAQKIWPALTTTED |
| Ga0182221_11512111 | 3300017442 | Miscanthus Phyllosphere | MGRKKAASKSQATFMDEESSLSMIENQEFVAMRAAQKAWSAPTTTED |
| Ga0182221_11583281 | 3300017442 | Miscanthus Phyllosphere | MDKKKAASKSQATFVDEESSLFVIENQEFVAMRAAQKAWPAPMTTED |
| Ga0182193_11243041 | 3300017443 | Miscanthus Phyllosphere | MGRKKSASKSQATFVDEEALLSVIENQEFMAMRAAQKI |
| Ga0182193_11306331 | 3300017443 | Miscanthus Phyllosphere | MGRKKSASKSQAAFVDKEASLSMIENQEFLAMRAA |
| Ga0182193_11646652 | 3300017443 | Miscanthus Phyllosphere | MGRKKLASKSQVTFVDEEASLSVIENQEFMAMRAA |
| Ga0182233_10729261 | 3300017680 | Miscanthus Phyllosphere | MGKKKTASKSQATFVDEESSLSLIENQEFVAMRAAQKVWPAPTTTED |
| Ga0182233_10911241 | 3300017680 | Miscanthus Phyllosphere | MGKKKTASKSQATFMDEESSLSLIEKQEFMAMKAAQKVWPAPTTSEDQ |
| Ga0182233_11110382 | 3300017680 | Miscanthus Phyllosphere | MGRKKATSKFQATFVDEEASLSVIENQEFMAMRAA |
| Ga0182229_10470752 | 3300017682 | Miscanthus Phyllosphere | MGRKKSASKSQATFVDEEASLSVIENQEFMAMRATQKIWSAPTTTED |
| Ga0182229_10623491 | 3300017682 | Miscanthus Phyllosphere | MGKKKATRKSQATFVDEESSLSVIENQEFVAMRAAQKAWPAPMMTEDQL |
| Ga0182229_10859173 | 3300017682 | Miscanthus Phyllosphere | MGRKKAVSKSQATFVDEESSLSVIENQEFVAMRAA |
| Ga0182218_10861862 | 3300017683 | Miscanthus Phyllosphere | MGKKKTASKSQSSFVDEETSLSVIENQEFVAMRAA |
| Ga0182218_11044521 | 3300017683 | Miscanthus Phyllosphere | MGRKKAANKSQAAFVDEESSLSLIENQEFMAMRAAQKV |
| Ga0182218_11260652 | 3300017683 | Miscanthus Phyllosphere | MGRKKAASKSQAAFVDEESSLSVIKNQEFMAIRAV |
| Ga0182218_11410101 | 3300017683 | Miscanthus Phyllosphere | MGRKKTASKSPATFVDEESSLSMIENQEFVAMRATQKAWPAPTTTED |
| Ga0182218_11504971 | 3300017683 | Miscanthus Phyllosphere | MGRKKAMSKSQAAFVDKESSLSVIENQEFMAMRAA |
| Ga0182225_10677651 | 3300017684 | Miscanthus Phyllosphere | MGRKKAESKSQATFMDEESSLSVIENQEFMAMKAAQKSLAGSDNN |
| Ga0182225_10742901 | 3300017684 | Miscanthus Phyllosphere | MGRKKSASKSQATFVDEEASLFVIENQEFMAMRAAQKVWPAPT |
| Ga0182227_11047321 | 3300017685 | Miscanthus Phyllosphere | MGRKKSASKSQATFVDVEASLSVIENQEFMAMRAAQKVW |
| Ga0182205_11135981 | 3300017686 | Miscanthus Phyllosphere | MGRKKSASKSQATFVYKEASLSVIENQEVMAMRAAQKIWSALTTTED |
| Ga0182205_11408861 | 3300017686 | Miscanthus Phyllosphere | MGRKKATSKSQATFVDKESSLYVIENQEFMAMRAAQKVWPAPTMTED |
| Ga0182205_11517302 | 3300017686 | Miscanthus Phyllosphere | KKAASKSQAAFVDEESSLSVIENQEFMAMRAVQKVWLAPTMTED |
| Ga0182223_10367152 | 3300017690 | Miscanthus Phyllosphere | MGRKKSASKSQASFVDEEASLSVIENQEFMAMRAAQKIWPAPTTTED |
| Ga0182232_10550641 | 3300021060 | Phyllosphere | MGRKKAANKSQAAFVDEESSLSLIENQEFVAMRAT |
| Ga0182232_10601971 | 3300021060 | Phyllosphere | MGMKKSARKSQASFVDEEASLFVIENQEFMAMRVAQKIWPAPTTTED |
| Ga0207642_111273001 | 3300025899 | Miscanthus Rhizosphere | MGKKKTASKSQATFVDEESSLSLIENQEFVAMRAAQKVWPAPITSED |
| Ga0207691_102285701 | 3300025940 | Miscanthus Rhizosphere | MGKKKTASKSQATFVDEESSLSLIENLEFVAMRVAQKVWPAPTTSED |
| Ga0207648_105726892 | 3300026089 | Miscanthus Rhizosphere | MGRKKSVSKSQATFVDEEASLSVIENQEFMAMRAAQKIWPAPTTTED |
| Ga0207648_112508471 | 3300026089 | Miscanthus Rhizosphere | MGKKKTASKSQATFVDEESSLSLIQNQEFVAMRASQKVWPAP |
| ⦗Top⦘ |