| Basic Information | |
|---|---|
| Family ID | F011812 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 287 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MPEPLIERVEVVALLFNVSDIAVTLTNIERLLGEDDGEEEADEG |
| Number of Associated Samples | 226 |
| Number of Associated Scaffolds | 287 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 41.55 % |
| % of genes near scaffold ends (potentially truncated) | 23.69 % |
| % of genes from short scaffolds (< 2000 bps) | 86.41 % |
| Associated GOLD sequencing projects | 210 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.171 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.679 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.010 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.174 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.50% β-sheet: 0.00% Coil/Unstructured: 62.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 287 Family Scaffolds |
|---|---|---|
| PF00196 | GerE | 2.44 |
| PF00903 | Glyoxalase | 2.44 |
| PF00583 | Acetyltransf_1 | 2.09 |
| PF02074 | Peptidase_M32 | 1.74 |
| PF02775 | TPP_enzyme_C | 1.39 |
| PF12681 | Glyoxalase_2 | 1.39 |
| PF13649 | Methyltransf_25 | 1.39 |
| PF07883 | Cupin_2 | 1.39 |
| PF13561 | adh_short_C2 | 1.05 |
| PF00155 | Aminotran_1_2 | 1.05 |
| PF04389 | Peptidase_M28 | 1.05 |
| PF02621 | VitK2_biosynth | 1.05 |
| PF04828 | GFA | 1.05 |
| PF00962 | A_deaminase | 1.05 |
| PF13365 | Trypsin_2 | 1.05 |
| PF01872 | RibD_C | 0.70 |
| PF00291 | PALP | 0.70 |
| PF00587 | tRNA-synt_2b | 0.70 |
| PF00561 | Abhydrolase_1 | 0.70 |
| PF08281 | Sigma70_r4_2 | 0.70 |
| PF07582 | Obsolete Pfam Family | 0.70 |
| PF02786 | CPSase_L_D2 | 0.70 |
| PF13432 | TPR_16 | 0.70 |
| PF01513 | NAD_kinase | 0.70 |
| PF05853 | BKACE | 0.70 |
| PF00106 | adh_short | 0.70 |
| PF13476 | AAA_23 | 0.70 |
| PF14748 | P5CR_dimer | 0.70 |
| PF13427 | DUF4111 | 0.70 |
| PF12847 | Methyltransf_18 | 0.35 |
| PF14520 | HHH_5 | 0.35 |
| PF01642 | MM_CoA_mutase | 0.35 |
| PF00873 | ACR_tran | 0.35 |
| PF06224 | HTH_42 | 0.35 |
| PF11752 | DUF3309 | 0.35 |
| PF03795 | YCII | 0.35 |
| PF03551 | PadR | 0.35 |
| PF04029 | 2-ph_phosp | 0.35 |
| PF01636 | APH | 0.35 |
| PF02371 | Transposase_20 | 0.35 |
| PF13518 | HTH_28 | 0.35 |
| PF14559 | TPR_19 | 0.35 |
| PF05227 | CHASE3 | 0.35 |
| PF01850 | PIN | 0.35 |
| PF00067 | p450 | 0.35 |
| PF02272 | DHHA1 | 0.35 |
| PF02803 | Thiolase_C | 0.35 |
| PF02223 | Thymidylate_kin | 0.35 |
| PF12900 | Pyridox_ox_2 | 0.35 |
| PF02518 | HATPase_c | 0.35 |
| PF13487 | HD_5 | 0.35 |
| PF08241 | Methyltransf_11 | 0.35 |
| PF01266 | DAO | 0.35 |
| PF02912 | Phe_tRNA-synt_N | 0.35 |
| PF02773 | S-AdoMet_synt_C | 0.35 |
| PF09948 | DUF2182 | 0.35 |
| PF07040 | DUF1326 | 0.35 |
| PF12698 | ABC2_membrane_3 | 0.35 |
| PF00364 | Biotin_lipoyl | 0.35 |
| PF02567 | PhzC-PhzF | 0.35 |
| PF03816 | LytR_cpsA_psr | 0.35 |
| PF04055 | Radical_SAM | 0.35 |
| PF03681 | Obsolete Pfam Family | 0.35 |
| PF04542 | Sigma70_r2 | 0.35 |
| PF13302 | Acetyltransf_3 | 0.35 |
| PF00557 | Peptidase_M24 | 0.35 |
| PF13671 | AAA_33 | 0.35 |
| PF02288 | Dehydratase_MU | 0.35 |
| PF09594 | GT87 | 0.35 |
| PF14026 | DUF4242 | 0.35 |
| PF01244 | Peptidase_M19 | 0.35 |
| PF00300 | His_Phos_1 | 0.35 |
| PF03759 | PRONE | 0.35 |
| PF13200 | DUF4015 | 0.35 |
| PF01738 | DLH | 0.35 |
| PF16277 | DUF4926 | 0.35 |
| PF00588 | SpoU_methylase | 0.35 |
| PF00117 | GATase | 0.35 |
| PF13280 | WYL | 0.35 |
| PF12146 | Hydrolase_4 | 0.35 |
| PF03992 | ABM | 0.35 |
| PF14106 | DUF4279 | 0.35 |
| PF01638 | HxlR | 0.35 |
| PF05400 | FliT | 0.35 |
| PF05491 | RuvB_C | 0.35 |
| PF02687 | FtsX | 0.35 |
| PF08240 | ADH_N | 0.35 |
| PF13340 | DUF4096 | 0.35 |
| PF07690 | MFS_1 | 0.35 |
| PF06351 | Allene_ox_cyc | 0.35 |
| PF08447 | PAS_3 | 0.35 |
| PF00977 | His_biosynth | 0.35 |
| PF10590 | PNP_phzG_C | 0.35 |
| PF09130 | DUF1932 | 0.35 |
| PF01243 | Putative_PNPOx | 0.35 |
| PF04229 | GrpB | 0.35 |
| PF09413 | DUF2007 | 0.35 |
| PF01939 | NucS | 0.35 |
| PF07676 | PD40 | 0.35 |
| PF00694 | Aconitase_C | 0.35 |
| PF00202 | Aminotran_3 | 0.35 |
| PF04998 | RNA_pol_Rpb1_5 | 0.35 |
| PF13419 | HAD_2 | 0.35 |
| PF01039 | Carboxyl_trans | 0.35 |
| PF01230 | HIT | 0.35 |
| COG ID | Name | Functional Category | % Frequency in 287 Family Scaffolds |
|---|---|---|---|
| COG2317 | Zn-dependent carboxypeptidase, M32 family | Posttranslational modification, protein turnover, chaperones [O] | 1.74 |
| COG1816 | Adenosine/6-amino-6-deoxyfutalosine deaminase | Nucleotide transport and metabolism [F] | 1.05 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 1.05 |
| COG1427 | Chorismate dehydratase (menaquinone biosynthesis, futalosine pathway) | Coenzyme transport and metabolism [H] | 1.05 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.70 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.70 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.70 |
| COG3246 | Uncharacterized conserved protein, DUF849 family | Function unknown [S] | 0.70 |
| COG2045 | Phosphosulfolactate phosphohydrolase or related enzyme | Coenzyme transport and metabolism [H] | 0.70 |
| COG2320 | GrpB domain, predicted nucleotidyltransferase, UPF0157 family | General function prediction only [R] | 0.35 |
| COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 0.35 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.35 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.35 |
| COG2255 | Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvB | Replication, recombination and repair [L] | 0.35 |
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.35 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.35 |
| COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 0.35 |
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.35 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.35 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.35 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.35 |
| COG0016 | Phenylalanyl-tRNA synthetase alpha subunit | Translation, ribosomal structure and biogenesis [J] | 0.35 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.35 |
| COG0086 | DNA-directed RNA polymerase, beta' subunit/160 kD subunit | Transcription [K] | 0.35 |
| COG0125 | Thymidylate kinase | Nucleotide transport and metabolism [F] | 0.35 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.35 |
| COG0192 | S-adenosylmethionine synthetase | Coenzyme transport and metabolism [H] | 0.35 |
| COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 0.35 |
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 0.35 |
| COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.35 |
| COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 0.35 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.35 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.35 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.35 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.35 |
| COG1316 | Anionic cell wall polymer biosynthesis enzyme TagV/TagU, LytR-Cps2A-Psr (LCP) family (peptidoglycan teichoic acid transferase) | Cell wall/membrane/envelope biogenesis [M] | 0.35 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.35 |
| COG1637 | Endonuclease NucS, RecB family | Replication, recombination and repair [L] | 0.35 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.35 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.52 % |
| Unclassified | root | N/A | 26.48 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17044922 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 2124908038|B3_all_c_ConsensusfromContig115644 | Not Available | 651 | Open in IMG/M |
| 2124908044|A5_c1_ConsensusfromContig40124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1369 | Open in IMG/M |
| 2124908045|KansclcFeb2_ConsensusfromContig146173 | Not Available | 530 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101582042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2521 | Open in IMG/M |
| 3300000956|JGI10216J12902_101248927 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
| 3300000956|JGI10216J12902_103525866 | All Organisms → cellular organisms → Bacteria | 3174 | Open in IMG/M |
| 3300000956|JGI10216J12902_105680705 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300000956|JGI10216J12902_107848654 | Not Available | 691 | Open in IMG/M |
| 3300000956|JGI10216J12902_118154326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
| 3300000956|JGI10216J12902_126681271 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300001361|A30PFW6_1426202 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300001535|A3PFW1_10855855 | Not Available | 639 | Open in IMG/M |
| 3300001538|A10PFW1_12449863 | Not Available | 884 | Open in IMG/M |
| 3300003267|soilL1_10105187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1798 | Open in IMG/M |
| 3300004156|Ga0062589_102008311 | Not Available | 587 | Open in IMG/M |
| 3300004157|Ga0062590_100700946 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300004643|Ga0062591_102450448 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 547 | Open in IMG/M |
| 3300005171|Ga0066677_10464192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 726 | Open in IMG/M |
| 3300005172|Ga0066683_10223357 | Not Available | 1165 | Open in IMG/M |
| 3300005175|Ga0066673_10804814 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300005179|Ga0066684_11119473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 503 | Open in IMG/M |
| 3300005184|Ga0066671_10988165 | Not Available | 530 | Open in IMG/M |
| 3300005187|Ga0066675_10493381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 915 | Open in IMG/M |
| 3300005327|Ga0070658_10109429 | All Organisms → cellular organisms → Bacteria | 2288 | Open in IMG/M |
| 3300005329|Ga0070683_100677219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 988 | Open in IMG/M |
| 3300005329|Ga0070683_101514382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 645 | Open in IMG/M |
| 3300005356|Ga0070674_102221769 | Not Available | 501 | Open in IMG/M |
| 3300005366|Ga0070659_102121099 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005445|Ga0070708_101154069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 725 | Open in IMG/M |
| 3300005451|Ga0066681_10874907 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300005458|Ga0070681_10466957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium | 1174 | Open in IMG/M |
| 3300005468|Ga0070707_100722699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 959 | Open in IMG/M |
| 3300005468|Ga0070707_101240431 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300005468|Ga0070707_101852438 | Not Available | 571 | Open in IMG/M |
| 3300005526|Ga0073909_10391313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 653 | Open in IMG/M |
| 3300005540|Ga0066697_10082983 | All Organisms → cellular organisms → Bacteria | 1852 | Open in IMG/M |
| 3300005545|Ga0070695_101506778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 560 | Open in IMG/M |
| 3300005553|Ga0066695_10226209 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300005557|Ga0066704_10837548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
| 3300005557|Ga0066704_10845461 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300005559|Ga0066700_11071841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
| 3300005563|Ga0068855_101461679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 703 | Open in IMG/M |
| 3300005576|Ga0066708_10108506 | All Organisms → cellular organisms → Bacteria | 1659 | Open in IMG/M |
| 3300005576|Ga0066708_10489915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 792 | Open in IMG/M |
| 3300005587|Ga0066654_10429024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 722 | Open in IMG/M |
| 3300005618|Ga0068864_100721606 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300005764|Ga0066903_101029426 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
| 3300005764|Ga0066903_105088456 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300005937|Ga0081455_10133792 | All Organisms → cellular organisms → Bacteria | 1935 | Open in IMG/M |
| 3300006028|Ga0070717_11734240 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300006046|Ga0066652_100308048 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300006059|Ga0075017_100682493 | Not Available | 789 | Open in IMG/M |
| 3300006196|Ga0075422_10090807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1160 | Open in IMG/M |
| 3300006755|Ga0079222_10698631 | Not Available | 802 | Open in IMG/M |
| 3300006797|Ga0066659_11581044 | Not Available | 550 | Open in IMG/M |
| 3300006800|Ga0066660_11442904 | Not Available | 540 | Open in IMG/M |
| 3300006844|Ga0075428_100035387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5505 | Open in IMG/M |
| 3300006880|Ga0075429_100336958 | Not Available | 1320 | Open in IMG/M |
| 3300007004|Ga0079218_11571142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 718 | Open in IMG/M |
| 3300007790|Ga0105679_10414240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1916 | Open in IMG/M |
| 3300007821|Ga0104323_103845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1058 | Open in IMG/M |
| 3300009012|Ga0066710_100081059 | All Organisms → cellular organisms → Bacteria | 4230 | Open in IMG/M |
| 3300009012|Ga0066710_100962681 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
| 3300009012|Ga0066710_102612085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 725 | Open in IMG/M |
| 3300009012|Ga0066710_103759852 | Not Available | 570 | Open in IMG/M |
| 3300009090|Ga0099827_10318497 | Not Available | 1318 | Open in IMG/M |
| 3300009090|Ga0099827_11111767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 686 | Open in IMG/M |
| 3300009090|Ga0099827_11437225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 600 | Open in IMG/M |
| 3300009090|Ga0099827_11581678 | Not Available | 571 | Open in IMG/M |
| 3300009094|Ga0111539_10363293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1685 | Open in IMG/M |
| 3300009137|Ga0066709_100335221 | All Organisms → cellular organisms → Bacteria | 2071 | Open in IMG/M |
| 3300009137|Ga0066709_100340538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2056 | Open in IMG/M |
| 3300009137|Ga0066709_100448051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1804 | Open in IMG/M |
| 3300009137|Ga0066709_100640060 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1520 | Open in IMG/M |
| 3300009137|Ga0066709_101358880 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300009137|Ga0066709_101585399 | Not Available | 938 | Open in IMG/M |
| 3300009143|Ga0099792_11156094 | Not Available | 523 | Open in IMG/M |
| 3300009147|Ga0114129_10412654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1778 | Open in IMG/M |
| 3300009156|Ga0111538_10313946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1984 | Open in IMG/M |
| 3300009545|Ga0105237_12287485 | Not Available | 550 | Open in IMG/M |
| 3300009804|Ga0105063_1039313 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300009840|Ga0126313_10718258 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300010036|Ga0126305_10910541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
| 3300010041|Ga0126312_11222864 | Not Available | 554 | Open in IMG/M |
| 3300010045|Ga0126311_11905955 | Not Available | 505 | Open in IMG/M |
| 3300010303|Ga0134082_10024776 | All Organisms → cellular organisms → Bacteria | 2232 | Open in IMG/M |
| 3300010323|Ga0134086_10289089 | Not Available | 634 | Open in IMG/M |
| 3300010329|Ga0134111_10443276 | Not Available | 562 | Open in IMG/M |
| 3300010379|Ga0136449_101143040 | Not Available | 1234 | Open in IMG/M |
| 3300010396|Ga0134126_12495981 | Not Available | 562 | Open in IMG/M |
| 3300010399|Ga0134127_11921256 | Not Available | 669 | Open in IMG/M |
| 3300011269|Ga0137392_10238616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1494 | Open in IMG/M |
| 3300011991|Ga0120153_1021440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1451 | Open in IMG/M |
| 3300011992|Ga0120146_1002701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5190 | Open in IMG/M |
| 3300011994|Ga0120157_1077588 | Not Available | 674 | Open in IMG/M |
| 3300012011|Ga0120152_1084289 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300012014|Ga0120159_1106134 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300012096|Ga0137389_11612604 | Not Available | 545 | Open in IMG/M |
| 3300012096|Ga0137389_11648490 | Not Available | 537 | Open in IMG/M |
| 3300012198|Ga0137364_10020932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4020 | Open in IMG/M |
| 3300012198|Ga0137364_10632615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 807 | Open in IMG/M |
| 3300012198|Ga0137364_10863428 | Not Available | 684 | Open in IMG/M |
| 3300012199|Ga0137383_10298907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1179 | Open in IMG/M |
| 3300012199|Ga0137383_11148316 | Not Available | 560 | Open in IMG/M |
| 3300012200|Ga0137382_10498809 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300012200|Ga0137382_10971560 | Not Available | 610 | Open in IMG/M |
| 3300012201|Ga0137365_10214397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1437 | Open in IMG/M |
| 3300012201|Ga0137365_10218766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1421 | Open in IMG/M |
| 3300012201|Ga0137365_10417712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 989 | Open in IMG/M |
| 3300012201|Ga0137365_10492866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 901 | Open in IMG/M |
| 3300012202|Ga0137363_11578611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 548 | Open in IMG/M |
| 3300012204|Ga0137374_10364787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1160 | Open in IMG/M |
| 3300012205|Ga0137362_10278340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1447 | Open in IMG/M |
| 3300012207|Ga0137381_10712400 | Not Available | 872 | Open in IMG/M |
| 3300012208|Ga0137376_10416951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1166 | Open in IMG/M |
| 3300012208|Ga0137376_11271655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 626 | Open in IMG/M |
| 3300012210|Ga0137378_10141655 | All Organisms → cellular organisms → Bacteria | 2226 | Open in IMG/M |
| 3300012211|Ga0137377_10331582 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
| 3300012211|Ga0137377_11158638 | Not Available | 703 | Open in IMG/M |
| 3300012211|Ga0137377_11794465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
| 3300012350|Ga0137372_10816944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 668 | Open in IMG/M |
| 3300012351|Ga0137386_10901123 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300012355|Ga0137369_10868970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 609 | Open in IMG/M |
| 3300012356|Ga0137371_10199586 | Not Available | 1566 | Open in IMG/M |
| 3300012356|Ga0137371_10513198 | Not Available | 925 | Open in IMG/M |
| 3300012356|Ga0137371_10725223 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300012357|Ga0137384_10570605 | Not Available | 925 | Open in IMG/M |
| 3300012357|Ga0137384_11159646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 616 | Open in IMG/M |
| 3300012361|Ga0137360_10606342 | Not Available | 937 | Open in IMG/M |
| 3300012362|Ga0137361_10425421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1220 | Open in IMG/M |
| 3300012363|Ga0137390_10283475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1640 | Open in IMG/M |
| 3300012469|Ga0150984_113794477 | Not Available | 574 | Open in IMG/M |
| 3300012512|Ga0157327_1014410 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Eurotiomycetes → Eurotiomycetidae → Eurotiales → Aspergillaceae → Aspergillus → Aspergillus subgen. Circumdati → Aspergillus terreus → Aspergillus terreus NIH2624 | 808 | Open in IMG/M |
| 3300012519|Ga0157352_1081898 | Not Available | 542 | Open in IMG/M |
| 3300012527|Ga0136633_1006109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7208 | Open in IMG/M |
| 3300012527|Ga0136633_1165349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. WL0053 | 846 | Open in IMG/M |
| 3300012668|Ga0157216_10438719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
| 3300012681|Ga0136613_10093973 | Not Available | 1717 | Open in IMG/M |
| 3300012681|Ga0136613_10330136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Micropruina → unclassified Micropruina → Micropruina sp. | 842 | Open in IMG/M |
| 3300012682|Ga0136611_10160552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1552 | Open in IMG/M |
| 3300012684|Ga0136614_10191788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1541 | Open in IMG/M |
| 3300012917|Ga0137395_10306850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1125 | Open in IMG/M |
| 3300012930|Ga0137407_10484345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1154 | Open in IMG/M |
| 3300012948|Ga0126375_11399134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 593 | Open in IMG/M |
| 3300012958|Ga0164299_11636810 | Not Available | 508 | Open in IMG/M |
| 3300012961|Ga0164302_11232976 | Not Available | 600 | Open in IMG/M |
| 3300012975|Ga0134110_10075378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1346 | Open in IMG/M |
| 3300012975|Ga0134110_10541721 | Not Available | 534 | Open in IMG/M |
| 3300012982|Ga0168317_1014813 | All Organisms → cellular organisms → Bacteria | 2409 | Open in IMG/M |
| 3300012982|Ga0168317_1024727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1708 | Open in IMG/M |
| 3300012988|Ga0164306_10665442 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300013307|Ga0157372_13090146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 531 | Open in IMG/M |
| 3300013758|Ga0120147_1034664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 920 | Open in IMG/M |
| 3300013765|Ga0120172_1174511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 501 | Open in IMG/M |
| 3300013768|Ga0120155_1135180 | Not Available | 674 | Open in IMG/M |
| 3300013770|Ga0120123_1098147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 666 | Open in IMG/M |
| 3300013772|Ga0120158_10058440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2591 | Open in IMG/M |
| 3300013772|Ga0120158_10125472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256 | 1476 | Open in IMG/M |
| 3300013772|Ga0120158_10149688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1294 | Open in IMG/M |
| 3300013772|Ga0120158_10321447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 739 | Open in IMG/M |
| 3300014031|Ga0120173_1028349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 806 | Open in IMG/M |
| 3300014271|Ga0075326_1039964 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300014495|Ga0182015_10554947 | Not Available | 731 | Open in IMG/M |
| 3300014501|Ga0182024_10385983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Goekera → Goekera deserti | 1816 | Open in IMG/M |
| 3300014501|Ga0182024_12260775 | Not Available | 593 | Open in IMG/M |
| 3300014827|Ga0120171_1084497 | Not Available | 837 | Open in IMG/M |
| 3300014871|Ga0180095_1101640 | Not Available | 535 | Open in IMG/M |
| 3300014969|Ga0157376_11140187 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300015086|Ga0167655_1027225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 944 | Open in IMG/M |
| 3300015203|Ga0167650_1001784 | All Organisms → cellular organisms → Bacteria | 6438 | Open in IMG/M |
| 3300015242|Ga0137412_10864122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300015264|Ga0137403_10260179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1643 | Open in IMG/M |
| 3300015358|Ga0134089_10527866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
| 3300015371|Ga0132258_10596535 | All Organisms → cellular organisms → Bacteria | 2772 | Open in IMG/M |
| 3300015371|Ga0132258_10766723 | All Organisms → cellular organisms → Bacteria | 2431 | Open in IMG/M |
| 3300015373|Ga0132257_100235758 | All Organisms → cellular organisms → Bacteria | 2180 | Open in IMG/M |
| 3300015374|Ga0132255_101249229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1120 | Open in IMG/M |
| 3300015374|Ga0132255_105622391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 530 | Open in IMG/M |
| 3300017654|Ga0134069_1044245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1390 | Open in IMG/M |
| 3300017659|Ga0134083_10278556 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 705 | Open in IMG/M |
| 3300017789|Ga0136617_10181308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1784 | Open in IMG/M |
| 3300017789|Ga0136617_10261461 | Not Available | 1437 | Open in IMG/M |
| 3300017789|Ga0136617_10477444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 994 | Open in IMG/M |
| 3300017927|Ga0187824_10275637 | Not Available | 590 | Open in IMG/M |
| 3300017947|Ga0187785_10257990 | Not Available | 784 | Open in IMG/M |
| 3300017959|Ga0187779_10521993 | Not Available | 788 | Open in IMG/M |
| 3300017961|Ga0187778_10299597 | Not Available | 1040 | Open in IMG/M |
| 3300017966|Ga0187776_10314569 | Not Available | 1022 | Open in IMG/M |
| 3300017966|Ga0187776_11161511 | Not Available | 577 | Open in IMG/M |
| 3300017973|Ga0187780_10278722 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300017999|Ga0187767_10268423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 569 | Open in IMG/M |
| 3300018027|Ga0184605_10018345 | All Organisms → cellular organisms → Bacteria | 2780 | Open in IMG/M |
| 3300018027|Ga0184605_10104225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1254 | Open in IMG/M |
| 3300018027|Ga0184605_10403845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 610 | Open in IMG/M |
| 3300018052|Ga0184638_1000009 | All Organisms → cellular organisms → Bacteria | 43570 | Open in IMG/M |
| 3300018056|Ga0184623_10011382 | All Organisms → cellular organisms → Bacteria | 3852 | Open in IMG/M |
| 3300018061|Ga0184619_10010131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3682 | Open in IMG/M |
| 3300018061|Ga0184619_10108039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1254 | Open in IMG/M |
| 3300018061|Ga0184619_10520609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 3300018071|Ga0184618_10211789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 812 | Open in IMG/M |
| 3300018071|Ga0184618_10295014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 689 | Open in IMG/M |
| 3300018089|Ga0187774_10368562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 862 | Open in IMG/M |
| 3300018429|Ga0190272_11467895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 691 | Open in IMG/M |
| 3300018431|Ga0066655_10869689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 615 | Open in IMG/M |
| 3300018433|Ga0066667_10381073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1133 | Open in IMG/M |
| 3300018469|Ga0190270_10022731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3916 | Open in IMG/M |
| 3300018476|Ga0190274_11432568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 781 | Open in IMG/M |
| 3300018476|Ga0190274_12997870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
| 3300018482|Ga0066669_11966834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 546 | Open in IMG/M |
| 3300019873|Ga0193700_1014049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1309 | Open in IMG/M |
| 3300019875|Ga0193701_1041385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura geliboluensis | 941 | Open in IMG/M |
| 3300019887|Ga0193729_1160409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 804 | Open in IMG/M |
| 3300019888|Ga0193751_1210072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 642 | Open in IMG/M |
| 3300020020|Ga0193738_1163532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 583 | Open in IMG/M |
| 3300020062|Ga0193724_1014318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1685 | Open in IMG/M |
| 3300020070|Ga0206356_10050759 | Not Available | 1090 | Open in IMG/M |
| 3300020070|Ga0206356_11800330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 560 | Open in IMG/M |
| 3300020076|Ga0206355_1561618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 671 | Open in IMG/M |
| 3300021080|Ga0210382_10230069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 809 | Open in IMG/M |
| 3300021358|Ga0213873_10174511 | Not Available | 657 | Open in IMG/M |
| 3300021363|Ga0193699_10023181 | Not Available | 2281 | Open in IMG/M |
| 3300021445|Ga0182009_10656062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 565 | Open in IMG/M |
| 3300025448|Ga0208037_1066861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
| 3300025764|Ga0209539_1184889 | Not Available | 780 | Open in IMG/M |
| 3300025906|Ga0207699_10133246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1624 | Open in IMG/M |
| 3300025910|Ga0207684_10469331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1080 | Open in IMG/M |
| 3300025912|Ga0207707_10095614 | All Organisms → cellular organisms → Bacteria | 2596 | Open in IMG/M |
| 3300025917|Ga0207660_10309994 | Not Available | 1258 | Open in IMG/M |
| 3300025921|Ga0207652_10561851 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300025922|Ga0207646_10460848 | Not Available | 1147 | Open in IMG/M |
| 3300025944|Ga0207661_10135328 | All Organisms → cellular organisms → Bacteria | 2116 | Open in IMG/M |
| 3300026116|Ga0207674_10001688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 28351 | Open in IMG/M |
| 3300026121|Ga0207683_10621345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1000 | Open in IMG/M |
| 3300026308|Ga0209265_1051609 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300026312|Ga0209153_1026294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1957 | Open in IMG/M |
| 3300026316|Ga0209155_1265858 | Not Available | 531 | Open in IMG/M |
| 3300026330|Ga0209473_1329663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
| 3300026342|Ga0209057_1031293 | All Organisms → cellular organisms → Bacteria | 2788 | Open in IMG/M |
| 3300026343|Ga0209159_1220131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 588 | Open in IMG/M |
| 3300027562|Ga0209735_1136677 | Not Available | 533 | Open in IMG/M |
| 3300027815|Ga0209726_10014027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7512 | Open in IMG/M |
| 3300027821|Ga0209811_10083688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1129 | Open in IMG/M |
| 3300027821|Ga0209811_10254453 | Not Available | 671 | Open in IMG/M |
| 3300027882|Ga0209590_10092819 | All Organisms → cellular organisms → Bacteria | 1788 | Open in IMG/M |
| 3300027886|Ga0209486_11315608 | Not Available | 501 | Open in IMG/M |
| 3300027905|Ga0209415_10292666 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
| 3300027907|Ga0207428_10026183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4871 | Open in IMG/M |
| 3300027907|Ga0207428_10122527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1993 | Open in IMG/M |
| 3300028007|Ga0247718_1061078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 967 | Open in IMG/M |
| 3300028705|Ga0307276_10144559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 602 | Open in IMG/M |
| 3300028714|Ga0307309_10084064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 740 | Open in IMG/M |
| 3300028716|Ga0307311_10103296 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300028718|Ga0307307_10236292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 582 | Open in IMG/M |
| 3300028721|Ga0307315_10287981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 520 | Open in IMG/M |
| 3300028722|Ga0307319_10016983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2223 | Open in IMG/M |
| 3300028744|Ga0307318_10006514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3766 | Open in IMG/M |
| 3300028778|Ga0307288_10434054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 538 | Open in IMG/M |
| 3300028791|Ga0307290_10165122 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300028792|Ga0307504_10113774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 878 | Open in IMG/M |
| 3300028799|Ga0307284_10323142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 622 | Open in IMG/M |
| 3300028800|Ga0265338_10035352 | All Organisms → cellular organisms → Bacteria | 4805 | Open in IMG/M |
| 3300028810|Ga0307294_10182565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 716 | Open in IMG/M |
| 3300028811|Ga0307292_10288724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 686 | Open in IMG/M |
| 3300028824|Ga0307310_10114514 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300028875|Ga0307289_10422382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 548 | Open in IMG/M |
| 3300028881|Ga0307277_10459992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
| 3300028885|Ga0307304_10325838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 683 | Open in IMG/M |
| 3300030838|Ga0311335_10997703 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300031240|Ga0265320_10429647 | Not Available | 583 | Open in IMG/M |
| 3300031716|Ga0310813_12200232 | Not Available | 522 | Open in IMG/M |
| 3300032068|Ga0318553_10528269 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300032074|Ga0308173_12025196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
| 3300032770|Ga0335085_10158623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2826 | Open in IMG/M |
| 3300032770|Ga0335085_11262061 | Not Available | 782 | Open in IMG/M |
| 3300032829|Ga0335070_11129048 | Not Available | 720 | Open in IMG/M |
| 3300032892|Ga0335081_11991677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus | 620 | Open in IMG/M |
| 3300032893|Ga0335069_11902594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 629 | Open in IMG/M |
| 3300032898|Ga0335072_10124874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 3223 | Open in IMG/M |
| 3300033004|Ga0335084_10000376 | All Organisms → cellular organisms → Bacteria | 37131 | Open in IMG/M |
| 3300033803|Ga0314862_0131243 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300033806|Ga0314865_016017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1858 | Open in IMG/M |
| 3300033808|Ga0314867_019936 | All Organisms → cellular organisms → Bacteria | 1587 | Open in IMG/M |
| 3300034195|Ga0370501_0091913 | Not Available | 1013 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.45% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 6.27% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.88% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.48% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 3.14% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.14% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.79% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.79% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.79% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.44% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.44% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.74% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.39% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.05% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.05% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.05% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.05% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.05% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.05% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.70% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.70% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.70% |
| Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.70% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.70% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.35% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.35% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.35% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.35% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.35% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.35% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.35% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.35% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.35% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.35% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.35% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.35% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.35% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.35% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.35% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.35% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.35% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.35% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.35% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.35% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.35% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.35% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.35% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.35% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.35% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2124908038 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
| 2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001361 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-PF)- 6 month illumina | Environmental | Open in IMG/M |
| 3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
| 3300007821 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-10-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009804 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011991 | Permafrost microbial communities from Nunavut, Canada - A34_65cm_12M | Environmental | Open in IMG/M |
| 3300011992 | Permafrost microbial communities from Nunavut, Canada - A23_65cm_12M | Environmental | Open in IMG/M |
| 3300011994 | Permafrost microbial communities from Nunavut, Canada - A7_65cm_12M | Environmental | Open in IMG/M |
| 3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Host-Associated | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012527 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ83 (22.06) | Environmental | Open in IMG/M |
| 3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
| 3300012681 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06) | Environmental | Open in IMG/M |
| 3300012682 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ223 (23.06) | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012982 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013758 | Permafrost microbial communities from Nunavut, Canada - A24_65cm_12M | Environmental | Open in IMG/M |
| 3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
| 3300013768 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0M | Environmental | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014031 | Permafrost microbial communities from Nunavut, Canada - A35_80cm_0.25M | Environmental | Open in IMG/M |
| 3300014271 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014827 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_18M | Environmental | Open in IMG/M |
| 3300014871 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_1Da | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015086 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5c, rocky medial moraine) | Environmental | Open in IMG/M |
| 3300015203 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019873 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1 | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025448 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025764 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-312 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028007 | Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 2-1-E_D | Environmental | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
| 3300033806 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20 | Environmental | Open in IMG/M |
| 3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_00301800 | 2088090014 | Soil | ADASAVPESVIEREEVVALLFNVSDIVAALSRIERLLKEDDGEEEAD |
| B3_all_c_02268570 | 2124908038 | Soil | MPDPIIERAEVAALLFNVSDIAVTLTNIERLLGEEENGEEEADEG |
| A5_c1_00054500 | 2124908044 | Soil | MPDPLIERAEVVALLFNVSDIAASLERIERLLGEDDGEEEADEG |
| KansclcFeb2_01397620 | 2124908045 | Soil | MAEPIIDRDEVVALLFNVSDIAVTLTKIERLLGGEENGKEEADEG |
| INPhiseqgaiiFebDRAFT_1015820422 | 3300000364 | Soil | VPESVIEREEVVALLFNVSDIVAALSRIERLLKEDDGEEEAD* |
| JGI10216J12902_1012489273 | 3300000956 | Soil | VPSSRQLELVPEPLVERDEIVALLFSVSDISNTLLRIEALLEADGETEEADEG* |
| JGI10216J12902_1035258663 | 3300000956 | Soil | MVSVMPEPVIERAEVVALLFNVSDIVSALERIERLLEEDDGEEEADEG* |
| JGI10216J12902_1056807052 | 3300000956 | Soil | VPNGLIERDEIVALLFNVSDIAVTLTRIEELLRSGDEEEEADEG* |
| JGI10216J12902_1078486542 | 3300000956 | Soil | MADPVISRDEVVALLFNVSDIAVTLTKIERRLAEDDGEEEADEG* |
| JGI10216J12902_1181543262 | 3300000956 | Soil | MFGLCAEVVALLLNVSDIAGTLTKIERLLGGDDGEEEADER* |
| JGI10216J12902_1266812713 | 3300000956 | Soil | VVALLFDVSDLVANVTRIREILEEDDGEEEADGG* |
| A30PFW6_14262021 | 3300001361 | Permafrost | VPEAVIERDEVVALLFNVSDIAVTLARIEQRLAEDDGEEEADED* |
| A3PFW1_108558552 | 3300001535 | Permafrost | MADPVIERDEVVALLFNVSDIAVGVETIVRLLSGGDDGQEEEADGD* |
| A10PFW1_124498633 | 3300001538 | Permafrost | MPDRVIERSEVAALLFNVSDIAVTLTNIERLLGEEDDGEEEADEG* |
| soilL1_101051873 | 3300003267 | Sugarcane Root And Bulk Soil | MLLTMPGPPIERAEVVALLFNVSDIAVTLTNIERLLAEDDGEEETDEG* |
| Ga0062589_1020083111 | 3300004156 | Soil | AARSDPDAHVVAEPVIEREEVVALLFNVSDIASALERIERLLEGDDGEEEADEG* |
| Ga0062590_1007009462 | 3300004157 | Soil | MAEPLIDRAEVVALLFNVSDIVARLASIEQLLEEDDGEEEVDES* |
| Ga0062591_1024504481 | 3300004643 | Soil | MPDLVIERAEVVALLFNVSDIAVTLTKIERLLEEDDGEEETDEG* |
| Ga0066677_104641922 | 3300005171 | Soil | VTDAVIERAEIVALLFNVSDISVTLTEIERLLGGDDAEEEADEG* |
| Ga0066683_102233571 | 3300005172 | Soil | MFSVTPEPVTERAEVVALLFNVSDIVWALERIERLLEEDDGEEEADEG* |
| Ga0066673_108048143 | 3300005175 | Soil | KVRAMNEPLIERDEIVGLLFNGSDIAVTLTRIEELLRGGDEEEEADES* |
| Ga0066684_111194732 | 3300005179 | Soil | MAEPLIERAEIVALLFNVSDIANALAIIQELLRGDDGDEEADEG* |
| Ga0066671_109881651 | 3300005184 | Soil | MAEKLIDRAEVVALLFKVSDSAVAAYNIENLLREGEDDGEEETDEG* |
| Ga0066675_104933812 | 3300005187 | Soil | LRAGHFAGKVRAMNEPLIERDEIVGLLFNGSDIAVTLTRIEELLRGGDEEEEADES* |
| Ga0070658_101094292 | 3300005327 | Corn Rhizosphere | MDEPVIERAEVVALLFNVSDIASSLDRIEQLLGEDDGEEEADGS* |
| Ga0070683_1006772191 | 3300005329 | Corn Rhizosphere | MDEELMAREELVALLFNVSDIAKTLTRIEILLEDDDEDEEADEG* |
| Ga0070683_1015143823 | 3300005329 | Corn Rhizosphere | RSVGMHTVRMADPLIERAEIAALLFNVSDIAITLTNIERLLGEDDGEEEADES* |
| Ga0070674_1022217691 | 3300005356 | Miscanthus Rhizosphere | MQALPVPPDTLIDRGEVVALLFNVSDIAVTLTKIERLLAEDDGEEETDER* |
| Ga0070659_1021210992 | 3300005366 | Corn Rhizosphere | MADPPIERAEVVALLFNVSDIAVTLANIERLLGEDDGEEE |
| Ga0070708_1011540692 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MPDLLIDRAEVVALLFNVSDIAVALTNIERLLGEENGEEEADES* |
| Ga0066681_108749071 | 3300005451 | Soil | MQADPMAEPLIKRDEIVDLLFNVSDIAVTLTKIERLLGGGDEEEEADEG* |
| Ga0070681_104669573 | 3300005458 | Corn Rhizosphere | MHTVRMADPLIERAEIAALLFNVSDIAITLTNIERLLGEDDGEEEADES* |
| Ga0070707_1007226991 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEPVIERPEVVALLFNVSDIAVTLTNIERLLGGDDGEEEADEG* |
| Ga0070707_1012404311 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | DPMNETLIERDEIVALLFDVSDIAVTLTRIEQLLRGGDEEEEADEG* |
| Ga0070707_1018524382 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEPLIERAEVVALLFNVSDLAVTLTSIERFLKEDEDDGEEEADQS* |
| Ga0073909_103913132 | 3300005526 | Surface Soil | MLDVVTESVIEREEVVALLFNVSDIAVAIRAIERLMGGDDGEAEADEG* |
| Ga0066697_100829833 | 3300005540 | Soil | MAEPLIKRDEIVDLLFNVSDIAVTLTKIERLLGGGDEEEEADEG* |
| Ga0070695_1015067782 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MPDPLIERAEVVALLFNVSDIAVALTNIERLLGGDDGEEEVDES* |
| Ga0066695_102262091 | 3300005553 | Soil | TAATHPVLVSDPLIERAEVIALLFNVSDIAVTLTKIERLLGGADGEEEADEG* |
| Ga0066704_108375481 | 3300005557 | Soil | LIERQEVVALLFNVSDIAITLTSIERFLTEDEDDGEEEADES* |
| Ga0066704_108454611 | 3300005557 | Soil | AQAVGVADPLIERAEVVALLFNVSDIAVTLTKIERLLGEDDGEEEVDEG* |
| Ga0066700_110718411 | 3300005559 | Soil | EVVALLFNVSDIAVALTNIERLLGEEDGEEEADES* |
| Ga0068855_1014616791 | 3300005563 | Corn Rhizosphere | MAREELVALLFNVSDIAKTLTRIEILLEDDDEDEEADEG* |
| Ga0066708_101085061 | 3300005576 | Soil | VRESLIERDEIVALLFNVSDIAVTPTKIERLLGGGDEEEEADE |
| Ga0066708_104899153 | 3300005576 | Soil | MPESVIDRDEVVALLFNVSDMAVALRGIARLLLGDDNGEEEVDEG* |
| Ga0066654_104290241 | 3300005587 | Soil | VIGRNEVVGLLFNVSDIAVTLTAIERLLGGDDEEEKADEG* |
| Ga0068864_1007216063 | 3300005618 | Switchgrass Rhizosphere | MSELLIDREEVVALLFSVHDVAATLLRIETLLEEDDGAEEADED* |
| Ga0066903_1010294263 | 3300005764 | Tropical Forest Soil | MRVRKLCEMSELPIERDEIVALLFTVSDISATLRRIERLLEDEDEGNGEADEG* |
| Ga0066903_1050884561 | 3300005764 | Tropical Forest Soil | AEPVIDRDEVVALLFNVSDIANALDRIRELLGDDDGEEEADAS* |
| Ga0081455_101337923 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSEPLIDRDEIVALLFNVSDLVAILSRIERLLFEDDGEEEADEG* |
| Ga0070717_117342403 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | EEVVALLFNVSDIAVALDKIQKLLGGDDGEEEADEG* |
| Ga0066652_1003080481 | 3300006046 | Soil | TAATHPVLVSDPLIERAEVVALLFSVSDIAVKLTKIERLLGGDDGEEEADEG* |
| Ga0075017_1006824933 | 3300006059 | Watersheds | ALCMADAPIERAEVVALLFNVSDIAVTLTSIELLLGEDNGEEETDED* |
| Ga0075422_100908072 | 3300006196 | Populus Rhizosphere | MEDALIERDEIVALLLNVSDIADTLAKIERLLGNGDEEEEADEG* |
| Ga0079222_106986311 | 3300006755 | Agricultural Soil | MLVAMAHPPIERPEVVALLFNVSDIAVTLTNIVRLLGEDDGEEETDED* |
| Ga0066659_115810442 | 3300006797 | Soil | MPEPPIERAEVVALLFNVSDIAVTLTNIERLLGEADGEEEADEV* |
| Ga0066660_114429043 | 3300006800 | Soil | VPEALIERGEVVALLFNVSDIVATLARIQQLLEEDDGEEEADEG* |
| Ga0075428_1000353876 | 3300006844 | Populus Rhizosphere | MEEALIERDEIVALLFNVSDLADTLAKIERLPGNGYEEEEADEG* |
| Ga0075429_1003369582 | 3300006880 | Populus Rhizosphere | MEEALIERDEIVALLFNVSDLADTLAKIERLLGNGDEEEEADEG* |
| Ga0079218_115711423 | 3300007004 | Agricultural Soil | VSEALIERDEIVALLFTLNDINATLIRIERLLREDEGEAEENE* |
| Ga0105679_104142402 | 3300007790 | Soil | VIERAEVVALLFNVSDIAVTLTKIERLLGEDDGEEEADEG* |
| Ga0104323_1038454 | 3300007821 | Soil | MTDPLIERAEVVALLFNVSDIASALERIERLLGEDDGEEETDEG* |
| Ga0066710_1000810596 | 3300009012 | Grasslands Soil | MDDALIERGEIVALLFNVSDIAVTLTKIERLLGGGNEEEETDEG |
| Ga0066710_1009626813 | 3300009012 | Grasslands Soil | VSDVLIHRAEVVALLFNVSDIAVVPTKIERLLGGEDGEEEADEG |
| Ga0066710_1026120852 | 3300009012 | Grasslands Soil | DRDEVVALLFNVSDMAVALRGIARLLLGDDNGEEEVDEG |
| Ga0066710_1037598521 | 3300009012 | Grasslands Soil | MSEPLIERAELVALLFNVSDIVATLTRIESLLRGGDELEETDEG |
| Ga0099827_103184972 | 3300009090 | Vadose Zone Soil | MSESLIERAEVVALLFNVSDIAVTLTNIERLLGEDDGEEEVDEG* |
| Ga0099827_111117671 | 3300009090 | Vadose Zone Soil | GTPDKRPSSASMSEPLIERAEVAARFFNVSDIAITLTSIERFLKEDEDDGEEEADQS* |
| Ga0099827_114372251 | 3300009090 | Vadose Zone Soil | MQDSLIERAEVVALLFNMSDIAVALTNIERLLGEDDGEEEADES* |
| Ga0099827_115816782 | 3300009090 | Vadose Zone Soil | VQAVAVVESLIERAEVVALLFNVSDIAITLTTIERFLKEDKDDGEEEADQS* |
| Ga0111539_103632932 | 3300009094 | Populus Rhizosphere | MEDALIERDEIVALLFNVSDIADTLAKIERLLGNGDEEEEADEG* |
| Ga0066709_1003352214 | 3300009137 | Grasslands Soil | MNEPLIERDEIVGLLFNGSDIAVTLTRIEELLRGGDEEEEADES* |
| Ga0066709_1003405382 | 3300009137 | Grasslands Soil | MDDPLIYREEVIALLFNVSTIVTTLERIEGLLEDGDGEEGNES* |
| Ga0066709_1004480511 | 3300009137 | Grasslands Soil | IHRAEVVALLFNVSDIAVVPTKIERLLGGEDGEEEADEG* |
| Ga0066709_1006400602 | 3300009137 | Grasslands Soil | VADDSLIDRDEVVALLFNVSDIAETLENIERLLGGENDGEEEADEG* |
| Ga0066709_1008804323 | 3300009137 | Grasslands Soil | VRQHFDMQADPMAEPLIKRDEIVDLLFNVSDIAVTLTKIERLLGGGDEEEEADEG* |
| Ga0066709_1013588802 | 3300009137 | Grasslands Soil | MDDALIERGEIVALLFNVSDIAVTLTKIERLLGGGNEEEETDEG* |
| Ga0066709_1015853992 | 3300009137 | Grasslands Soil | MVAHAYLMPDPLIERPEVVALLFNVSDIAVTLTNIERLLGEDDGEEEANED* |
| Ga0099792_111560941 | 3300009143 | Vadose Zone Soil | MADPLIEREEIVALLFNVSDIASALERIERLPEEDDGEEEADES* |
| Ga0114129_104126543 | 3300009147 | Populus Rhizosphere | MADPLIERDEVVALLFNLSDIAQALGRIELLLRGDDDGEEEAQDDRS* |
| Ga0111538_103139463 | 3300009156 | Populus Rhizosphere | MEDALIERDEIVALLFNVSDIADTLAEIERLLGNGDEEEEADEG* |
| Ga0105237_122874852 | 3300009545 | Corn Rhizosphere | MSDPLIERAEIVALLFNVSDIASALERIERLLEEDDGEEEADEG* |
| Ga0105063_10393132 | 3300009804 | Groundwater Sand | MPDALIERAEVVALLFNVGDIAVALTNIERLLGGDDGEEEVDES* |
| Ga0126313_107182582 | 3300009840 | Serpentine Soil | MADGLIERDEIVALLFNVSDIAVTLTKIERLLRGGDEEEEADEG* |
| Ga0126305_109105411 | 3300010036 | Serpentine Soil | VSEPLIAREEVVALLFNVSDLVAILSRIERLLFEDGDGEEEANEG* |
| Ga0126312_112228641 | 3300010041 | Serpentine Soil | MSEPLIERGEVVGLLFNVSDIAATLITIEELPEEDDGEEEADEG* |
| Ga0126311_119059553 | 3300010045 | Serpentine Soil | VEEPEPAIYREEVVALLFNVSNIVALLGRMLEEDDGEAEDEG* |
| Ga0134082_100247763 | 3300010303 | Grasslands Soil | LRAGHFAGKVREMNEPLIERDEIVGLLFNGSDIAVTLTRIEELLRGGDEEEEADES* |
| Ga0134086_102890892 | 3300010323 | Grasslands Soil | VRTLMFSVTPEPVTERAEVVALLFNVSDIVWALERIERLLEEDDGEEEADEG* |
| Ga0134111_104432762 | 3300010329 | Grasslands Soil | VSDLLIERAKIVALLFNVSDIAVTLTKIESLLGGDDGEEEADEG* |
| Ga0136449_1011430402 | 3300010379 | Peatlands Soil | MPDLPIERAEVVALLFNVSDISVTLTNIERLLGENDGQEETDED* |
| Ga0134126_124959811 | 3300010396 | Terrestrial Soil | MADPLIERAEIAALLFNVSDIAITLTNIERLLGEDDGEEEAD |
| Ga0134127_119212561 | 3300010399 | Terrestrial Soil | MQPVAVSELIERDEVVALLFNVSDIAVTLTNIERLLGDDDGAEEEADES* |
| Ga0137392_102386162 | 3300011269 | Vadose Zone Soil | VADPLIERAEVVALLFNVSDIAVTLTKIERFLGEDDGEEEVDEG* |
| Ga0120153_10214402 | 3300011991 | Permafrost | MPEALIERVEVVALLFNVSDIAVTLTNIERLLGEDDGEEEADEG* |
| Ga0120146_10027012 | 3300011992 | Permafrost | MPEPLIERVEVVALLFNVSDIAVTLTNIERLLGEDDGEEEADEG* |
| Ga0120157_10775882 | 3300011994 | Permafrost | MPEPVIERAEVAALLFNVSDIAITLTNIERLLGGEGYGEEEADEG* |
| Ga0120152_10842892 | 3300012011 | Permafrost | MPDPLIERAEVVALLFNVSDIAVALTNIERLLGEDDGDEEADES* |
| Ga0120159_11061342 | 3300012014 | Permafrost | VVALLFNVSDIAATLTKIERLLGEDDGEEEADED* |
| Ga0137389_116126042 | 3300012096 | Vadose Zone Soil | VADPLIERAEVVALLFNVSDIANTLSRIEQLLEDGDDEQDEDS* |
| Ga0137389_116484903 | 3300012096 | Vadose Zone Soil | LYVMPDPLLERAEVVALLFNVSDIATALALIQRLLEGDDGEEEADED* |
| Ga0137364_100209323 | 3300012198 | Vadose Zone Soil | VAEPLIERAEVVALLFNVSDIAARLASIEGLLEDEDGEEETDEG* |
| Ga0137364_106326152 | 3300012198 | Vadose Zone Soil | MQADPMAEPLIERDEIVGLLFNVSDIAVTLTKIERLLGGRDEEEEADEG* |
| Ga0137364_108634281 | 3300012198 | Vadose Zone Soil | VADDPLIHRDEVVALLFNVSDIAETLENIERLLGRENDGEEEADEG* |
| Ga0137383_102989071 | 3300012199 | Vadose Zone Soil | MPDPLIVRAEVVALLFNVSDVAATLANIERLLGEDD |
| Ga0137383_111483163 | 3300012199 | Vadose Zone Soil | MPELLIDRGEVVALLFNVSDIAKHLGVIEQLLRGGDDAEEEDDEG* |
| Ga0137382_104988091 | 3300012200 | Vadose Zone Soil | VRAMNEPLIERDEIVGLLFNGSDIAVTLTRIEELLRGGDEEEEADES* |
| Ga0137382_109715601 | 3300012200 | Vadose Zone Soil | MADDLLIHRDEVVALLFNVSDIAETLENIERLLGGENDGEEEADEG* |
| Ga0137365_102143972 | 3300012201 | Vadose Zone Soil | MADPIIDRDEVVGLLFNVGDIVALLSKIVRLLEENDGEEEADEG* |
| Ga0137365_102187662 | 3300012201 | Vadose Zone Soil | VANLLIERDEIVALLFNVSDIAVTLTNIERLLGGGDEEEEADES* |
| Ga0137365_104177122 | 3300012201 | Vadose Zone Soil | VVDPLIERAEVVALLFNVSDIAESVWRIERILEEGDGEEENHEG* |
| Ga0137365_104928662 | 3300012201 | Vadose Zone Soil | VADDPLIHRDEVVALLFNVSDIAETLESIERLLGGENDGEEEADEG* |
| Ga0137363_115786112 | 3300012202 | Vadose Zone Soil | MPEPLIERSEVVALLFNVSDIAITLTSIERFLKEDEDDGEEEADPS* |
| Ga0137374_103647872 | 3300012204 | Vadose Zone Soil | MPDPLIARAEVVALLFNVSDIVSALERIERLLEEDDGEEEADEG* |
| Ga0137362_102783403 | 3300012205 | Vadose Zone Soil | MPDPLIEREEVVALLFNVSDIASALERIERLLEEDDGEEETDEG* |
| Ga0137381_107124002 | 3300012207 | Vadose Zone Soil | MADDPLIHRDEVVALLFNVSDIAETLESIERLLGGENDGEEEADEG* |
| Ga0137376_104169512 | 3300012208 | Vadose Zone Soil | MLDPLIERAEVVALLFNVSDIAVALTNIERLLGEDDGEEEADES* |
| Ga0137376_112716552 | 3300012208 | Vadose Zone Soil | VPDPLIDRGEVVALLFNVSDIALTLERIERLLEDDDGEEETDEG* |
| Ga0137378_101416551 | 3300012210 | Vadose Zone Soil | MDESLVERAEIVALLFNVSDIVALLVRIERILEDGNGQEDGEG* |
| Ga0137377_103315821 | 3300012211 | Vadose Zone Soil | MPDPLIERAEVVALLFNVSDIAVALRNIERLLGEDDGEEEADES* |
| Ga0137377_111586381 | 3300012211 | Vadose Zone Soil | MADPIIDRDEVVGLLFNVGDMVALLSKIVRLLEENDGEEEVDEG* |
| Ga0137377_117944652 | 3300012211 | Vadose Zone Soil | MLPVVPEPVIERVEVVALLFNVSDIVSALERIERLLGEDDGEEEADEG* |
| Ga0137372_108169442 | 3300012350 | Vadose Zone Soil | VADDPLIHRDEVVALLFNVSDIAETLENIERLLGGENDGEEEADEG* |
| Ga0137386_109011231 | 3300012351 | Vadose Zone Soil | VAEPLIERAEVVALLFNVSDIAVALTNIERLLGEDDGEEEADES* |
| Ga0137369_108689701 | 3300012355 | Vadose Zone Soil | LIERAEVVALLFNVSDIVARLTSIEKLLEDDDGEEETDEG* |
| Ga0137371_101995862 | 3300012356 | Vadose Zone Soil | LRIDEELITRDEVVALLFNVSDIAASLSHVEELLGGDDGEEEADES* |
| Ga0137371_105131983 | 3300012356 | Vadose Zone Soil | MSETLIERAEVVALLFNVSDMAVALTKIERLLGGDDGEEEADEV* |
| Ga0137371_107252232 | 3300012356 | Vadose Zone Soil | MPDPLIERAEVVALLFNVSDIAVALTNIERLLGEDDGEEEADES* |
| Ga0137384_105706052 | 3300012357 | Vadose Zone Soil | MAEPVIEREEVVALLFNVSEIVFQATTIRELLEEDDGEEEAD* |
| Ga0137384_111596462 | 3300012357 | Vadose Zone Soil | VVFPIERAEVVALLFNVSDIAASLRRIERILEDEDGE* |
| Ga0137360_106063422 | 3300012361 | Vadose Zone Soil | PMPDPLIEREEVVALLFNVSDIASALERIERLLEEDDGEEETDEG* |
| Ga0137361_104254212 | 3300012362 | Vadose Zone Soil | MSEPLIERSEVVALLFNVSDIAITLTSIERFLKEDDDDGEEEADPS* |
| Ga0137390_102834752 | 3300012363 | Vadose Zone Soil | VADPLIERAEVVALLFNVSDIAVTLTKIERLLGEDDGEEEVDEG* |
| Ga0150984_1137944771 | 3300012469 | Avena Fatua Rhizosphere | REEVVALLFNVSDMAMALDRIQQLLEDDDGEEEDDTG* |
| Ga0157327_10144102 | 3300012512 | Arabidopsis Rhizosphere | VAEPVIEREEVVALLFNVSDIVAALERIERLLGEEDGEEEADEG* |
| Ga0157352_10818981 | 3300012519 | Unplanted Soil | MEEALIERDEIVALLFNVSDIVAALERIERLPGEEDGEEEADEG* |
| Ga0136633_10061094 | 3300012527 | Polar Desert Sand | LAEALIERDEIVAQLFNVSDIVSALERIELLLGEDDGEEEADES* |
| Ga0136633_11653491 | 3300012527 | Polar Desert Sand | VAEALVERDEIVALLFNVSDIVSALERIELLLGEDDGEEEADES* |
| Ga0157216_104387193 | 3300012668 | Glacier Forefield Soil | ESLIERDEVVALLFNVSDIVASLARIEDLLREDEGEEEADE* |
| Ga0136613_100939732 | 3300012681 | Polar Desert Sand | VHEPVIEREEVVALLFNVSDVARSLERIEGLLGGDDGEEETDES* |
| Ga0136613_103301361 | 3300012681 | Polar Desert Sand | MFPVIEREEVVALLFNVSDVARSLERIEGLLGGDDGEEETDEG* |
| Ga0136611_101605523 | 3300012682 | Polar Desert Sand | VSDPLIERDEVVALLFNVSDIAASLARIERLLREDEGEEEADE* |
| Ga0136614_101917882 | 3300012684 | Polar Desert Sand | VPDPVIEREEVVALLFNVSDVARSLERIELLLGGDDGEEETDEG* |
| Ga0137395_103068503 | 3300012917 | Vadose Zone Soil | SLALIPDPLIEREEVVALLFNVSDIASALERIERLLEEDDGEEETDEG* |
| Ga0137407_104843452 | 3300012930 | Vadose Zone Soil | MPDSLIERAEVVALLFNVSDIAITLANSERLLGEDSGEEE |
| Ga0126375_113991341 | 3300012948 | Tropical Forest Soil | VGVAEPLIERAEVVALLFNVSDIAVTLTEIERLLGGTDGEE |
| Ga0164299_116368101 | 3300012958 | Soil | MSEPLIERSEVVALLFNVSDIVARLTSIERLLEEDDGEEEVDES* |
| Ga0164302_110002461 | 3300012961 | Soil | IIEGDEAVGLLFNVSDILETLRRIERLLEDGGEPEEADEG* |
| Ga0164302_112329762 | 3300012961 | Soil | VAETVVEREEVVALLFNVSDIVATLSRIERLLEEDDGEEEADGS* |
| Ga0134110_100753782 | 3300012975 | Grasslands Soil | VALLFNVSDIAITLTSIERFLTEDEDDGEAEADES* |
| Ga0134110_105417211 | 3300012975 | Grasslands Soil | GAMGDPLIERTEVVALLFNVSDIGVTLTKIERLLEEDDGEEEADEG* |
| Ga0168317_10148134 | 3300012982 | Weathered Mine Tailings | VVERREVVALLFNASDIVSALERIERLLGEDDGEEEADEG* |
| Ga0168317_10247272 | 3300012982 | Weathered Mine Tailings | MVERLVEREEVVALLFNVSDIAVTLTNIERLLGGDDGEEEADEG* |
| Ga0164306_106654422 | 3300012988 | Soil | MAEPLIDQAEVVALLFNVSDIVARLASIEELLEEDDGEEEVDES* |
| Ga0157372_130901461 | 3300013307 | Corn Rhizosphere | VVEPVIEREEVIALLFNVSDIAATLSRIERLLEEEDDGEEEADGG* |
| Ga0120147_10346641 | 3300013758 | Permafrost | MPEPLIERVEVVALLFNVSDIAVTLTNIERLLGEDENDGEEEADEG* |
| Ga0120172_11745111 | 3300013765 | Permafrost | MADPSIERAEVVALLFSVSDIAVALTNIERLLGGADGEEETDES |
| Ga0120155_11351801 | 3300013768 | Permafrost | GTEVVALLFNVSDIAVTLTKIERLLGDDDGEEEVDEG* |
| Ga0120123_10981472 | 3300013770 | Permafrost | MPDRVIERSEVAALLFNVSDIAVTLTNIERLLREEDDGEEEVDEG* |
| Ga0120158_100584403 | 3300013772 | Permafrost | VADPLIERAEVVALLFNVSDIAATLTKIERLLGEDDGEEEADED* |
| Ga0120158_101254723 | 3300013772 | Permafrost | MIERTEVVALLFNVSDIASALERIERLLGEDDGEEEADRG* |
| Ga0120158_101496882 | 3300013772 | Permafrost | MPDQLIERAEVVALLFNVGDIASVPERIERLLEEDDGEEEGDES* |
| Ga0120158_103214473 | 3300013772 | Permafrost | MADPLIERREVVALLFNVSDIAITLTSIERFLKEDEDDGEEEADQG* |
| Ga0120173_10283492 | 3300014031 | Permafrost | MPEALIERVEVVALLFNVGDIAVTLTNIERLLGEDDGEEEADEG* |
| Ga0075326_10399642 | 3300014271 | Natural And Restored Wetlands | VIERAEVVALLFNVSDIVSALERIERLLEEDDGEEEADEG* |
| Ga0182015_105549472 | 3300014495 | Palsa | MPDVPIERAEVVALLSNVSGIAVTLTNIERLLGEDDGEEETDEG* |
| Ga0182024_103859832 | 3300014501 | Permafrost | MPDVPIARAEVVALLFNVSDIAVTLTNIERLLGDDDGEEETDED* |
| Ga0182024_122607751 | 3300014501 | Permafrost | MLGRMSDMPIARAEVVALLFNVSDIAVTLTNIERLRGGEDGEEETDED* |
| Ga0120171_10844971 | 3300014827 | Permafrost | DDPLIDRAEVVALLFNVSDIAVTLTNIERLLGGDDAEEEADES* |
| Ga0180095_11016403 | 3300014871 | Soil | SARLQMMDDPVIDRGEAVALLFNVSDILRTLERIEALLAEDDGGEETDD* |
| Ga0157376_111401872 | 3300014969 | Miscanthus Rhizosphere | VADPVIERDEVVALLFTVSDIAVAVEKIRLLLGGEDGEEEADEG* |
| Ga0167655_10272251 | 3300015086 | Glacier Forefield Soil | MPDAPIARTEVVALLFNVSDIAMTLTNIERLLGEDDGEEEVDEG* |
| Ga0167650_10017843 | 3300015203 | Glacier Forefield Soil | MAEPLIERDEIVALLFNVSDIVVGVGEIVYLLGGGDDEEEEADGS* |
| Ga0137412_108641222 | 3300015242 | Vadose Zone Soil | MADPLIEREEIVALLFNVSDIASALERIERLLEEDDGEEEADES* |
| Ga0137403_102601791 | 3300015264 | Vadose Zone Soil | EVVALLFNVSDIAVALTNIERLLGEDDGEEEADAS* |
| Ga0134089_105278661 | 3300015358 | Grasslands Soil | AEALIERAEVVALLFNVSDIAARLASIEGLLEDDDGEEETDEG* |
| Ga0132258_105965354 | 3300015371 | Arabidopsis Rhizosphere | VVDEPVIEREEVVALLFNVSDIQMTLLRVEALLQEDDDEAQEDE* |
| Ga0132258_107667235 | 3300015371 | Arabidopsis Rhizosphere | LIERAEVVALLFNVSDIVARLASIEQLLEDDDGEEEIDEG* |
| Ga0132257_1002357583 | 3300015373 | Arabidopsis Rhizosphere | VVDEPVIEREEVVALLFNVSDVQMTLLRVEALLQEDDDEAQEDE* |
| Ga0132255_1012492292 | 3300015374 | Arabidopsis Rhizosphere | LIERAEVVALLFNVSDIVARLASIELLLEDDDGEEEIDEG* |
| Ga0132255_1056223912 | 3300015374 | Arabidopsis Rhizosphere | VCRLTFTVTRAEVIALLFNVSDIGVTLTKIERLLGEDDGEEEADED* |
| Ga0134069_10442451 | 3300017654 | Grasslands Soil | EVVALLFDVSDIAVTLTKIERHLGEDDGEEEADEG |
| Ga0134083_102785561 | 3300017659 | Grasslands Soil | VAEALIERAEVVALLFNVSDIAARLANIEGLLEDDDGEEETDEG |
| Ga0136617_101813084 | 3300017789 | Polar Desert Sand | VPDPVIEREEVVALLFNVSDVARSLERIELLFGGDDGEEETDEG |
| Ga0136617_102614613 | 3300017789 | Polar Desert Sand | MFPVIEREEVVALLFNVSDVARSLERIEGLLGGDDGEEETDES |
| Ga0136617_104774441 | 3300017789 | Polar Desert Sand | RCGMSESLIERDEIVALLFNVSDIAAILVRIEELLEEDDGEEEEADD |
| Ga0187824_102756372 | 3300017927 | Freshwater Sediment | MIYREEVVALLFNVSDIAVALSQLTDLLRGDDGEEEDDEG |
| Ga0187785_102579902 | 3300017947 | Tropical Peatland | VMEELIERDEIVGLLFTVSDISHTLLRIEVLLGDDDEEAEANEG |
| Ga0187779_105219932 | 3300017959 | Tropical Peatland | GGAAIQSLCVAEPLIERDEIVALLSNVSDLVAEVTTIRELLEDDDGEEEED |
| Ga0187778_102995971 | 3300017961 | Tropical Peatland | MTELLIERAEVVALPFNVSDIAVTLTNIERLLGEGNGEEEADES |
| Ga0187776_103145692 | 3300017966 | Tropical Peatland | MEELIERDEIVGLLFTVSDISHTLLRIEVLLGDDDEEAEANEG |
| Ga0187776_111615111 | 3300017966 | Tropical Peatland | VSDVLIERAEIVALLFNVSDISVTLTKIERLLGEEGGEEEEADED |
| Ga0187780_102787222 | 3300017973 | Tropical Peatland | VIERAEVVALLFNVSDIAVTLAKIERLLGEDNGEEEADEG |
| Ga0187767_102684231 | 3300017999 | Tropical Peatland | RAEVVALLFNVSDIAVTLTEIERLLGEDNGEEEADEG |
| Ga0184605_100183451 | 3300018027 | Groundwater Sediment | MPDPLIERAEVVALLFNVSDIAVALTNIERLLGEDDGEEEGDES |
| Ga0184605_101042253 | 3300018027 | Groundwater Sediment | MDEALIERGEIVALLFNVSDIAHTLTKIERLLGGEDEEEEADES |
| Ga0184605_104038451 | 3300018027 | Groundwater Sediment | MPDSLIERAEVVALLFNVSDIAITLAIERLLGEDSGEEEADES |
| Ga0184638_10000095 | 3300018052 | Groundwater Sediment | MPDPLIERVEVVALLFNVSDIAVALTNIERMLGEDDGEEETDES |
| Ga0184623_100113821 | 3300018056 | Groundwater Sediment | MPDPLIERAEVVALLFSVSDIVVALTNIERLLGGDDGEEETDES |
| Ga0184619_100101316 | 3300018061 | Groundwater Sediment | VSDVLIERDEVVAFLFNVSDIAVTLTRIERLLLEDDDGEEEADQD |
| Ga0184619_101080392 | 3300018061 | Groundwater Sediment | MPDSLIERAEVVALLFNVSDIAITLANIERLLGEDNGEEEADES |
| Ga0184619_105206092 | 3300018061 | Groundwater Sediment | MGLQAARVADSLIERGEIVALLFNVSDIADTLTKIERLLRGGDEEEEADEG |
| Ga0184618_102117892 | 3300018071 | Groundwater Sediment | MPDPLIERAEVVALLFNVSDIAVALTNIERLLGEDDGEEEADES |
| Ga0184618_102950142 | 3300018071 | Groundwater Sediment | VPEALIERDEVAALLFNVSDIAVTLARIERRLAEDDGEEEADES |
| Ga0187774_103685622 | 3300018089 | Tropical Peatland | ATAMLVAMSGPPIERAEVVALLFNVSDIAVTLTNIERLLGEDDGEEETDED |
| Ga0190272_114678952 | 3300018429 | Soil | VTESLIERDEVVALLFNVSDIAMSLSRIQALLEGEDGEEEESEGD |
| Ga0066655_108696892 | 3300018431 | Grasslands Soil | MNEPLIERDEIVGLLFNGSDIAVTLTRIEELLRGGDEEEEADES |
| Ga0066667_103810732 | 3300018433 | Grasslands Soil | LRGNGFACSLSSVRESLIERDEIVALLFNVSDIAVTLTKTERLLGGGDEEEEADES |
| Ga0190270_100227313 | 3300018469 | Soil | MSEPLIAREEIVALLFNVSDIVAILSRIERLLFEDGDGEEEANEG |
| Ga0190274_114325681 | 3300018476 | Soil | LLVSEPLIERAEVVALLFNVSDIATSLPRIQALLEGENGDEEESEGD |
| Ga0190274_129978702 | 3300018476 | Soil | MNEPPIAREEVIALLFNVSDIVASLGRIERLLGDDDGEEEADEG |
| Ga0066669_119668342 | 3300018482 | Grasslands Soil | LRGNGFACSLSSVRESLIERDEIVALLFNVSDIAVTLTKIERLLGGGDEEEEADES |
| Ga0193700_10140493 | 3300019873 | Soil | MPDPLIERAEAVALLFNVSDIAVALTNIERPLGGDDGEEEVDES |
| Ga0193701_10413852 | 3300019875 | Soil | MPAPLNERAEAVALLFNVSDIAVALTNIERPLGGDDGEEEVDES |
| Ga0193729_11604093 | 3300019887 | Soil | MPEPLIERAEVVALLFNVSDIAVTLTNIERLLGEDDGEEEVDEG |
| Ga0193751_12100722 | 3300019888 | Soil | VCKLAPLPESLIARAEVVALLFNVSDIAVTLANIERLLGEDDGEEEADED |
| Ga0193738_11635321 | 3300020020 | Soil | KGVEEPVIHREEVVALLFNVSDIALTLTKIERLLGGDDAEEEADEG |
| Ga0193724_10143182 | 3300020062 | Soil | MDETVISRDEVVALLFNVSDIARSLKPIEILMGGDDGEEEEADEG |
| Ga0206356_100507593 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | DDLQARWDMPEPMIERPEIVALLFNVSDIAVTLTNIERLLGGDDGEEEADEG |
| Ga0206356_118003301 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | LIERAEIAALLFNVSDIAITLTNIERLLGEDDGEEEADES |
| Ga0206355_15616183 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | MDEPVIERAEVVALLFNVSDIASSLDRIEQLLGEDDGEEEADGS |
| Ga0210382_102300692 | 3300021080 | Groundwater Sediment | VPEALIERDEVVALLFNVSDIAVTLARIEQRLAEDDGEEEADES |
| Ga0213873_101745111 | 3300021358 | Rhizosphere | VDDTLIERNEIVALLFNVSDILVVLRRIEKLLEEDDGEEEEADGS |
| Ga0193699_100231813 | 3300021363 | Soil | MVDPVIERGEVVALLFNVSDIAKSLSYIEQLLEDDNGQEGDED |
| Ga0182009_106560622 | 3300021445 | Soil | MLRRVAGLPIERDEIVALLFTVNDISVTLTRIERLLGGEDE |
| Ga0208037_10668611 | 3300025448 | Peatland | REETIALLFNVSDIARSLARIELLLGGEDGEEETDES |
| Ga0209539_11848891 | 3300025764 | Arctic Peat Soil | MPDPIIERAEVAALLFNVSDIALTLTNIERLLGEEENGEEEADED |
| Ga0207699_101332463 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEPVIERAEVVALLFTVSDIAVTLGNIEKLLGEEGDDGEEEADES |
| Ga0207684_104693312 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VAEPIIERDEAVGLLFNVSDILETLRRIERLLEDGGEAEEADEG |
| Ga0207707_100956145 | 3300025912 | Corn Rhizosphere | MSDPLIERAEIVALLSNVRDIASALERIERLLEEDDGEEEADEG |
| Ga0207660_103099941 | 3300025917 | Corn Rhizosphere | MIERPEVVALLFNVSDIAVTLTNIERLLGGDDGEEEADEG |
| Ga0207652_105618512 | 3300025921 | Corn Rhizosphere | MEEPVIERAGVVALLFNVSDIASSLDRIEQLLGEDD |
| Ga0207646_104608484 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEPLIERAEVVALLFNVSDLAVTLTSIERFLKEDEDDGEEEADQS |
| Ga0207661_101353284 | 3300025944 | Corn Rhizosphere | MAREELVALLFNVSDIAKTLTRIEILLEDDDEDEEADEG |
| Ga0207674_1000168832 | 3300026116 | Corn Rhizosphere | VAEPLIERAEVVALLFNVSDIVARLASIEQLLEDDDGEEEIDEG |
| Ga0207683_106213452 | 3300026121 | Miscanthus Rhizosphere | MSELLIDREEVVALLFSVHDVAATLLRIETLLEEDDGAEEADED |
| Ga0209265_10516093 | 3300026308 | Soil | VIGRNEVVGLLFNVSDIAVTLTAIERLLGGDDEEEKADEG |
| Ga0209153_10262941 | 3300026312 | Soil | MADDAVIHREEFVALLFTVSDIAHSLRNIERLLGGENGGEEEADEG |
| Ga0209155_12658581 | 3300026316 | Soil | NSMPESVIDRDEVVALLFNVSDMAVALRGIARLLLGDDNGEEEVDEG |
| Ga0209473_13296632 | 3300026330 | Soil | VTDAVIERAEIVALLFNVSDISVTLTEIERLLGGDDAEEEADEG |
| Ga0209057_10312935 | 3300026342 | Soil | MAEPLIKRDEIVDLLFNVSDIAVTLTKIERLLGGGDEEEEADEG |
| Ga0209159_12201311 | 3300026343 | Soil | PLIERAEVIALLFNVSDIAVTLTKIERLLGGADGEEEADEG |
| Ga0209735_11366771 | 3300027562 | Forest Soil | ERDEVVALLFDVSDIAVRLARIEQRLAEDDGEEEADDD |
| Ga0209726_100140279 | 3300027815 | Groundwater | MSEMLIERSEVVALLFNVSDIAITLTSIERFLKEDEDDGEEEADQS |
| Ga0209811_100836883 | 3300027821 | Surface Soil | MLDVVTESVIEREEVVALLFNVSDIAVAIRAIERLMGGDDGEAEADEG |
| Ga0209811_102544533 | 3300027821 | Surface Soil | SEVAALLFNVSDIAVAVEAIVDLLKEDDDGEEEAHEG |
| Ga0209590_100928192 | 3300027882 | Vadose Zone Soil | MSESLIERAEVVALLFNVSDIAVTLTNIERLLGEDDGEEEVDEG |
| Ga0209486_113156081 | 3300027886 | Agricultural Soil | VSEALIERDEIVALLFTLNDINATLIRIERLLREDEGEAEEDE |
| Ga0209415_102926662 | 3300027905 | Peatlands Soil | MPDLPIERDEVVALLFNVSDIAVTLTNIERVLGEDDGEEETDED |
| Ga0207428_100261833 | 3300027907 | Populus Rhizosphere | MEEALIERDEIVALLFNVSDLADTLAKIERLPGNGYEEEEADEG |
| Ga0207428_101225273 | 3300027907 | Populus Rhizosphere | MEDALIERDEIVALLFNVSDIADTLAKIERLLGNGDEEEEADEG |
| Ga0247718_10610782 | 3300028007 | Soil | VSDPLIERDEVVGLLFNVSDISVTLLEIERLLREDDGEAEEDD |
| Ga0307276_101445592 | 3300028705 | Soil | MGLQAARVADPLIERGEIVALLFNVSDIADTLTKIERLLRGGDEEEEADEG |
| Ga0307309_100840642 | 3300028714 | Soil | MPDPLIERAEAVALLFNVSDIAVALTNIERLLGGDDGEEEVDES |
| Ga0307311_101032961 | 3300028716 | Soil | MPDPLIERAEAVALLFNVSDIAVAVTNIERLLGGDDGEEEVDES |
| Ga0307307_102362922 | 3300028718 | Soil | SLIERGEIVALLFNVSDIADTLTKIERLLRGGDEEEEADEG |
| Ga0307315_102879811 | 3300028721 | Soil | MPAPLNERAEAVALLFNVSDIAVAVTNIERLLGGDDGEEEVDES |
| Ga0307319_100169831 | 3300028722 | Soil | RSGRHALVVPDDVIERDEVVALLFNVSDIAAAALNIERLLSEDDGEEEADEG |
| Ga0307318_100065143 | 3300028744 | Soil | VPDDVIERDEVVALLFNVSDIAAAALNIERLLSEDDGEEEADEG |
| Ga0307288_104340541 | 3300028778 | Soil | MPAPLNERAEAVALLFNVSDIAVAVTNIERLLGGGDGEEEVDES |
| Ga0307290_101651222 | 3300028791 | Soil | MPDPLIERAEAVALLFNVSDTAVALTNIERPLGGDDGEEEVDES |
| Ga0307504_101137741 | 3300028792 | Soil | MPPAQQSWGPMPDPLIEREEVVALLFNVSDIASALERIERLMEEDDGEEETDEG |
| Ga0307284_103231422 | 3300028799 | Soil | MPDSLIERAEVVALLFNVSDIAITLANIERLLGEDSGEEEADES |
| Ga0265338_100353522 | 3300028800 | Rhizosphere | VSELLIERNEVVALLFNVSDIAVTLTRIEALLREEDDGEAEADEG |
| Ga0307294_101825651 | 3300028810 | Soil | VQPSDVIALPFNASNIVARLASIEELLEDDDGKEETDER |
| Ga0307292_102887242 | 3300028811 | Soil | IERDEVVAFLFNVSDIAVTLTRIERLLLEDDDGEEEADQD |
| Ga0307310_101145141 | 3300028824 | Soil | MGLQAARVADPLIERGEIVALLYNVSDIADTLTKIERLLRGGDEEEEADEG |
| Ga0307289_104223823 | 3300028875 | Soil | QAARVSDVLIERDEVVAFLFNVSDIAVTLTRIERLLLEDDDGEEEADQD |
| Ga0307277_104599921 | 3300028881 | Soil | MSEPPIERPEVVALLFNVSDMAVTLTKIERLLGADDGEEEADEV |
| Ga0307304_103258382 | 3300028885 | Soil | MPDSLIERAEVVALLFNVSDIAITLANIERLLGEDSGEEADES |
| Ga0311335_109977031 | 3300030838 | Fen | MAGPLIERAEVVALLFNVSDIATTLSNIEMLLKEEDDGEEEADE |
| Ga0265320_104296471 | 3300031240 | Rhizosphere | MPDPIIERAEVAALLFNVSDIAVTLTNLERLLGEEENGEEEADEG |
| Ga0310813_122002322 | 3300031716 | Soil | MADLVIERAEVVALLFNVSDIAVTLTKIERLLGEDDGEAETDEG |
| Ga0318553_105282691 | 3300032068 | Soil | VCVAEEVIDRDEVVALLFNVSDIAASLDRIRLLLEGSDGEEETDEG |
| Ga0308173_120251963 | 3300032074 | Soil | CRVAEPVIERDEVVALLFNVSDIAVAIREIERILGDDDGEAEADEG |
| Ga0335085_101586235 | 3300032770 | Soil | MTDSPIERDEVIALLFNVSDIAVTLTRIERLLGGEDAEEEADES |
| Ga0335085_112620611 | 3300032770 | Soil | MDDAPIARAEVVALLSNVSDIAVTLTNIERLLGEDDGEEADED |
| Ga0335070_111290483 | 3300032829 | Soil | MDSSLVDRDEVVALLFNISDISLTLQRIEQLLTEDDDDGEEEADAG |
| Ga0335081_119916772 | 3300032892 | Soil | VTEPVIEREEVVALLFNVSDVAATLSRIERLLEEEDDGEEEADGG |
| Ga0335069_119025942 | 3300032893 | Soil | MEVSVIEREEVVALPFNVSDIVAALARIERLLKEDDGEEEAD |
| Ga0335072_101248744 | 3300032898 | Soil | MDDAPIERAEVVALLFNVSDIAVTLTNIERLLGEDDGEEADED |
| Ga0335084_100003762 | 3300033004 | Soil | MSELVINRDEVVALLFNVSDITAAVLRIEALLEDDGEAEEANEG |
| Ga0314862_0131243_178_312 | 3300033803 | Peatland | VPEHLIERAEVIALLFNVSDIAVTLTEIERHLGGDDGEEEADEG |
| Ga0314865_016017_1547_1693 | 3300033806 | Peatland | VEGVPEPLIERDEVVALLFNVSDIAATLAAIQRLLEGGDDGEEEADEG |
| Ga0314867_019936_657_791 | 3300033808 | Peatland | VQEPVIERAEVVGLLFNVSDIAVTLTKIERLLGEDDGEEEADKG |
| Ga0364924_065253_88_258 | 3300033811 | Sediment | VQRRANRDAIGVPEPVIGRDEVVALLFNVSDIVDVLKRIENLLQEDDGEAEETDGS |
| Ga0370501_0091913_593_727 | 3300034195 | Untreated Peat Soil | MPEPLIARAEVVALLFNVSDIAVTLTNIERLLGEDDGEEEADEG |
| ⦗Top⦘ |