NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F011809

Metagenome / Metatranscriptome Family F011809

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F011809
Family Type Metagenome / Metatranscriptome
Number of Sequences 287
Average Sequence Length 41 residues
Representative Sequence MDRKAEEEPIVELSATTTTPRDARPADAQQARDLRDTP
Number of Associated Samples 150
Number of Associated Scaffolds 287

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 32.75 %
% of genes near scaffold ends (potentially truncated) 75.26 %
% of genes from short scaffolds (< 2000 bps) 89.20 %
Associated GOLD sequencing projects 143
AlphaFold2 3D model prediction Yes
3D model pTM-score0.25

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (72.474 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(29.268 % of family members)
Environment Ontology (ENVO) Unclassified
(37.631 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.704 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 15.15%    β-sheet: 0.00%    Coil/Unstructured: 84.85%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.25
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 287 Family Scaffolds
PF00196GerE 2.44
PF01636APH 2.09
PF030614HBT 2.09
PF14559TPR_19 1.74
PF12900Pyridox_ox_2 1.74
PF00296Bac_luciferase 1.74
PF02374ArsA_ATPase 1.39
PF02518HATPase_c 1.39
PF00557Peptidase_M24 1.39
PF02735Ku 1.39
PF01569PAP2 1.05
PF00155Aminotran_1_2 1.05
PF00580UvrD-helicase 1.05
PF01145Band_7 1.05
PF02652Lactate_perm 1.05
PF08669GCV_T_C 1.05
PF11774Lsr2 1.05
PF00106adh_short 1.05
PF04978DUF664 1.05
PF01578Cytochrom_C_asm 1.05
PF00920ILVD_EDD 1.05
PF07728AAA_5 0.70
PF02771Acyl-CoA_dh_N 0.70
PF00067p450 0.70
PF00144Beta-lactamase 0.70
PF03861ANTAR 0.70
PF09663Amido_AtzD_TrzD 0.70
PF00037Fer4 0.70
PF13374TPR_10 0.70
PF13193AMP-binding_C 0.70
PF01557FAA_hydrolase 0.70
PF00702Hydrolase 0.70
PF00027cNMP_binding 0.70
PF12697Abhydrolase_6 0.70
PF02769AIRS_C 0.70
PF01614IclR 0.70
PF00440TetR_N 0.70
PF00463ICL 0.70
PF00455DeoRC 0.70
PF00753Lactamase_B 0.70
PF03729DUF308 0.70
PF14681UPRTase 0.70
PF00403HMA 0.70
PF01182Glucosamine_iso 0.70
PF03466LysR_substrate 0.70
PF01493GXGXG 0.35
PF13561adh_short_C2 0.35
PF06224HTH_42 0.35
PF01979Amidohydro_1 0.35
PF00682HMGL-like 0.35
PF12680SnoaL_2 0.35
PF01019G_glu_transpept 0.35
PF13472Lipase_GDSL_2 0.35
PF13602ADH_zinc_N_2 0.35
PF00578AhpC-TSA 0.35
PF01209Ubie_methyltran 0.35
PF01938TRAM 0.35
PF00118Cpn60_TCP1 0.35
PF09107SelB-wing_3 0.35
PF05762VWA_CoxE 0.35
PF01717Meth_synt_2 0.35
PF00005ABC_tran 0.35
PF00128Alpha-amylase 0.35
PF01012ETF 0.35
PF12681Glyoxalase_2 0.35
PF01872RibD_C 0.35
PF08241Methyltransf_11 0.35
PF00441Acyl-CoA_dh_1 0.35
PF027395_3_exonuc_N 0.35
PF00561Abhydrolase_1 0.35
PF01121CoaE 0.35
PF14016DUF4232 0.35
PF00162PGK 0.35
PF08281Sigma70_r4_2 0.35
PF00491Arginase 0.35
PF02397Bac_transf 0.35
PF13302Acetyltransf_3 0.35
PF02190LON_substr_bdg 0.35
PF01799Fer2_2 0.35
PF04679DNA_ligase_A_C 0.35
PF09924LPG_synthase_C 0.35
PF00072Response_reg 0.35
PF13191AAA_16 0.35
PF02211NHase_beta 0.35
PF01794Ferric_reduct 0.35
PF13458Peripla_BP_6 0.35
PF12627PolyA_pol_RNAbd 0.35
PF00293NUDIX 0.35
PF00962A_deaminase 0.35
PF00275EPSP_synthase 0.35
PF16363GDP_Man_Dehyd 0.35
PF00486Trans_reg_C 0.35
PF09900DUF2127 0.35
PF07045DUF1330 0.35
PF13396PLDc_N 0.35
PF10094DUF2332 0.35
PF05088Bac_GDH 0.35
PF12728HTH_17 0.35
PF13401AAA_22 0.35
PF06781CrgA 0.35
PF02934GatB_N 0.35
PF14574RACo_C_ter 0.35
PF13450NAD_binding_8 0.35
PF08044DUF1707 0.35
PF12172DUF35_N 0.35
PF02012BNR 0.35
PF08240ADH_N 0.35
PF13340DUF4096 0.35
PF10431ClpB_D2-small 0.35
PF03988DUF347 0.35
PF13669Glyoxalase_4 0.35
PF03949Malic_M 0.35
PF01464SLT 0.35
PF02222ATP-grasp 0.35
PF01321Creatinase_N 0.35
PF00923TAL_FSA 0.35
PF00534Glycos_transf_1 0.35
PF01196Ribosomal_L17 0.35
PF04075F420H2_quin_red 0.35
PF00135COesterase 0.35
PF07978NIPSNAP 0.35
PF00266Aminotran_5 0.35
PF01643Acyl-ACP_TE 0.35
PF00701DHDPS 0.35
PF013675_3_exonuc 0.35
PF00069Pkinase 0.35
PF06253MTTB 0.35
PF09363XFP_C 0.35
PF00781DAGK_cat 0.35
PF13404HTH_AsnC-type 0.35
PF11305DUF3107 0.35
PF00254FKBP_C 0.35
PF12710HAD 0.35
PF00132Hexapep 0.35
PF01583APS_kinase 0.35
PF13524Glyco_trans_1_2 0.35
PF02637GatB_Yqey 0.35
PF01039Carboxyl_trans 0.35
PF12411Choline_sulf_C 0.35
PF01230HIT 0.35

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 287 Family Scaffolds
COG0129Dihydroxyacid dehydratase/phosphogluconate dehydrataseCarbohydrate transport and metabolism [G] 2.09
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 1.74
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 1.39
COG1273Non-homologous end joining protein Ku, dsDNA break repairReplication, recombination and repair [L] 1.39
COG1349DNA-binding transcriptional regulator of sugar metabolism, DeoR/GlpR familyTranscription [K] 1.39
COG1620L-lactate permeaseEnergy production and conversion [C] 1.05
COG10743’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V)Replication, recombination and repair [L] 1.05
COG3973DNA helicase IVReplication, recombination and repair [L] 1.05
COG0210Superfamily I DNA or RNA helicaseReplication, recombination and repair [L] 1.05
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 1.05
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.70
COG2608Copper chaperone CopZInorganic ion transport and metabolism [P] 0.70
COG2224Isocitrate lyaseEnergy production and conversion [C] 0.70
COG1597Phosphatidylglycerol kinase, diacylglycerol kinase familyLipid transport and metabolism [I] 0.70
COG1414DNA-binding transcriptional regulator, IclR familyTranscription [K] 0.70
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.70
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 0.70
COG2367Beta-lactamase class ADefense mechanisms [V] 0.70
COG2511Archaeal Glu-tRNAGln amidotransferase subunit E, contains GAD domainTranslation, ribosomal structure and biogenesis [J] 0.70
COG2124Cytochrome P450Defense mechanisms [V] 0.70
COG0064Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunitTranslation, ribosomal structure and biogenesis [J] 0.70
COG0120Ribose 5-phosphate isomeraseCarbohydrate transport and metabolism [G] 0.70
COG3247Acid resistance membrane protein HdeD, DUF308 familyGeneral function prediction only [R] 0.70
COG03636-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminaseCarbohydrate transport and metabolism [G] 0.70
COG03294-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyaseCell wall/membrane/envelope biogenesis [M] 0.70
COG3707Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domainsTranscription [K] 0.70
COG02585'-3' exonuclease Xni/ExoIX (flap endonuclease)Replication, recombination and repair [L] 0.70
COG5598Trimethylamine:corrinoid methyltransferaseCoenzyme transport and metabolism [H] 0.35
COG1610Uncharacterized conserved protein YqeY, may have tRNA amino acid amidase activityGeneral function prediction only [R] 0.35
COG2148Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid)Cell wall/membrane/envelope biogenesis [M] 0.35
COG5470Uncharacterized conserved protein, DUF1330 familyFunction unknown [S] 0.35
COG4799Acetyl-CoA carboxylase, carboxyltransferase componentLipid transport and metabolism [I] 0.35
COG4705Uncharacterized membrane-anchored proteinFunction unknown [S] 0.35
COG3884Acyl-ACP thioesteraseLipid transport and metabolism [I] 0.35
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.35
COG3280Maltooligosyltrehalose synthaseCarbohydrate transport and metabolism [G] 0.35
COG22272-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylaseCoenzyme transport and metabolism [H] 0.35
COG2272Carboxylesterase type BLipid transport and metabolism [I] 0.35
COG3214DNA glycosylase YcaQ, repair of DNA interstrand crosslinksReplication, recombination and repair [L] 0.35
COG2902NAD-specific glutamate dehydrogenaseAmino acid transport and metabolism [E] 0.35
COG0529Adenylylsulfate kinase or related kinaseInorganic ion transport and metabolism [P] 0.35
COG0010Arginase/agmatinase family enzymeAmino acid transport and metabolism [E] 0.35
COG01263-phosphoglycerate kinaseCarbohydrate transport and metabolism [G] 0.35
COG0176Transaldolase/fructose-6-phosphate aldolaseCarbohydrate transport and metabolism [G] 0.35
COG0203Ribosomal protein L17Translation, ribosomal structure and biogenesis [J] 0.35
COG0237Dephospho-CoA kinaseCoenzyme transport and metabolism [H] 0.35
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.35
COG0281Malic enzymeEnergy production and conversion [C] 0.35
COG02961,4-alpha-glucan branching enzymeCarbohydrate transport and metabolism [G] 0.35
COG0366Glycosidase/amylase (phosphorylase)Carbohydrate transport and metabolism [G] 0.35
COG0405Gamma-glutamyltranspeptidaseAmino acid transport and metabolism [E] 0.35
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 0.35
COG2086Electron transfer flavoprotein, alpha and beta subunitsEnergy production and conversion [C] 0.35
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 0.35
COG0686Alanine dehydrogenase (includes sporulation protein SpoVN)Amino acid transport and metabolism [E] 0.35
COG0777Acetyl-CoA carboxylase beta subunitLipid transport and metabolism [I] 0.35
COG0825Acetyl-CoA carboxylase alpha subunitLipid transport and metabolism [I] 0.35
COG1523Pullulanase/glycogen debranching enzymeCarbohydrate transport and metabolism [G] 0.35
COG0006Xaa-Pro aminopeptidaseAmino acid transport and metabolism [E] 0.35
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 0.35
COG1816Adenosine/6-amino-6-deoxyfutalosine deaminaseNucleotide transport and metabolism [F] 0.35
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.35
COG2025Electron transfer flavoprotein, alpha subunit FixBEnergy production and conversion [C] 0.35


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms72.47 %
UnclassifiedrootN/A27.53 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_104943914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia524Open in IMG/M
3300001403|JGI20205J14842_1021799All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300004281|Ga0066397_10147718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia535Open in IMG/M
3300004633|Ga0066395_10174797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp.1106Open in IMG/M
3300005172|Ga0066683_10661533Not Available625Open in IMG/M
3300005332|Ga0066388_100719559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1602Open in IMG/M
3300005332|Ga0066388_100892548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia asaccharolytica1468Open in IMG/M
3300005332|Ga0066388_102050165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1027Open in IMG/M
3300005332|Ga0066388_106628034Not Available583Open in IMG/M
3300005332|Ga0066388_107921986Not Available531Open in IMG/M
3300005363|Ga0008090_10166041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1878Open in IMG/M
3300005713|Ga0066905_100171922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1587Open in IMG/M
3300005713|Ga0066905_100517184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales996Open in IMG/M
3300005713|Ga0066905_100704739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales867Open in IMG/M
3300005713|Ga0066905_100712462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia862Open in IMG/M
3300005713|Ga0066905_101463456Not Available620Open in IMG/M
3300005713|Ga0066905_101706848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → environmental samples → uncultured Frankineae bacterium579Open in IMG/M
3300005764|Ga0066903_101740372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1188Open in IMG/M
3300005764|Ga0066903_102948284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces922Open in IMG/M
3300005764|Ga0066903_103557841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia839Open in IMG/M
3300005764|Ga0066903_103873250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia804Open in IMG/M
3300005764|Ga0066903_104183217All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300005764|Ga0066903_104716894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria725Open in IMG/M
3300005764|Ga0066903_106493345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales609Open in IMG/M
3300005899|Ga0075271_10012836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1509Open in IMG/M
3300005900|Ga0075272_1105659All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300005901|Ga0075274_1025796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales818Open in IMG/M
3300005902|Ga0075273_10027111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria975Open in IMG/M
3300006028|Ga0070717_10069665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2930Open in IMG/M
3300006028|Ga0070717_10435450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1180Open in IMG/M
3300006046|Ga0066652_100812664Not Available894Open in IMG/M
3300006573|Ga0074055_11832188Not Available1033Open in IMG/M
3300006575|Ga0074053_12000376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales942Open in IMG/M
3300006577|Ga0074050_10003246Not Available1341Open in IMG/M
3300006579|Ga0074054_12131999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales752Open in IMG/M
3300006581|Ga0074048_13465335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Thermocrispum → Thermocrispum municipale1541Open in IMG/M
3300006605|Ga0074057_12238528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia507Open in IMG/M
3300006755|Ga0079222_10150169All Organisms → cellular organisms → Bacteria1323Open in IMG/M
3300006796|Ga0066665_10342876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1216Open in IMG/M
3300006796|Ga0066665_11363048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia547Open in IMG/M
3300006804|Ga0079221_10858508Not Available660Open in IMG/M
3300006804|Ga0079221_11175507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales594Open in IMG/M
3300006854|Ga0075425_100204108All Organisms → cellular organisms → Bacteria2271Open in IMG/M
3300006854|Ga0075425_100714491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1150Open in IMG/M
3300006903|Ga0075426_10497488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales906Open in IMG/M
3300006954|Ga0079219_12092061All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300006954|Ga0079219_12452659Not Available507Open in IMG/M
3300009137|Ga0066709_101476739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Nocardiopsis983Open in IMG/M
3300009792|Ga0126374_10338469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1026Open in IMG/M
3300009792|Ga0126374_10482352All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300009792|Ga0126374_10514361Not Available866Open in IMG/M
3300009792|Ga0126374_10559587Not Available836Open in IMG/M
3300009792|Ga0126374_11126598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria624Open in IMG/M
3300010043|Ga0126380_10093421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1782Open in IMG/M
3300010043|Ga0126380_10249563Not Available1228Open in IMG/M
3300010043|Ga0126380_10474946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria952Open in IMG/M
3300010046|Ga0126384_10429440All Organisms → cellular organisms → Bacteria → Terrabacteria group1123Open in IMG/M
3300010047|Ga0126382_11247067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → environmental samples → uncultured Frankineae bacterium669Open in IMG/M
3300010047|Ga0126382_11338291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia650Open in IMG/M
3300010047|Ga0126382_12314091Not Available520Open in IMG/M
3300010048|Ga0126373_10144733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2253Open in IMG/M
3300010048|Ga0126373_10743103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1041Open in IMG/M
3300010048|Ga0126373_11292877Not Available795Open in IMG/M
3300010048|Ga0126373_11679412All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300010048|Ga0126373_12617380Not Available563Open in IMG/M
3300010048|Ga0126373_12864528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea538Open in IMG/M
3300010358|Ga0126370_10114628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1896Open in IMG/M
3300010358|Ga0126370_10278591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1314Open in IMG/M
3300010358|Ga0126370_10398960Not Available1129Open in IMG/M
3300010358|Ga0126370_12066594All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300010359|Ga0126376_11207989Not Available771Open in IMG/M
3300010360|Ga0126372_10029335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3418Open in IMG/M
3300010360|Ga0126372_10119351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2033Open in IMG/M
3300010360|Ga0126372_10302865Not Available1406Open in IMG/M
3300010360|Ga0126372_10340517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1340Open in IMG/M
3300010360|Ga0126372_10470325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1171Open in IMG/M
3300010360|Ga0126372_11009922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces844Open in IMG/M
3300010360|Ga0126372_11536810Not Available703Open in IMG/M
3300010360|Ga0126372_12895915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium532Open in IMG/M
3300010360|Ga0126372_13063387Not Available519Open in IMG/M
3300010361|Ga0126378_10106709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2777Open in IMG/M
3300010361|Ga0126378_10193910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2104Open in IMG/M
3300010361|Ga0126378_10324333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1647Open in IMG/M
3300010361|Ga0126378_11502240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales764Open in IMG/M
3300010361|Ga0126378_12124100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria641Open in IMG/M
3300010361|Ga0126378_12237462Not Available624Open in IMG/M
3300010362|Ga0126377_11305941All Organisms → cellular organisms → Bacteria → Terrabacteria group797Open in IMG/M
3300010362|Ga0126377_12710048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium571Open in IMG/M
3300010366|Ga0126379_10398332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1423Open in IMG/M
3300010366|Ga0126379_12162941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia658Open in IMG/M
3300010366|Ga0126379_12165060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia657Open in IMG/M
3300010376|Ga0126381_100140449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3156Open in IMG/M
3300010398|Ga0126383_11088992All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia888Open in IMG/M
3300010398|Ga0126383_12067536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia657Open in IMG/M
3300011271|Ga0137393_10889844Not Available760Open in IMG/M
3300012198|Ga0137364_10173773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → environmental samples → uncultured Nocardioidaceae bacterium1569Open in IMG/M
3300012198|Ga0137364_10974350All Organisms → cellular organisms → Bacteria → Terrabacteria group642Open in IMG/M
3300012199|Ga0137383_10849976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria666Open in IMG/M
3300012200|Ga0137382_10021274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae3728Open in IMG/M
3300012201|Ga0137365_10048216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3232Open in IMG/M
3300012207|Ga0137381_11179319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia658Open in IMG/M
3300012210|Ga0137378_10205803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1832Open in IMG/M
3300012285|Ga0137370_10244143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. NL15-2K1062Open in IMG/M
3300012349|Ga0137387_10496153Not Available886Open in IMG/M
3300012356|Ga0137371_10272279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis saalfeldensis1321Open in IMG/M
3300012356|Ga0137371_11263324Not Available548Open in IMG/M
3300012356|Ga0137371_11445950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia502Open in IMG/M
3300012359|Ga0137385_11168796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa ishikariensis631Open in IMG/M
3300012948|Ga0126375_10391746Not Available1001Open in IMG/M
3300012971|Ga0126369_10461288Not Available1322Open in IMG/M
3300012971|Ga0126369_11035130Not Available909Open in IMG/M
3300012971|Ga0126369_11718905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria717Open in IMG/M
3300012971|Ga0126369_11964810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria673Open in IMG/M
3300012975|Ga0134110_10457454Not Available574Open in IMG/M
3300015371|Ga0132258_10840404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2316Open in IMG/M
3300015371|Ga0132258_10974927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2142Open in IMG/M
3300016270|Ga0182036_11210745Not Available628Open in IMG/M
3300016319|Ga0182033_10572819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia978Open in IMG/M
3300016319|Ga0182033_11776986Not Available559Open in IMG/M
3300016341|Ga0182035_11318295Not Available647Open in IMG/M
3300016341|Ga0182035_12171826All Organisms → cellular organisms → Bacteria → Terrabacteria group503Open in IMG/M
3300016357|Ga0182032_10154961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter stackebrandtii1699Open in IMG/M
3300016357|Ga0182032_10739806Not Available828Open in IMG/M
3300016404|Ga0182037_10343406All Organisms → cellular organisms → Bacteria1214Open in IMG/M
3300016422|Ga0182039_10632190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae938Open in IMG/M
3300016422|Ga0182039_12088744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii522Open in IMG/M
3300016445|Ga0182038_12157265All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia505Open in IMG/M
3300017939|Ga0187775_10152150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia825Open in IMG/M
3300017939|Ga0187775_10170817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria788Open in IMG/M
3300017947|Ga0187785_10677319All Organisms → cellular organisms → Bacteria → Terrabacteria group539Open in IMG/M
3300017947|Ga0187785_10697822Not Available532Open in IMG/M
3300017966|Ga0187776_10421572Not Available897Open in IMG/M
3300017966|Ga0187776_10743369Not Available698Open in IMG/M
3300017966|Ga0187776_10795348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK678Open in IMG/M
3300017966|Ga0187776_11313656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia547Open in IMG/M
3300017966|Ga0187776_11406973All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300017973|Ga0187780_10035373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3510Open in IMG/M
3300017999|Ga0187767_10061419Not Available960Open in IMG/M
3300018032|Ga0187788_10075841Not Available1182Open in IMG/M
3300018032|Ga0187788_10141711All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300018058|Ga0187766_10138749All Organisms → cellular organisms → Bacteria1502Open in IMG/M
3300018060|Ga0187765_10000537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales13940Open in IMG/M
3300018060|Ga0187765_10036996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae2447Open in IMG/M
3300018060|Ga0187765_10091663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1640Open in IMG/M
3300018060|Ga0187765_10127420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1416Open in IMG/M
3300018060|Ga0187765_10186761All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1191Open in IMG/M
3300018060|Ga0187765_10565682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium729Open in IMG/M
3300018060|Ga0187765_11253199Not Available523Open in IMG/M
3300018064|Ga0187773_10021253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2785Open in IMG/M
3300018064|Ga0187773_10038917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2134Open in IMG/M
3300018064|Ga0187773_10044805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2012Open in IMG/M
3300018064|Ga0187773_10105332Not Available1397Open in IMG/M
3300018064|Ga0187773_10374906Not Available817Open in IMG/M
3300018064|Ga0187773_10527680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia709Open in IMG/M
3300018064|Ga0187773_10603727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium671Open in IMG/M
3300018064|Ga0187773_10815144Not Available595Open in IMG/M
3300018064|Ga0187773_10841867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia587Open in IMG/M
3300018089|Ga0187774_10085840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1512Open in IMG/M
3300018089|Ga0187774_10281602All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300018089|Ga0187774_10497135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria767Open in IMG/M
3300018089|Ga0187774_11029755All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia577Open in IMG/M
3300018469|Ga0190270_12016502Not Available635Open in IMG/M
3300019767|Ga0190267_10189964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria949Open in IMG/M
3300021560|Ga0126371_10348965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1615Open in IMG/M
3300021560|Ga0126371_10398513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1518Open in IMG/M
3300021560|Ga0126371_13306526Not Available545Open in IMG/M
3300021560|Ga0126371_13753871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae512Open in IMG/M
3300025928|Ga0207700_10258533Not Available1490Open in IMG/M
3300025929|Ga0207664_10527504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1058Open in IMG/M
3300026995|Ga0208761_1027098Not Available568Open in IMG/M
3300027523|Ga0208890_1006084All Organisms → cellular organisms → Bacteria1477Open in IMG/M
3300027646|Ga0209466_1014590All Organisms → cellular organisms → Bacteria → Proteobacteria1654Open in IMG/M
3300027765|Ga0209073_10292867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium643Open in IMG/M
3300031543|Ga0318516_10012839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4101Open in IMG/M
3300031544|Ga0318534_10188721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1190Open in IMG/M
3300031544|Ga0318534_10242376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales1040Open in IMG/M
3300031544|Ga0318534_10603720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria623Open in IMG/M
3300031546|Ga0318538_10015229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3308Open in IMG/M
3300031546|Ga0318538_10059420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1892Open in IMG/M
3300031546|Ga0318538_10130766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae1317Open in IMG/M
3300031546|Ga0318538_10440279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → Microbispora sitophila706Open in IMG/M
3300031549|Ga0318571_10253357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium648Open in IMG/M
3300031572|Ga0318515_10284548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura886Open in IMG/M
3300031573|Ga0310915_10230884All Organisms → cellular organisms → Bacteria1300Open in IMG/M
3300031573|Ga0310915_10443657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → Jatrophihabitans telluris922Open in IMG/M
3300031640|Ga0318555_10230121Not Available1000Open in IMG/M
3300031668|Ga0318542_10176267Not Available1071Open in IMG/M
3300031681|Ga0318572_10890647Not Available529Open in IMG/M
3300031713|Ga0318496_10113877Not Available1459Open in IMG/M
3300031713|Ga0318496_10133853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1346Open in IMG/M
3300031713|Ga0318496_10285953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia910Open in IMG/M
3300031719|Ga0306917_10360215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales1132Open in IMG/M
3300031719|Ga0306917_10820097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium729Open in IMG/M
3300031720|Ga0307469_10064529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2389Open in IMG/M
3300031723|Ga0318493_10146070All Organisms → cellular organisms → Bacteria1220Open in IMG/M
3300031724|Ga0318500_10074557All Organisms → cellular organisms → Bacteria1497Open in IMG/M
3300031724|Ga0318500_10082948All Organisms → cellular organisms → Bacteria1431Open in IMG/M
3300031724|Ga0318500_10154907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1080Open in IMG/M
3300031724|Ga0318500_10349648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria730Open in IMG/M
3300031736|Ga0318501_10172714Not Available1121Open in IMG/M
3300031744|Ga0306918_10173206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1610Open in IMG/M
3300031747|Ga0318502_10351172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria872Open in IMG/M
3300031748|Ga0318492_10085186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes subtropicus1534Open in IMG/M
3300031748|Ga0318492_10308462Not Available824Open in IMG/M
3300031765|Ga0318554_10217384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1088Open in IMG/M
3300031768|Ga0318509_10102715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales1543Open in IMG/M
3300031769|Ga0318526_10247496Not Available729Open in IMG/M
3300031769|Ga0318526_10294848All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300031771|Ga0318546_10723224Not Available700Open in IMG/M
3300031777|Ga0318543_10419375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. SID2131600Open in IMG/M
3300031778|Ga0318498_10009950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3795Open in IMG/M
3300031778|Ga0318498_10073031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1542Open in IMG/M
3300031779|Ga0318566_10134347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → unclassified Kribbellaceae → Kribbellaceae bacterium1223Open in IMG/M
3300031781|Ga0318547_10102194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1638Open in IMG/M
3300031793|Ga0318548_10476771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia610Open in IMG/M
3300031794|Ga0318503_10036653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1458Open in IMG/M
3300031795|Ga0318557_10266999Not Available784Open in IMG/M
3300031797|Ga0318550_10137617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora chersina1169Open in IMG/M
3300031798|Ga0318523_10350369Not Available735Open in IMG/M
3300031831|Ga0318564_10013955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3240Open in IMG/M
3300031831|Ga0318564_10020579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2734Open in IMG/M
3300031831|Ga0318564_10375753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium623Open in IMG/M
3300031846|Ga0318512_10089984Not Available1430Open in IMG/M
3300031879|Ga0306919_10150194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1698Open in IMG/M
3300031879|Ga0306919_10572486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia871Open in IMG/M
3300031890|Ga0306925_10062643All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3902Open in IMG/M
3300031890|Ga0306925_10260290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1869Open in IMG/M
3300031890|Ga0306925_10805430Not Available974Open in IMG/M
3300031890|Ga0306925_10816439Not Available966Open in IMG/M
3300031893|Ga0318536_10147597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1194Open in IMG/M
3300031893|Ga0318536_10230324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium942Open in IMG/M
3300031896|Ga0318551_10636432Not Available616Open in IMG/M
3300031910|Ga0306923_10117100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3018Open in IMG/M
3300031912|Ga0306921_10286118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1930Open in IMG/M
3300031941|Ga0310912_10214894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales1473Open in IMG/M
3300031945|Ga0310913_10085155Not Available2115Open in IMG/M
3300031945|Ga0310913_10174261All Organisms → cellular organisms → Bacteria1496Open in IMG/M
3300031945|Ga0310913_10314260Not Available1106Open in IMG/M
3300031945|Ga0310913_10492490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium870Open in IMG/M
3300031946|Ga0310910_10516400Not Available948Open in IMG/M
3300031946|Ga0310910_11072198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria628Open in IMG/M
3300031947|Ga0310909_11030708Not Available671Open in IMG/M
3300031947|Ga0310909_11643889Not Available508Open in IMG/M
3300031959|Ga0318530_10392248Not Available575Open in IMG/M
3300032001|Ga0306922_11785989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales606Open in IMG/M
3300032008|Ga0318562_10068703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1973Open in IMG/M
3300032009|Ga0318563_10757824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria520Open in IMG/M
3300032010|Ga0318569_10051760Not Available1777Open in IMG/M
3300032010|Ga0318569_10136860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1122Open in IMG/M
3300032010|Ga0318569_10146755All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1084Open in IMG/M
3300032010|Ga0318569_10270162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria791Open in IMG/M
3300032035|Ga0310911_10209847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales1109Open in IMG/M
3300032035|Ga0310911_10903949Not Available509Open in IMG/M
3300032039|Ga0318559_10112956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1212Open in IMG/M
3300032039|Ga0318559_10463367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces591Open in IMG/M
3300032039|Ga0318559_10591100Not Available518Open in IMG/M
3300032041|Ga0318549_10455545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia576Open in IMG/M
3300032043|Ga0318556_10043350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2150Open in IMG/M
3300032044|Ga0318558_10185145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1012Open in IMG/M
3300032044|Ga0318558_10517392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia596Open in IMG/M
3300032052|Ga0318506_10067298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1481Open in IMG/M
3300032064|Ga0318510_10112493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1047Open in IMG/M
3300032064|Ga0318510_10151232Not Available916Open in IMG/M
3300032064|Ga0318510_10270596Not Available702Open in IMG/M
3300032065|Ga0318513_10016131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3035Open in IMG/M
3300032067|Ga0318524_10221559Not Available970Open in IMG/M
3300032067|Ga0318524_10496173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia640Open in IMG/M
3300032067|Ga0318524_10694102Not Available537Open in IMG/M
3300032076|Ga0306924_10911580Not Available971Open in IMG/M
3300032090|Ga0318518_10619799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia552Open in IMG/M
3300032205|Ga0307472_102574020Not Available518Open in IMG/M
3300032782|Ga0335082_10255620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1633Open in IMG/M
3300032783|Ga0335079_10048582All Organisms → cellular organisms → Bacteria4862Open in IMG/M
3300032783|Ga0335079_11482244Not Available671Open in IMG/M
3300032828|Ga0335080_10503923All Organisms → cellular organisms → Bacteria → Terrabacteria group1285Open in IMG/M
3300032828|Ga0335080_11024545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales839Open in IMG/M
3300032828|Ga0335080_11051086All Organisms → cellular organisms → Bacteria → Terrabacteria group826Open in IMG/M
3300032828|Ga0335080_11409483Not Available692Open in IMG/M
3300032828|Ga0335080_11556738Not Available652Open in IMG/M
3300032955|Ga0335076_10369347Not Available1320Open in IMG/M
3300032955|Ga0335076_10794090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia828Open in IMG/M
3300032955|Ga0335076_11267992All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria621Open in IMG/M
3300033004|Ga0335084_10506680Not Available1240Open in IMG/M
3300033158|Ga0335077_10240422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2012Open in IMG/M
3300033158|Ga0335077_10750916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia999Open in IMG/M
3300033290|Ga0318519_10191376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales1163Open in IMG/M
3300033805|Ga0314864_0040561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1039Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil29.27%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil19.16%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland11.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.36%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil7.32%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.88%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.79%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.74%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.39%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.05%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.70%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.70%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.70%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.35%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.35%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.35%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.35%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.35%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.35%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001403Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012EnvironmentalOpen in IMG/M
3300004281Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBioEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005899Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302EnvironmentalOpen in IMG/M
3300005900Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404EnvironmentalOpen in IMG/M
3300005901Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201EnvironmentalOpen in IMG/M
3300005902Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006577Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017939Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MGEnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026995Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes)EnvironmentalOpen in IMG/M
3300027523Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes)EnvironmentalOpen in IMG/M
3300027646Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033805Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10494391423300000956SoilMKGEGEAGGDRKAEEEFIAELWATTTTPRGARPVDAQQA
JGI20205J14842_102179913300001403Arctic Peat SoilPSRAAAGGMHRKAEEEPIAELWATTTTQRGARPVDAQQAEDPRDMP*
Ga0066397_1014771813300004281Tropical Forest SoilMPSRAAVGGIDRKAEEETIVELPATTTTRRDARPADAQQAGD
Ga0066395_1017479723300004633Tropical Forest SoilMPSRAVAGGMDRKAEEEPIVELFGDDDNAADARPAAAQQAEDLWDTP*
Ga0066683_1066153313300005172SoilMPSRAVAGGMDRKAEEEPIVELSATTTTPRDARPADAQQARDL*
Ga0066388_10071955913300005332Tropical Forest SoilPSRAAAGGMDRKAEEEPIAELLATTTTPRGARPVDAQQARDLRDTP*
Ga0066388_10089254833300005332Tropical Forest SoilMGRRVGDRKAEEEPIVGLWATTTTQRGARPVDAQQAGGLRDTP
Ga0066388_10205016513300005332Tropical Forest SoilVSRRSMPSRAAAGGMDRKAEEETIVELSAATATPRDARPAGAQQAGDLRDMA*
Ga0066388_10662803423300005332Tropical Forest SoilMPSRAVAGGMDRKAEEELIVELSAMTATPRDARPADAQQAGDLRDTA*
Ga0066388_10792198613300005332Tropical Forest SoilGGMDRKAEEETIVELSATTTTPRDARPAAAQQAEDLQDMP*
Ga0008090_1016604113300005363Tropical Rainforest SoilMGRRVGHRKAEEEPIAELCATTTTPRGARPVDAQQARDLRDTP
Ga0066905_10017192223300005713Tropical Forest SoilMDRKAEEETIVELSATTTTPRNARPAAAQQAEDL*
Ga0066905_10051718423300005713Tropical Forest SoilMDRKAEEETIVELSATTTTPRDARPAAAQQAGDLRDMA*
Ga0066905_10070473913300005713Tropical Forest SoilPSRAVAGGMDRKAEEETIVELPATTATPRAARPATA*
Ga0066905_10071246213300005713Tropical Forest SoilMPSRAIAGGMDRKAEKELMVELSATTTTPRDARPADAQQAGDLRDMA*
Ga0066905_10146345613300005713Tropical Forest SoilDRKAEEETIVELSAATATPRAARPADAQQAGDLRDMA*
Ga0066905_10170684813300005713Tropical Forest SoilMPSRAAVGGIDRKAEEETIVELPATTTTRRDARPADAQQAGDLRD
Ga0066903_10174037223300005764Tropical Forest SoilSLPSRAAAGGMDRKAEEEPIAELLATTTTQRGARPVDAEQAGDLRDTPSRGWPA*
Ga0066903_10294828423300005764Tropical Forest SoilMDRKAEEETIVELSATMATPRDARPAAAQQARDLRDMP*
Ga0066903_10355784123300005764Tropical Forest SoilGGMHRKAEEEPIAELLATTTTPRGARPADAQQARDLRDTPWA*
Ga0066903_10387325013300005764Tropical Forest SoilRERLSGGMDRKAEEELIAELWATTTTPRGARPAAAQQAE*
Ga0066903_10418321723300005764Tropical Forest SoilAGGMDRKAEEEPIVGLWATTTTQRGARPVDAQQAGGLRDTP*
Ga0066903_10471689413300005764Tropical Forest SoilMPSRAVAGGMDRKAEEETIVELSATTTTPRDARPA
Ga0066903_10649334513300005764Tropical Forest SoilAGGMDRKAEEEPIVGLWATTTTQRGARPVDAQQAGGLRDMP*
Ga0075271_1001283623300005899Rice Paddy SoilMARKAEEEPIVELSAMTARQREARPGGAQQAEDCQDTP*
Ga0075272_110565913300005900Rice Paddy SoilRKAEEERITELFATAATRRDARPGGAQQAEDLRNMA*
Ga0075274_102579623300005901Rice Paddy SoilMARKAEEEPIVELSATTARQREARPGGAQQAEDCQDTP*
Ga0075273_1002711113300005902Rice Paddy SoilKADEERMVELFAVTATPRDARTGDAQQADDLRDPA*
Ga0070717_1006966513300006028Corn, Switchgrass And Miscanthus RhizosphereGGMDRKAEEEPIVELWETTTTPRGARPGAAQQARDLRDTP*
Ga0070717_1043545023300006028Corn, Switchgrass And Miscanthus RhizosphereMDRKAEEETIVELSATTTTPRDARPAAAQQAEDLLDMP*
Ga0066652_10081266413300006046SoilGDRKTEEETIVELPATTTIPRDDRPAAAQQAGDLRDMA*
Ga0074055_1183218823300006573SoilAGGMDRKAEEETIVELSAATATPRDARPADAQQAGDLRDTA*
Ga0074053_1200037623300006575SoilMDRKAEEETIVELSATTTTPRDARPADAQQAGDLRDMA*
Ga0074050_1000324623300006577SoilAGGMDRKAEEEPIVELSATTTTPRDARPAAAQQAEDLWDTP*
Ga0074054_1213199933300006579SoilMDRKAEEELIVELSATTTTPRDARPADAQQAGDLR
Ga0074048_1346533533300006581SoilMDRKAEEEPIVELSATTTTPRAARPAVAQQAGDLRDMA
Ga0074057_1223852813300006605SoilMGRRAGDRKAEEETIVELSAATATPRDARPAVAQQAGD
Ga0079222_1015016933300006755Agricultural SoilGGMDRKAEEELIAELWATTTTPRAARPADAQQAE*
Ga0066665_1034287623300006796SoilMPSRAVAGGMDRKTEEEPIVELSATTTTPRDARPADAQQARDLRDTP*
Ga0066665_1136304823300006796SoilMPSRAAADGMDRKAEEEPIVVLWATTTTPRGARPVDAQ
Ga0079221_1085850823300006804Agricultural SoilGMGRRVGDRKAEEEPIAELWATTTTPRGARPVDAQQAG*
Ga0079221_1117550723300006804Agricultural SoilLPSRAPAGGMDRKAEEEPIAELLATTTTPRGARPADAQQAGDLRDTPWAPAGFFR*
Ga0075425_10020410843300006854Populus RhizosphereSMPSRAAAGGMDRKAEEELIAELWATTTTPRAARPADAQQAE*
Ga0075425_10071449133300006854Populus RhizosphereMDRKAEEETIVELSATTTTPRDARPAAAQQAEDLWDMP*
Ga0075426_1049748813300006903Populus RhizosphereGRRVGDRKAEEEPIAELLATTTTQRGARPVDAQH*
Ga0079219_1209206123300006954Agricultural SoilVARIFAVASGRMKGMGRRVGHRKAEEEPIAELWATTTTPRGARPADAQQARDLRD
Ga0079219_1245265913300006954Agricultural SoilRGMGRRVGDRKAEEEPMAELLATTTTQRGARPADAQQAGDLQDSP*
Ga0066709_10147673923300009137Grasslands SoilMPSRAVVGGMDRKAEEEPIVELSATTTTPRDARPADAQQARDLRDTP*
Ga0126374_1033846923300009792Tropical Forest SoilMDRKAEEETMVELSATTTTPRAARPAAAQQAGDLRDTP*
Ga0126374_1048235223300009792Tropical Forest SoilMPSRAVAGGMDRKAEEETIVELSATTTTPRDARPADAQQAGDPREMP*
Ga0126374_1051436123300009792Tropical Forest SoilMKGMGRRAGDRKAQEETMVELSATTTTPRDARPADAQQAGDLRDLA*
Ga0126374_1055958723300009792Tropical Forest SoilMPSRAVADGMDRKAEEELIVELSAMTATPRDARPADAQQAGDLRDTA*
Ga0126374_1112659823300009792Tropical Forest SoilMPSRAIAGGMDRKAEKELMVELSATTTTPRDARPADAQQAGDPRGMA*
Ga0126380_1009342123300010043Tropical Forest SoilMGRRAGDRKAEEETMVELSATTTTPRDARPAVAQQAGDLRDMA*
Ga0126380_1024956313300010043Tropical Forest SoilGGMDRKAEEETMVELSATTATPRDARPAGAQQAEDLRDMA*
Ga0126380_1047494623300010043Tropical Forest SoilMPSRAVAGGMDRKAEEELMVELSATTTTPRDARPAGAQQAGDLRDMA*
Ga0126384_1042944013300010046Tropical Forest SoilRKAEEEPIAELLATTTTPRGARAADAQQAGDLRDMP*
Ga0126382_1124706723300010047Tropical Forest SoilMPSRAAVGGIDRKAEEETIVELPATTTTRRDARPADAQQAGDLRDT
Ga0126382_1133829113300010047Tropical Forest SoilRSMPSRAAAGGMDRKAEEETIVELSATTTTPRDARPVDAQQAGDLRDTG*
Ga0126382_1231409113300010047Tropical Forest SoilMGRRVGDRKAEEEMIVELSATTATPRDARPADAQQA
Ga0126373_1014473343300010048Tropical Forest SoilAAAGGMDRKAEEEPIVGLWATTTTQRGARPVDAQQAGGLRGTP*
Ga0126373_1074310313300010048Tropical Forest SoilMPSRAVAGGMDRKAEEETIVELSATTTTPRDARPAAAQQAGDLRDMA*
Ga0126373_1129287713300010048Tropical Forest SoilAAGGMDRKAEEEPIVGLWATTTTQRGARPVDAQQAGGLRDTP*
Ga0126373_1167941213300010048Tropical Forest SoilAAGGMDRKAEEEPIVGLWATTTTQRGARPVDAQQAGGLRDMP*
Ga0126373_1261738013300010048Tropical Forest SoilSWPSRAAAGGMDRKAEEETIVELSATTTTPRDPRPVDAQQAQDLQEMP*
Ga0126373_1286452813300010048Tropical Forest SoilMDRKAEEEPIVELSATTTTPRDARPADAQQARDLRDTP*
Ga0126370_1011462813300010358Tropical Forest SoilMPSRAVAGGMDRKAEEETIVELSATATTPRDARPAAAQQAGDLRDMA*
Ga0126370_1027859113300010358Tropical Forest SoilGMDRKAEEETIVELSATTTTPRDARPAGAQQAGDLRDTA*
Ga0126370_1039896013300010358Tropical Forest SoilVSRRSMPSRAVAGGMDRKAEEETIVELSATTTTPRDTRPADAQQAGDLRDMA*
Ga0126370_1206659423300010358Tropical Forest SoilGDRKAEEEPIVGLWATTTTQRGARPVVAQQAGGLRDTP*
Ga0126376_1120798913300010359Tropical Forest SoilPSRAIAGGMDRKAEEETMVELSATTATPRDARPAGAQQAEDLRDMA*
Ga0126372_1002933543300010360Tropical Forest SoilMRSRAVAGGMDRKAEEEPIVELSATTTTPRAARPADAQQAGDL*
Ga0126372_1011935123300010360Tropical Forest SoilMPSRAVAGGMDRKAEEEAIVELSATTTTPRDARPAAAQQAGDLRDMA*
Ga0126372_1030286523300010360Tropical Forest SoilDGMDRKAEEELIVELSAMMATPRDARPADAQQAGDLRDTA*
Ga0126372_1034051723300010360Tropical Forest SoilMDRKAEEETIVELSATTTTPRDARPAAAQQAEDLQDMP*
Ga0126372_1047032523300010360Tropical Forest SoilAAGGMDRKAEEETIVELSATTTTPRDARPVDAQQAGDPRDMP*
Ga0126372_1100992223300010360Tropical Forest SoilMDRKAEEELIVELSAITTTPRDARPADAQQAGDLRDTA*
Ga0126372_1153681013300010360Tropical Forest SoilRVGDRKAEEEPIVGLWATTTTQRGARPVDAQQAGGLRDTP*
Ga0126372_1289591513300010360Tropical Forest SoilAEEETIVGLSATTATPRDARPAAAQQAGDLQDMA*
Ga0126372_1306338713300010360Tropical Forest SoilMPSRAVAGGMDRKAEEEPIVELSATTTTPRGARPADAQ
Ga0126378_1010670913300010361Tropical Forest SoilGLGRRVGDRKAEEEPIAELLATTTTQRGARPVDAQQARGLRDAP*
Ga0126378_1019391043300010361Tropical Forest SoilGMDRKAEEEPIVGLWATTTTQRGARPVDAQQAGGLRDTP*
Ga0126378_1032433343300010361Tropical Forest SoilMDRKAEEEEETSVELLAATATPRAARPAVAQQARDLRDMA*
Ga0126378_1150224023300010361Tropical Forest SoilMPSRAVAGGMDRKAEEELIVELSATTTTPRDARPADAQQAEDPRDTA*
Ga0126378_1212410023300010361Tropical Forest SoilAGGMDRKAEEEPIAELLATTTTQRGARPVDAQQARDLRDMP*
Ga0126378_1223746223300010361Tropical Forest SoilLRAVAGGMDRKAEEEPIVELSATTTTPRDARPAAAQQAEDLWDTP*
Ga0126377_1130594113300010362Tropical Forest SoilGGMDRKAEEEPIAELLATTTTPRGARPVDAQQAGDLRDMP*
Ga0126377_1271004813300010362Tropical Forest SoilMPSRAVAMKGMGRRAGDRKAQEETMVELSATTTTPRDARPADAQQAGDLRDLA*
Ga0126379_1039833233300010366Tropical Forest SoilVSRRSMPSRAVAGGMDRKAEEEPIVELSATTTTPRDARPADAQQARDLRDMP*
Ga0126379_1216294113300010366Tropical Forest SoilMPSRAVAGGMDRKAEEETIVELSATTTTPRDARPADAQQAGD
Ga0126379_1216506023300010366Tropical Forest SoilMPSRAAAGGMDRKAEEELIAELWATTTTLRAARPVDAQQAG*
Ga0126381_10014044923300010376Tropical Forest SoilMPSRAVAGGMDRKAEKELIVELSATTTTPRDARPADAQQAEDPRDTA*
Ga0126383_1108899213300010398Tropical Forest SoilIARRRRKPIVELSATTTTPRDARPAAAQQAGDPRGIP*
Ga0126383_1206753613300010398Tropical Forest SoilGMDRKAEEETIVELSATTTTPRDARPADAQQAGDLRDMA*
Ga0137393_1088984433300011271Vadose Zone SoilGGMDRKAEEEPIAELLATTTTPRGARPAAAQQAG*
Ga0137364_1017377313300012198Vadose Zone SoilAGGMDRQAEEEPIVELSATTATPRDARPAGAQRAGDLRDMA*
Ga0137364_1097435023300012198Vadose Zone SoilMPSRAVAGAMERKAEEEPIVEVSATTATPRDARPAGAQQAGDLQDIAQSQPTGTEG
Ga0137383_1084997623300012199Vadose Zone SoilMPSRAVAVKGDGEAGGDRKTEEETIVELPATTTIPRDDRPAAAQQAGDLRDMA*
Ga0137382_1002127453300012200Vadose Zone SoilMDGKAEEETIAELSATTATPRAARPAVAQQARDLRDMA*
Ga0137365_1004821623300012201Vadose Zone SoilMDRKTEEETIVELSAATTTPRDDRPAAAQQAGDLRDMA*
Ga0137381_1117931913300012207Vadose Zone SoilMDRKAEEELIVEISATTTTPRAARPAAAQQAGDLRGM
Ga0137378_1020580313300012210Vadose Zone SoilLPSRAAAGGMARKAEEEPIVVLWATTTTQRGARPADAQQAE
Ga0137370_1024414323300012285Vadose Zone SoilCRSMPSRAVAGGMDRKAEEETIVELSATTTTPRDARPADAQQAGDLQDMA*
Ga0137387_1049615323300012349Vadose Zone SoilMDRKAEEEPIVELSATDDNAARRPAADAQQAGDP*
Ga0137371_1027227923300012356Vadose Zone SoilMDRKAEEETIVELSATTATPRAARPAAAQQARDLRGMA*
Ga0137371_1126332413300012356Vadose Zone SoilMPSRAVADGMDRKAEEAIVELSATTATLRDARPAGAQQAGDLRDMA*
Ga0137371_1144595013300012356Vadose Zone SoilAAAGGMARKAEEEPIVVLWATTTTQRGARPADAQQAE*
Ga0137385_1116879623300012359Vadose Zone SoilAAGGMARKAEEEPIVVLWATTTTQRGARPADAQQAE*
Ga0126375_1039174613300012948Tropical Forest SoilKAEEEPIVELSATRTTPRDARPAVAQQAGDLPGMA*
Ga0126369_1046128813300012971Tropical Forest SoilAVAGGMDRKAEEEPIVELSATTTTPRDARPADAQQARDLWDMP*
Ga0126369_1103513023300012971Tropical Forest SoilAGGMDRKAEEETIVELSATTTTPRDARPADAQQAGDLRDMA*
Ga0126369_1171890523300012971Tropical Forest SoilMDRNAEEETMVELSATTTTPRDARPAGAQQAGDLGDMA*
Ga0126369_1196481023300012971Tropical Forest SoilMDRKAEEETMGELSATRTTLRAARPAVTQQARDLRDMA
Ga0134110_1045745423300012975Grasslands SoilMPSRAAAGGMDRKAEEEPIVELSATDDNAARRPAADAQQAGDP*
Ga0132258_1084040423300015371Arabidopsis RhizosphereMDRKAEEELIAELWVTTTTPRAARPADAQQAKDLRDTP*
Ga0132258_1097492713300015371Arabidopsis RhizosphereRKAEEEPIAELLATTTTPRGARPADAQQAGDLRDMP*
Ga0182036_1121074523300016270SoilVGDRKAEEEPIAELWATTTTKRGARPADAQQARDL
Ga0182033_1057281913300016319SoilERLSGGMDRKAEEEPIAELWATTTTPRAARPAVARQAE
Ga0182033_1177698623300016319SoilRAAVGGMDRKAEEEPIAELLATTTTQRDARPADAQQAGDLRDMA
Ga0182035_1131829533300016341SoilGGMDRKAEEEPIAELLATTTTPRGARPADAQQAGDLRDTP
Ga0182035_1217182613300016341SoilMGRWVGDRKAEEEPIAELLATTTTPRGARPADAQQAGDLR
Ga0182032_1015496113300016357SoilSRAVAGGMDRKAEEEFIAELWATTTTPRGARPADAQEARDLRDQDS
Ga0182032_1073980613300016357SoilRSLPSRAVAGGMDRKAEEEFIAELWATTTTPRGARPADAQQARDLRDTP
Ga0182037_1034340613300016404SoilRKAEEEFIAELWATTTTPRGARPADAQQARDLRDTL
Ga0182039_1063219013300016422SoilRKAEEEMIAELSATTTTPRDARPVAAQQAGDPRGMP
Ga0182039_1208874413300016422SoilMDRKAEEEPIAELLATTTTPRGARPADAQQAEDLRDTP
Ga0182038_1215726513300016445SoilAVAGGMDRKAEEETIVELSATTTTPRDVRPAAAQQAGDLRDMA
Ga0187775_1015215013300017939Tropical PeatlandAVAGGMDRKAEEETIVELSATTTTPRDARPADAQQAEDLRDMP
Ga0187775_1017081713300017939Tropical PeatlandMPSRAVADGMDRKAEEETIVELSATTTTPRDARPADAQQAG
Ga0187785_1067731923300017947Tropical PeatlandMDRKAEEEPIVELSATTTTPRDARPADAQQAEDLRETP
Ga0187785_1069782213300017947Tropical PeatlandMPSRAVAGGMDRKAEEETIVELSATTTTPRDARPAAAQQ
Ga0187776_1042157213300017966Tropical PeatlandAGGMDRKAEEEPIVELSATTTTPRDARPADAQQAGDLGDMA
Ga0187776_1074336923300017966Tropical PeatlandMPSRAVAGGMDRKAEEETIVELSATTTTPRDARPADA
Ga0187776_1079534823300017966Tropical PeatlandKAEEEPIVELSATTTTPRDARPADAQQAGDLRGMA
Ga0187776_1131365613300017966Tropical PeatlandGMDRKAEEETIVELSATTTTPRDARPADAQQAGDLRDMA
Ga0187776_1140697313300017966Tropical PeatlandMPSRAGAGGMDRKAEEEPIVELSATRTTPRDARPADAQ
Ga0187780_1003537353300017973Tropical PeatlandMDREAEEETIVELSATTTTPRDARLADAQQAEDLRDMP
Ga0187767_1006141933300017999Tropical PeatlandPSRAGAGGMDRKAEEEPIVELSATTTTPRAARPAVAQQARDLRDMA
Ga0187788_1007584113300018032Tropical PeatlandMPSRAVAGGMDRKAEEETIVELSATTTTPRDARPADAQQA
Ga0187788_1014171133300018032Tropical PeatlandMDRKAEEETIVELSATTTTPRDARPADAQQAGIYEAWPKS
Ga0187766_1013874913300018058Tropical PeatlandMPSRAVAGGMDRKAEEEPIVELSATTTTQRDARPAAAQQAEDLQDMP
Ga0187765_10000537113300018060Tropical PeatlandMDRKAEEETIVELSATTTTPRDARPADAQQAEDLRGMP
Ga0187765_1003699613300018060Tropical PeatlandMGRRVGDRKAAEEETMVELPATTTTPRDARQAAAQQ
Ga0187765_1009166333300018060Tropical PeatlandMPSRAVAGGMDRKAEEEPIVELSATTTTPRDARPAD
Ga0187765_1012742033300018060Tropical PeatlandMDRKAEEEPIVELSATTTTPRAARPAVAQQARDLRD
Ga0187765_1018676123300018060Tropical PeatlandMDRKAEEETIVELSAATAMQRDARPAAAQQAEDLQDMP
Ga0187765_1056568223300018060Tropical PeatlandMPSRAVAGGMDRKAEEETIVELSATTTTQRDARPADAQQAGDL
Ga0187765_1125319923300018060Tropical PeatlandMDRKAEEELIVELSATTTTRRDARPAYAQQAGDLGDMA
Ga0187773_1002125323300018064Tropical PeatlandMDRKAEEELMVELSAAATTPRAARPAVAQQARDLRDMA
Ga0187773_1003891743300018064Tropical PeatlandMPSRAADGGMDRKAEEELIVELSATTTTPRAARPAAA
Ga0187773_1004480523300018064Tropical PeatlandMDRKAEKETIVELSATTTTPRDARPVAAQQAEDLREMP
Ga0187773_1010533223300018064Tropical PeatlandMPSRAVAGGMDRKAEEETIVELSATTTTPRDARPADAQQAG
Ga0187773_1037490623300018064Tropical PeatlandRSMPSRAGAGGMDRKAEEELIVELSAAAATPRDARPADAQQAGDLGDMA
Ga0187773_1052768013300018064Tropical PeatlandMPSRAAVGGMDRKAEEETIVELSATTTTPRDARPADAQQAGDLRDMA
Ga0187773_1060372713300018064Tropical PeatlandVAGGMDRKAEEEPIVELSATRTTPRDARPADAQQAGDLGDMA
Ga0187773_1081514413300018064Tropical PeatlandMGRRVGDRKAEEETIVELSAATATPRDARPADAQQAGDLRDMA
Ga0187773_1084186723300018064Tropical PeatlandVAGGMDRKAEEETIVELSATTTTPRDARPADAQQAEDLRDMP
Ga0187774_1008584033300018089Tropical PeatlandVGDRKAEEEPIVELSATTTTPRDARPAGAQQAGDLRDMA
Ga0187774_1028160213300018089Tropical PeatlandKAEEEPIVELSATRTTPRDARPADAQQAGDLGDTA
Ga0187774_1049713523300018089Tropical PeatlandMDRKAEEELIVELSAAAATPRDARPADAQQAGDLGDMA
Ga0187774_1102975523300018089Tropical PeatlandRAVAGGMDRKAEEETIVELSATTATPRDARPADAQQAGDLGDTA
Ga0190270_1201650223300018469SoilMVDRKAEEESIAVELSATTTTQRGAVLVVAQQIGGLGDTP
Ga0190267_1018996413300019767SoilMVDRKAEEEPTAELSATTTTRRDAVLASAQQAGDPGDTR
Ga0126371_1034896523300021560Tropical Forest SoilMPSRAAAGGMDRKAEEELIAELWATTTTLRAARPVDAQQAG
Ga0126371_1039851313300021560Tropical Forest SoilAAAGGMDRKAEEETIVELSATTTTPRDARPADAQQAGDLRDMA
Ga0126371_1330652613300021560Tropical Forest SoilDRKAEEEPIVELSATTTTPRDARPADAQQAEDLRDMP
Ga0126371_1375387123300021560Tropical Forest SoilAGGMYRKAEEEPIVELSAATTTPRDARPADAQQARDLWDMP
Ga0207700_1025853313300025928Corn, Switchgrass And Miscanthus RhizosphereMGRRVGDRKAEEEFIAELWATTTTQRAARPAAAQQAE
Ga0207664_1052750413300025929Agricultural SoilVGDRKAEEEPIAELLATTTTQRGARPGDAQQARGLRDTP
Ga0208761_102709823300026995SoilMGRWVGDRKAEEETIVELSATTTTPRDARPADAQQAGDLRDTA
Ga0208890_100608413300027523SoilKAEEEPIVELSATTTTPRGARPAAAQQAGDLRDTPWS
Ga0209466_101459013300027646Tropical Forest SoilRRRRQRRHRKAEEGLMVELSATAATPRETRPAAAQQAEDRQDMP
Ga0209073_1029286713300027765Agricultural SoilQSRAGAGGMDRKAEEETIVELSATTTTPRDARPADAQQAEDLLDMP
Ga0318516_1001283913300031543SoilRKAEEEPIAELWATTTTPRGARPADAQQARDLRDTP
Ga0318534_1018872133300031544SoilMDRKAEEEFIAELWATTTTPRGARPADAQQARDLRDTPEGA
Ga0318534_1024237613300031544SoilGGMDRKAEEEPIAELLATTTTPRGARPADAQQARDLRDMP
Ga0318534_1060372013300031544SoilDRKAEEELIAELWATTTTPRGARPADAQQARDLRDMP
Ga0318538_1001522953300031546SoilMGRKAEEEPIVELSATTTTPRNAPPVDAQQAEDLRDTP
Ga0318538_1005942033300031546SoilGMDRKAEEEPIAELLATTTTPRGARPADAQQAEDLRDTP
Ga0318538_1013076623300031546SoilMPSRAVAGGMDRKAEEETIVELSATTTTPRDARPVDAQQAGDL
Ga0318538_1044027923300031546SoilMDRKAEEEPIAELLATTTTPRGARPADAQQAEDLRDTPLGNPDQES
Ga0318571_1025335723300031549SoilMGREAEEEPIVELSATTTTPRNTPPVDAQQAEDLRDTP
Ga0318515_1028454823300031572SoilMGDRKAEEELIAELWATTTTPRGARPADAQQARDLRDMP
Ga0310915_1023088433300031573SoilMDRKAEEEPIAELLATTTTPRGARPADAQQAGDLRDTP
Ga0310915_1044365713300031573SoilKAVEEPIAELLATTTTPRGARPADAQQAGDLRDTP
Ga0318555_1023012113300031640SoilMDRKAEEEPIAELLATTTTPRGARPADAQQAEDLRD
Ga0318542_1017626723300031668SoilVGDRKAEEEPIAELLATTTTPRGARPADAQQAGDLRDTP
Ga0318572_1089064723300031681SoilDRKAEEEPIAELLATTTTPRGARPADAQQAGDLRDTP
Ga0318496_1011387713300031713SoilMPSRAAAGGMDRKAAEEPIAELLATTTTQRGARPVDAQQAR
Ga0318496_1013385313300031713SoilDRKAEEEFIAELWATTTTPRGARPADAQQARDLRDTP
Ga0318496_1028595323300031713SoilRRSLPSRAAVGGMDRKAEEEPIAELLATTTTQRGARPTNAQQARDLRDMP
Ga0306917_1036021513300031719SoilKAEEEPIAELLATTTTPRGARPADAQQARDLRDMP
Ga0306917_1082009723300031719SoilKAEEEPIVELSATTTTPRNAPPVDAQQAEDLRDTP
Ga0307469_1006452933300031720Hardwood Forest SoilMDRKAEEETIVELSATTTTPRDARPADAQQAGDLRDMA
Ga0318493_1014607023300031723SoilMPSRAVAGGMDRKAEEETIVELSATTTTPRDARPAAAQQAGDLRDMA
Ga0318500_1007455733300031724SoilMDRKAEEEFIAELWATTTTPRGARPADAQQARDLRAAR
Ga0318500_1008294813300031724SoilMDRKAEEEFIAELWATTTTPRGARPADAQQARDLRDTL
Ga0318500_1015490713300031724SoilRAVAGGMDRKAEEEFIAELWATTTTPRGARPADAQQARDLRDAP
Ga0318500_1034964813300031724SoilMDRKAEEEFIAELWATTTTPRGARPADAQQARDLRDTP
Ga0318501_1017271413300031736SoilLTLVSRRSLPSRAVAGGMDRKAEEEFIAELWATTTTPRGARPADAQQARDLRDTP
Ga0306918_1017320613300031744SoilMHRKAEEETMAELLATTTTPRGARPADAQQARDLRDTP
Ga0318502_1035117213300031747SoilRVDRKAEEELIAELWATTTTPRGARPADAQQARDLRDMP
Ga0318492_1008518633300031748SoilKAEEKPIVELSATTTTPRNAPPVDAQQAEDLRDTP
Ga0318492_1030846223300031748SoilRKAEEEFIAELWATTTTPRGARPADAQQARDLRDTP
Ga0318554_1021738413300031765SoilGKGRRVGDRKAEEEFIAELLATTTTPRGARPADAQQARDLRDMP
Ga0318509_1010271513300031768SoilAAAGGMHRKAEEETMAELLATTTTPRGARPADAQQARDLRDMP
Ga0318526_1024749613300031769SoilGRKAEEKPIVELSATTTTPRNAPPVDAQQAEDLRDTP
Ga0318526_1029484813300031769SoilGPQGGEEPIVELSATTTTPRNAPPVDAQQAEDLRDTP
Ga0318546_1072322423300031771SoilMAEEEPIVELSATTTTPRNAPPVDAQQAEDLRDTP
Ga0318543_1041937513300031777SoilMPSRSAAGGMHRKAEEEPIAELLATTTTQRGARPVDAQQAE
Ga0318498_1000995013300031778SoilGEEEEPIAELLATTTTPRGARPADAQQARDLRDMP
Ga0318498_1007303113300031778SoilVAGGMDRKAEEEFIAELWATTTTPRGARPADAQQARDLRDTP
Ga0318566_1013434723300031779SoilVVGGMDRKAEEERMAEPWATTTTPRGARPADAQQAGDLRGMP
Ga0318547_1010219413300031781SoilGMDRKTEEEFIAELWATTTTPRGARPADAQQARDLRDTP
Ga0318548_1047677123300031793SoilMGRRVGDRKAEEEFIAELWATTTTPRGARPADAQQARD
Ga0318503_1003665313300031794SoilPSRAAVGGMDRKAEEEPIAELLATTTTQRDARPADAQQAGDLRDMA
Ga0318557_1026699913300031795SoilRSLPSRAVAGGMDRKAEEEFIAKLWATTTTPRGARPADAQQARDLRDTP
Ga0318550_1013761713300031797SoilMDRKAEEEPIVELSATRTTLRAARPAAAQQARDLRD
Ga0318523_1035036913300031798SoilRKAEEEPIAELLATTTTPRGARPADAQQAGDLRDTP
Ga0318564_1001395543300031831SoilSGGMGRKAEEEPIVELSATTTTPRNAPPVDAQQAEDLRDTP
Ga0318564_1002057913300031831SoilAGGMDRKAEEEPIAELLATTTTPRGARPAGAQQAGDLRDMP
Ga0318564_1037575313300031831SoilRKAEEEPIVELSATTTTPRDARPAAAQQAGDLRDTA
Ga0318512_1008998413300031846SoilVGDRKAEEEFIAELWATTTTPRGARPADAQQARDLRDTP
Ga0306919_1015019413300031879SoilSRRSWPSRAAAGGMDRKAEEEPIAELLATTTTPRGARPADAQQAGDLRDTP
Ga0306919_1057248623300031879SoilDRKAEEEPIAELWATTTTKRGARPADAQQARDLRGMP
Ga0306925_1006264313300031890SoilAVAGGMDRKAEEEFIAELWATTTTPRGARPADAQQARDLRDTP
Ga0306925_1026029013300031890SoilKAEEEPIVELSATTTTPRNAPPVDAQQAKDLRDTP
Ga0306925_1080543013300031890SoilKAEEEFIAELWATTTTPRGARPADAQQARDLRDTP
Ga0306925_1081643923300031890SoilAVAGGMDRKAEEEFIAELWATTTTPRGARPADAQQARDLRDTL
Ga0318536_1014759713300031893SoilAAAGGMDRKAEEEPIAELLATTTTPRGARPADAQQAGDLRDMP
Ga0318536_1023032423300031893SoilRKAEEEPIAELLATTTTPRGARPADAQQARDLRDMP
Ga0318551_1063643223300031896SoilAAAGGMDRKAEEEPIVVLWATTTTQRGARPVDAQQAE
Ga0306923_1011710023300031910SoilMGRKAEEKPIVELSATTTTPRNAPPVDAQQAEDLRDTP
Ga0306921_1028611813300031912SoilAAAGGMDRKAEEEPIAELLATTTTPRGARPADAQQAEDLRDTP
Ga0310912_1021489423300031941SoilGMDRKAEEEPIAELLATTTTPRGARPADAQQARDLRDMP
Ga0310913_1008515513300031945SoilGVGGMDRKAEEEPIAELLATTTTPRGARPADAQQAGDLRETP
Ga0310913_1017426123300031945SoilRKAEEEFIAELWATTTTPRGARPADAQQARDLRDAP
Ga0310913_1031426013300031945SoilAGGMDRKTEEEFIAELWATTTTPRGARPADAQQARDLRDTP
Ga0310913_1049249013300031945SoilKAEEEPIAELLATTTTPRGARPADAQQAGDLRDMP
Ga0310910_1051640023300031946SoilAGGMDRKAEEEPIAELLATTTTPRGARPADAQQAGDLRDTP
Ga0310910_1107219823300031946SoilRLPREGVSHRSMPSRAAAGGMHRKAEEEPTAELLATTTTQRGARPAAAQQAE
Ga0310909_1103070813300031947SoilGGMDRKAEEEFIAELWATTTTPRGARPADAQQARDLRDTP
Ga0310909_1164388923300031947SoilMGRRVGDRKAEEEFIAELLATTTTPRGARPADAQQARD
Ga0318530_1039224813300031959SoilSRGSMPSRAAVGGMDRKAEEEPIAELLATTTTQRDARPADAQQAGDLRDMA
Ga0306922_1178598923300032001SoilVGDRKAEEEPIAELLATTTTPRGARPADAQQARDLRDMP
Ga0318562_1006870313300032008SoilDRKVEEEPIAELLATTTTPRGARPADAQQAEDLRDTP
Ga0318563_1075782433300032009SoilQAEEEFIAELWATTTTPRGARPADAQQARDLRDTP
Ga0318569_1005176043300032010SoilVADGMDRKAEEEFIAELWATTTTPRGARPADAQQARDLRDTP
Ga0318569_1013686013300032010SoilVMSRGSMPSRAAVGGMDRKAEEEPIAELLATTTTQRDARPADAQQAGDLRDMA
Ga0318569_1014675513300032010SoilGRKAEEEPIVELSATTTTPRNAPPVDAQQAEDLRDTP
Ga0318569_1027016213300032010SoilRKAEEELIAELWATTTTPRGARPADAQQARDLRDMP
Ga0310911_1020984713300032035SoilDRKGEEEPIAELLATTTTPRGARPADAQQARDLRDMP
Ga0310911_1090394923300032035SoilKAEEEPIAELLATTTTPRGARPADAQQAGDLRDTP
Ga0318559_1011295613300032039SoilMDRKAEEEPIAELLATTTTPRGARPADAQQAGELRD
Ga0318559_1046336723300032039SoilMPSRAVAGGMDRKAEEETIVELSATTTTPRDVRPAAAQQAGDLRDMA
Ga0318559_1059110023300032039SoilGMDRKAEEEPIAELLATTTTPRGARPADAQQAGDLRDTP
Ga0318549_1045554513300032041SoilMPSRAVAGGMDRKAEEETIVELSATTTTPRDARPAGAQQAGDLRDMAYAAPCSRR
Ga0318556_1004335033300032043SoilGMGRKAEEEPIVELSATTTTPRNAPPVDAQQAEDLRDTP
Ga0318558_1018514533300032044SoilGDRKAEEEPIAELWATTTTKRGARPADAQQARDLRGMP
Ga0318558_1051739213300032044SoilRLSGGMDRKAEEELIAELWATTTTQRAARPAVAQQAE
Ga0318506_1006729813300032052SoilGGMDRKAEEEPIAELLATTTTPRGARPAGAQQAGDLRDTP
Ga0318510_1011249323300032064SoilMGRKAEEEPIVELSATTTTPRNAPPVDAQQAKDLRDTP
Ga0318510_1015123223300032064SoilDRTAVEEPIAELLATTTTPRGARPADAQQAGDLRDTP
Ga0318510_1027059623300032064SoilDRTAEEEPIAELLATTTTPRGARPADAQQAGDLRDTP
Ga0318513_1001613113300032065SoilSEGMGRKAEEEPIVELSATTTTPRNAPPVDAQQAEDLRDTP
Ga0318524_1022155923300032067SoilGMGRWVGDRKAEEEPIAELLATTTTPRGARPADAQQAGDLRDTP
Ga0318524_1049617313300032067SoilMDRKAEEEPIAELRVTTTTPRGARPVDAQQAGDLRDTPYRRGSLA
Ga0318524_1069410213300032067SoilMGRRVGDRKAEEEPMAELLATTTTPRGARPADAQQARDLRDM
Ga0306924_1091158013300032076SoilMGRRVGDRKAEEEFIAELLATTTTPRGARPADAQQAR
Ga0318518_1061979913300032090SoilVGDRKAEEEPIAELWATTTTKRGARPADAQQARDLRGMP
Ga0307472_10257402023300032205Hardwood Forest SoilAGAGGMDRKAEEEPIAELWATTTTPRGARPVDAQQAG
Ga0335082_1025562023300032782SoilMPSRAVGGGMDRKAEEELIVELSATTTTPRAARPAVA
Ga0335079_1004858233300032783SoilMPSRAVAGGMDRKAEKEPIVELSATTATPRDARPTAAQQARDLYGMA
Ga0335079_1148224413300032783SoilRAAASGMDREAEEETIVELSATTTTPRDARLADAQQAEDLRDMP
Ga0335080_1050392323300032828SoilMKGKGRRVGYRKAEEETIVELSATTTTPRDARPAAAQQAGDLRDTA
Ga0335080_1102454523300032828SoilMPSRAVVGGMDRKAEEELIVELSATTTTQRDARPAAAQQA
Ga0335080_1105108613300032828SoilMGRRVGDREAEEELIVVELSATTATRRDARPAYAQQAGDLGDMA
Ga0335080_1140948313300032828SoilMDRKAEEEPIVELSATTTTPRDARPADAQQAGIYEAWPK
Ga0335080_1155673813300032828SoilGKGRRVGDRKAEEETIVELSATTATQRHARPGAAQQAEDLQDMA
Ga0335076_1036934743300032955SoilMDRVAEEETIVELSATTTPRDPRPADAQQAEDPRDMPQ
Ga0335076_1079409013300032955SoilKAEEEPVVELSATRTTPRDARPADAQQAEDPRDTP
Ga0335076_1126799213300032955SoilKAEEETIVELSATTTTPRDARPVAAQQAEDPRDMP
Ga0335084_1050668013300033004SoilMDRKAEEQPTVELSATTTLPRGTRPVAVQQAGDLPDT
Ga0335077_1024042213300033158SoilDRKAEEETIVELSAATTMQRAARPAVAQQARDLRDMA
Ga0335077_1075091613300033158SoilMDREAEEETIVELSATTTTPRDARPADEQQAEDLRDMP
Ga0318519_1019137613300033290SoilWVGDRKAEEEPIAELLATTTTPRGARPADAQQARDLRDMP
Ga0314864_0040561_496_6363300033805PeatlandMKGDGRRAGDRKAEEETIVELSATTTTPRDARPAAAQQAEDLWDAP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.