| Basic Information | |
|---|---|
| Family ID | F011809 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 287 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MDRKAEEEPIVELSATTTTPRDARPADAQQARDLRDTP |
| Number of Associated Samples | 150 |
| Number of Associated Scaffolds | 287 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 32.75 % |
| % of genes near scaffold ends (potentially truncated) | 75.26 % |
| % of genes from short scaffolds (< 2000 bps) | 89.20 % |
| Associated GOLD sequencing projects | 143 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.474 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (29.268 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.631 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.704 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.15% β-sheet: 0.00% Coil/Unstructured: 84.85% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 287 Family Scaffolds |
|---|---|---|
| PF00196 | GerE | 2.44 |
| PF01636 | APH | 2.09 |
| PF03061 | 4HBT | 2.09 |
| PF14559 | TPR_19 | 1.74 |
| PF12900 | Pyridox_ox_2 | 1.74 |
| PF00296 | Bac_luciferase | 1.74 |
| PF02374 | ArsA_ATPase | 1.39 |
| PF02518 | HATPase_c | 1.39 |
| PF00557 | Peptidase_M24 | 1.39 |
| PF02735 | Ku | 1.39 |
| PF01569 | PAP2 | 1.05 |
| PF00155 | Aminotran_1_2 | 1.05 |
| PF00580 | UvrD-helicase | 1.05 |
| PF01145 | Band_7 | 1.05 |
| PF02652 | Lactate_perm | 1.05 |
| PF08669 | GCV_T_C | 1.05 |
| PF11774 | Lsr2 | 1.05 |
| PF00106 | adh_short | 1.05 |
| PF04978 | DUF664 | 1.05 |
| PF01578 | Cytochrom_C_asm | 1.05 |
| PF00920 | ILVD_EDD | 1.05 |
| PF07728 | AAA_5 | 0.70 |
| PF02771 | Acyl-CoA_dh_N | 0.70 |
| PF00067 | p450 | 0.70 |
| PF00144 | Beta-lactamase | 0.70 |
| PF03861 | ANTAR | 0.70 |
| PF09663 | Amido_AtzD_TrzD | 0.70 |
| PF00037 | Fer4 | 0.70 |
| PF13374 | TPR_10 | 0.70 |
| PF13193 | AMP-binding_C | 0.70 |
| PF01557 | FAA_hydrolase | 0.70 |
| PF00702 | Hydrolase | 0.70 |
| PF00027 | cNMP_binding | 0.70 |
| PF12697 | Abhydrolase_6 | 0.70 |
| PF02769 | AIRS_C | 0.70 |
| PF01614 | IclR | 0.70 |
| PF00440 | TetR_N | 0.70 |
| PF00463 | ICL | 0.70 |
| PF00455 | DeoRC | 0.70 |
| PF00753 | Lactamase_B | 0.70 |
| PF03729 | DUF308 | 0.70 |
| PF14681 | UPRTase | 0.70 |
| PF00403 | HMA | 0.70 |
| PF01182 | Glucosamine_iso | 0.70 |
| PF03466 | LysR_substrate | 0.70 |
| PF01493 | GXGXG | 0.35 |
| PF13561 | adh_short_C2 | 0.35 |
| PF06224 | HTH_42 | 0.35 |
| PF01979 | Amidohydro_1 | 0.35 |
| PF00682 | HMGL-like | 0.35 |
| PF12680 | SnoaL_2 | 0.35 |
| PF01019 | G_glu_transpept | 0.35 |
| PF13472 | Lipase_GDSL_2 | 0.35 |
| PF13602 | ADH_zinc_N_2 | 0.35 |
| PF00578 | AhpC-TSA | 0.35 |
| PF01209 | Ubie_methyltran | 0.35 |
| PF01938 | TRAM | 0.35 |
| PF00118 | Cpn60_TCP1 | 0.35 |
| PF09107 | SelB-wing_3 | 0.35 |
| PF05762 | VWA_CoxE | 0.35 |
| PF01717 | Meth_synt_2 | 0.35 |
| PF00005 | ABC_tran | 0.35 |
| PF00128 | Alpha-amylase | 0.35 |
| PF01012 | ETF | 0.35 |
| PF12681 | Glyoxalase_2 | 0.35 |
| PF01872 | RibD_C | 0.35 |
| PF08241 | Methyltransf_11 | 0.35 |
| PF00441 | Acyl-CoA_dh_1 | 0.35 |
| PF02739 | 5_3_exonuc_N | 0.35 |
| PF00561 | Abhydrolase_1 | 0.35 |
| PF01121 | CoaE | 0.35 |
| PF14016 | DUF4232 | 0.35 |
| PF00162 | PGK | 0.35 |
| PF08281 | Sigma70_r4_2 | 0.35 |
| PF00491 | Arginase | 0.35 |
| PF02397 | Bac_transf | 0.35 |
| PF13302 | Acetyltransf_3 | 0.35 |
| PF02190 | LON_substr_bdg | 0.35 |
| PF01799 | Fer2_2 | 0.35 |
| PF04679 | DNA_ligase_A_C | 0.35 |
| PF09924 | LPG_synthase_C | 0.35 |
| PF00072 | Response_reg | 0.35 |
| PF13191 | AAA_16 | 0.35 |
| PF02211 | NHase_beta | 0.35 |
| PF01794 | Ferric_reduct | 0.35 |
| PF13458 | Peripla_BP_6 | 0.35 |
| PF12627 | PolyA_pol_RNAbd | 0.35 |
| PF00293 | NUDIX | 0.35 |
| PF00962 | A_deaminase | 0.35 |
| PF00275 | EPSP_synthase | 0.35 |
| PF16363 | GDP_Man_Dehyd | 0.35 |
| PF00486 | Trans_reg_C | 0.35 |
| PF09900 | DUF2127 | 0.35 |
| PF07045 | DUF1330 | 0.35 |
| PF13396 | PLDc_N | 0.35 |
| PF10094 | DUF2332 | 0.35 |
| PF05088 | Bac_GDH | 0.35 |
| PF12728 | HTH_17 | 0.35 |
| PF13401 | AAA_22 | 0.35 |
| PF06781 | CrgA | 0.35 |
| PF02934 | GatB_N | 0.35 |
| PF14574 | RACo_C_ter | 0.35 |
| PF13450 | NAD_binding_8 | 0.35 |
| PF08044 | DUF1707 | 0.35 |
| PF12172 | DUF35_N | 0.35 |
| PF02012 | BNR | 0.35 |
| PF08240 | ADH_N | 0.35 |
| PF13340 | DUF4096 | 0.35 |
| PF10431 | ClpB_D2-small | 0.35 |
| PF03988 | DUF347 | 0.35 |
| PF13669 | Glyoxalase_4 | 0.35 |
| PF03949 | Malic_M | 0.35 |
| PF01464 | SLT | 0.35 |
| PF02222 | ATP-grasp | 0.35 |
| PF01321 | Creatinase_N | 0.35 |
| PF00923 | TAL_FSA | 0.35 |
| PF00534 | Glycos_transf_1 | 0.35 |
| PF01196 | Ribosomal_L17 | 0.35 |
| PF04075 | F420H2_quin_red | 0.35 |
| PF00135 | COesterase | 0.35 |
| PF07978 | NIPSNAP | 0.35 |
| PF00266 | Aminotran_5 | 0.35 |
| PF01643 | Acyl-ACP_TE | 0.35 |
| PF00701 | DHDPS | 0.35 |
| PF01367 | 5_3_exonuc | 0.35 |
| PF00069 | Pkinase | 0.35 |
| PF06253 | MTTB | 0.35 |
| PF09363 | XFP_C | 0.35 |
| PF00781 | DAGK_cat | 0.35 |
| PF13404 | HTH_AsnC-type | 0.35 |
| PF11305 | DUF3107 | 0.35 |
| PF00254 | FKBP_C | 0.35 |
| PF12710 | HAD | 0.35 |
| PF00132 | Hexapep | 0.35 |
| PF01583 | APS_kinase | 0.35 |
| PF13524 | Glyco_trans_1_2 | 0.35 |
| PF02637 | GatB_Yqey | 0.35 |
| PF01039 | Carboxyl_trans | 0.35 |
| PF12411 | Choline_sulf_C | 0.35 |
| PF01230 | HIT | 0.35 |
| COG ID | Name | Functional Category | % Frequency in 287 Family Scaffolds |
|---|---|---|---|
| COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 2.09 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.74 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.39 |
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 1.39 |
| COG1349 | DNA-binding transcriptional regulator of sugar metabolism, DeoR/GlpR family | Transcription [K] | 1.39 |
| COG1620 | L-lactate permease | Energy production and conversion [C] | 1.05 |
| COG1074 | 3’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 1.05 |
| COG3973 | DNA helicase IV | Replication, recombination and repair [L] | 1.05 |
| COG0210 | Superfamily I DNA or RNA helicase | Replication, recombination and repair [L] | 1.05 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 1.05 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.70 |
| COG2608 | Copper chaperone CopZ | Inorganic ion transport and metabolism [P] | 0.70 |
| COG2224 | Isocitrate lyase | Energy production and conversion [C] | 0.70 |
| COG1597 | Phosphatidylglycerol kinase, diacylglycerol kinase family | Lipid transport and metabolism [I] | 0.70 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.70 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.70 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.70 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.70 |
| COG2511 | Archaeal Glu-tRNAGln amidotransferase subunit E, contains GAD domain | Translation, ribosomal structure and biogenesis [J] | 0.70 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.70 |
| COG0064 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit | Translation, ribosomal structure and biogenesis [J] | 0.70 |
| COG0120 | Ribose 5-phosphate isomerase | Carbohydrate transport and metabolism [G] | 0.70 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.70 |
| COG0363 | 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase | Carbohydrate transport and metabolism [G] | 0.70 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 0.70 |
| COG3707 | Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domains | Transcription [K] | 0.70 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.70 |
| COG5598 | Trimethylamine:corrinoid methyltransferase | Coenzyme transport and metabolism [H] | 0.35 |
| COG1610 | Uncharacterized conserved protein YqeY, may have tRNA amino acid amidase activity | General function prediction only [R] | 0.35 |
| COG2148 | Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) | Cell wall/membrane/envelope biogenesis [M] | 0.35 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.35 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.35 |
| COG4705 | Uncharacterized membrane-anchored protein | Function unknown [S] | 0.35 |
| COG3884 | Acyl-ACP thioesterase | Lipid transport and metabolism [I] | 0.35 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.35 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.35 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.35 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.35 |
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.35 |
| COG2902 | NAD-specific glutamate dehydrogenase | Amino acid transport and metabolism [E] | 0.35 |
| COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 0.35 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.35 |
| COG0126 | 3-phosphoglycerate kinase | Carbohydrate transport and metabolism [G] | 0.35 |
| COG0176 | Transaldolase/fructose-6-phosphate aldolase | Carbohydrate transport and metabolism [G] | 0.35 |
| COG0203 | Ribosomal protein L17 | Translation, ribosomal structure and biogenesis [J] | 0.35 |
| COG0237 | Dephospho-CoA kinase | Coenzyme transport and metabolism [H] | 0.35 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.35 |
| COG0281 | Malic enzyme | Energy production and conversion [C] | 0.35 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.35 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.35 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.35 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.35 |
| COG2086 | Electron transfer flavoprotein, alpha and beta subunits | Energy production and conversion [C] | 0.35 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.35 |
| COG0686 | Alanine dehydrogenase (includes sporulation protein SpoVN) | Amino acid transport and metabolism [E] | 0.35 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.35 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.35 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.35 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.35 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.35 |
| COG1816 | Adenosine/6-amino-6-deoxyfutalosine deaminase | Nucleotide transport and metabolism [F] | 0.35 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.35 |
| COG2025 | Electron transfer flavoprotein, alpha subunit FixB | Energy production and conversion [C] | 0.35 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.47 % |
| Unclassified | root | N/A | 27.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_104943914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 524 | Open in IMG/M |
| 3300001403|JGI20205J14842_1021799 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300004281|Ga0066397_10147718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 535 | Open in IMG/M |
| 3300004633|Ga0066395_10174797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. | 1106 | Open in IMG/M |
| 3300005172|Ga0066683_10661533 | Not Available | 625 | Open in IMG/M |
| 3300005332|Ga0066388_100719559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1602 | Open in IMG/M |
| 3300005332|Ga0066388_100892548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia asaccharolytica | 1468 | Open in IMG/M |
| 3300005332|Ga0066388_102050165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1027 | Open in IMG/M |
| 3300005332|Ga0066388_106628034 | Not Available | 583 | Open in IMG/M |
| 3300005332|Ga0066388_107921986 | Not Available | 531 | Open in IMG/M |
| 3300005363|Ga0008090_10166041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1878 | Open in IMG/M |
| 3300005713|Ga0066905_100171922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1587 | Open in IMG/M |
| 3300005713|Ga0066905_100517184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 996 | Open in IMG/M |
| 3300005713|Ga0066905_100704739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 867 | Open in IMG/M |
| 3300005713|Ga0066905_100712462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 862 | Open in IMG/M |
| 3300005713|Ga0066905_101463456 | Not Available | 620 | Open in IMG/M |
| 3300005713|Ga0066905_101706848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → environmental samples → uncultured Frankineae bacterium | 579 | Open in IMG/M |
| 3300005764|Ga0066903_101740372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1188 | Open in IMG/M |
| 3300005764|Ga0066903_102948284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 922 | Open in IMG/M |
| 3300005764|Ga0066903_103557841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 839 | Open in IMG/M |
| 3300005764|Ga0066903_103873250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 804 | Open in IMG/M |
| 3300005764|Ga0066903_104183217 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300005764|Ga0066903_104716894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 725 | Open in IMG/M |
| 3300005764|Ga0066903_106493345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 609 | Open in IMG/M |
| 3300005899|Ga0075271_10012836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1509 | Open in IMG/M |
| 3300005900|Ga0075272_1105659 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300005901|Ga0075274_1025796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 818 | Open in IMG/M |
| 3300005902|Ga0075273_10027111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 975 | Open in IMG/M |
| 3300006028|Ga0070717_10069665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2930 | Open in IMG/M |
| 3300006028|Ga0070717_10435450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1180 | Open in IMG/M |
| 3300006046|Ga0066652_100812664 | Not Available | 894 | Open in IMG/M |
| 3300006573|Ga0074055_11832188 | Not Available | 1033 | Open in IMG/M |
| 3300006575|Ga0074053_12000376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 942 | Open in IMG/M |
| 3300006577|Ga0074050_10003246 | Not Available | 1341 | Open in IMG/M |
| 3300006579|Ga0074054_12131999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 752 | Open in IMG/M |
| 3300006581|Ga0074048_13465335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Thermocrispum → Thermocrispum municipale | 1541 | Open in IMG/M |
| 3300006605|Ga0074057_12238528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 507 | Open in IMG/M |
| 3300006755|Ga0079222_10150169 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
| 3300006796|Ga0066665_10342876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1216 | Open in IMG/M |
| 3300006796|Ga0066665_11363048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 547 | Open in IMG/M |
| 3300006804|Ga0079221_10858508 | Not Available | 660 | Open in IMG/M |
| 3300006804|Ga0079221_11175507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 594 | Open in IMG/M |
| 3300006854|Ga0075425_100204108 | All Organisms → cellular organisms → Bacteria | 2271 | Open in IMG/M |
| 3300006854|Ga0075425_100714491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1150 | Open in IMG/M |
| 3300006903|Ga0075426_10497488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 906 | Open in IMG/M |
| 3300006954|Ga0079219_12092061 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300006954|Ga0079219_12452659 | Not Available | 507 | Open in IMG/M |
| 3300009137|Ga0066709_101476739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Nocardiopsis | 983 | Open in IMG/M |
| 3300009792|Ga0126374_10338469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1026 | Open in IMG/M |
| 3300009792|Ga0126374_10482352 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300009792|Ga0126374_10514361 | Not Available | 866 | Open in IMG/M |
| 3300009792|Ga0126374_10559587 | Not Available | 836 | Open in IMG/M |
| 3300009792|Ga0126374_11126598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 624 | Open in IMG/M |
| 3300010043|Ga0126380_10093421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1782 | Open in IMG/M |
| 3300010043|Ga0126380_10249563 | Not Available | 1228 | Open in IMG/M |
| 3300010043|Ga0126380_10474946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 952 | Open in IMG/M |
| 3300010046|Ga0126384_10429440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1123 | Open in IMG/M |
| 3300010047|Ga0126382_11247067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → environmental samples → uncultured Frankineae bacterium | 669 | Open in IMG/M |
| 3300010047|Ga0126382_11338291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 650 | Open in IMG/M |
| 3300010047|Ga0126382_12314091 | Not Available | 520 | Open in IMG/M |
| 3300010048|Ga0126373_10144733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2253 | Open in IMG/M |
| 3300010048|Ga0126373_10743103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1041 | Open in IMG/M |
| 3300010048|Ga0126373_11292877 | Not Available | 795 | Open in IMG/M |
| 3300010048|Ga0126373_11679412 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300010048|Ga0126373_12617380 | Not Available | 563 | Open in IMG/M |
| 3300010048|Ga0126373_12864528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea | 538 | Open in IMG/M |
| 3300010358|Ga0126370_10114628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1896 | Open in IMG/M |
| 3300010358|Ga0126370_10278591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1314 | Open in IMG/M |
| 3300010358|Ga0126370_10398960 | Not Available | 1129 | Open in IMG/M |
| 3300010358|Ga0126370_12066594 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300010359|Ga0126376_11207989 | Not Available | 771 | Open in IMG/M |
| 3300010360|Ga0126372_10029335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3418 | Open in IMG/M |
| 3300010360|Ga0126372_10119351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2033 | Open in IMG/M |
| 3300010360|Ga0126372_10302865 | Not Available | 1406 | Open in IMG/M |
| 3300010360|Ga0126372_10340517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1340 | Open in IMG/M |
| 3300010360|Ga0126372_10470325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1171 | Open in IMG/M |
| 3300010360|Ga0126372_11009922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 844 | Open in IMG/M |
| 3300010360|Ga0126372_11536810 | Not Available | 703 | Open in IMG/M |
| 3300010360|Ga0126372_12895915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 532 | Open in IMG/M |
| 3300010360|Ga0126372_13063387 | Not Available | 519 | Open in IMG/M |
| 3300010361|Ga0126378_10106709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2777 | Open in IMG/M |
| 3300010361|Ga0126378_10193910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2104 | Open in IMG/M |
| 3300010361|Ga0126378_10324333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1647 | Open in IMG/M |
| 3300010361|Ga0126378_11502240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 764 | Open in IMG/M |
| 3300010361|Ga0126378_12124100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 641 | Open in IMG/M |
| 3300010361|Ga0126378_12237462 | Not Available | 624 | Open in IMG/M |
| 3300010362|Ga0126377_11305941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 797 | Open in IMG/M |
| 3300010362|Ga0126377_12710048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 571 | Open in IMG/M |
| 3300010366|Ga0126379_10398332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1423 | Open in IMG/M |
| 3300010366|Ga0126379_12162941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 658 | Open in IMG/M |
| 3300010366|Ga0126379_12165060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 657 | Open in IMG/M |
| 3300010376|Ga0126381_100140449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3156 | Open in IMG/M |
| 3300010398|Ga0126383_11088992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 888 | Open in IMG/M |
| 3300010398|Ga0126383_12067536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 657 | Open in IMG/M |
| 3300011271|Ga0137393_10889844 | Not Available | 760 | Open in IMG/M |
| 3300012198|Ga0137364_10173773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → environmental samples → uncultured Nocardioidaceae bacterium | 1569 | Open in IMG/M |
| 3300012198|Ga0137364_10974350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 642 | Open in IMG/M |
| 3300012199|Ga0137383_10849976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 666 | Open in IMG/M |
| 3300012200|Ga0137382_10021274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 3728 | Open in IMG/M |
| 3300012201|Ga0137365_10048216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3232 | Open in IMG/M |
| 3300012207|Ga0137381_11179319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 658 | Open in IMG/M |
| 3300012210|Ga0137378_10205803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1832 | Open in IMG/M |
| 3300012285|Ga0137370_10244143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. NL15-2K | 1062 | Open in IMG/M |
| 3300012349|Ga0137387_10496153 | Not Available | 886 | Open in IMG/M |
| 3300012356|Ga0137371_10272279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis saalfeldensis | 1321 | Open in IMG/M |
| 3300012356|Ga0137371_11263324 | Not Available | 548 | Open in IMG/M |
| 3300012356|Ga0137371_11445950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 502 | Open in IMG/M |
| 3300012359|Ga0137385_11168796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa ishikariensis | 631 | Open in IMG/M |
| 3300012948|Ga0126375_10391746 | Not Available | 1001 | Open in IMG/M |
| 3300012971|Ga0126369_10461288 | Not Available | 1322 | Open in IMG/M |
| 3300012971|Ga0126369_11035130 | Not Available | 909 | Open in IMG/M |
| 3300012971|Ga0126369_11718905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 717 | Open in IMG/M |
| 3300012971|Ga0126369_11964810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 673 | Open in IMG/M |
| 3300012975|Ga0134110_10457454 | Not Available | 574 | Open in IMG/M |
| 3300015371|Ga0132258_10840404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2316 | Open in IMG/M |
| 3300015371|Ga0132258_10974927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2142 | Open in IMG/M |
| 3300016270|Ga0182036_11210745 | Not Available | 628 | Open in IMG/M |
| 3300016319|Ga0182033_10572819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 978 | Open in IMG/M |
| 3300016319|Ga0182033_11776986 | Not Available | 559 | Open in IMG/M |
| 3300016341|Ga0182035_11318295 | Not Available | 647 | Open in IMG/M |
| 3300016341|Ga0182035_12171826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 503 | Open in IMG/M |
| 3300016357|Ga0182032_10154961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter stackebrandtii | 1699 | Open in IMG/M |
| 3300016357|Ga0182032_10739806 | Not Available | 828 | Open in IMG/M |
| 3300016404|Ga0182037_10343406 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300016422|Ga0182039_10632190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 938 | Open in IMG/M |
| 3300016422|Ga0182039_12088744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 522 | Open in IMG/M |
| 3300016445|Ga0182038_12157265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 505 | Open in IMG/M |
| 3300017939|Ga0187775_10152150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 825 | Open in IMG/M |
| 3300017939|Ga0187775_10170817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 788 | Open in IMG/M |
| 3300017947|Ga0187785_10677319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 539 | Open in IMG/M |
| 3300017947|Ga0187785_10697822 | Not Available | 532 | Open in IMG/M |
| 3300017966|Ga0187776_10421572 | Not Available | 897 | Open in IMG/M |
| 3300017966|Ga0187776_10743369 | Not Available | 698 | Open in IMG/M |
| 3300017966|Ga0187776_10795348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK | 678 | Open in IMG/M |
| 3300017966|Ga0187776_11313656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 547 | Open in IMG/M |
| 3300017966|Ga0187776_11406973 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300017973|Ga0187780_10035373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3510 | Open in IMG/M |
| 3300017999|Ga0187767_10061419 | Not Available | 960 | Open in IMG/M |
| 3300018032|Ga0187788_10075841 | Not Available | 1182 | Open in IMG/M |
| 3300018032|Ga0187788_10141711 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300018058|Ga0187766_10138749 | All Organisms → cellular organisms → Bacteria | 1502 | Open in IMG/M |
| 3300018060|Ga0187765_10000537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 13940 | Open in IMG/M |
| 3300018060|Ga0187765_10036996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae | 2447 | Open in IMG/M |
| 3300018060|Ga0187765_10091663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1640 | Open in IMG/M |
| 3300018060|Ga0187765_10127420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1416 | Open in IMG/M |
| 3300018060|Ga0187765_10186761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1191 | Open in IMG/M |
| 3300018060|Ga0187765_10565682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 729 | Open in IMG/M |
| 3300018060|Ga0187765_11253199 | Not Available | 523 | Open in IMG/M |
| 3300018064|Ga0187773_10021253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2785 | Open in IMG/M |
| 3300018064|Ga0187773_10038917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2134 | Open in IMG/M |
| 3300018064|Ga0187773_10044805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2012 | Open in IMG/M |
| 3300018064|Ga0187773_10105332 | Not Available | 1397 | Open in IMG/M |
| 3300018064|Ga0187773_10374906 | Not Available | 817 | Open in IMG/M |
| 3300018064|Ga0187773_10527680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 709 | Open in IMG/M |
| 3300018064|Ga0187773_10603727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 671 | Open in IMG/M |
| 3300018064|Ga0187773_10815144 | Not Available | 595 | Open in IMG/M |
| 3300018064|Ga0187773_10841867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 587 | Open in IMG/M |
| 3300018089|Ga0187774_10085840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1512 | Open in IMG/M |
| 3300018089|Ga0187774_10281602 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300018089|Ga0187774_10497135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 767 | Open in IMG/M |
| 3300018089|Ga0187774_11029755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 577 | Open in IMG/M |
| 3300018469|Ga0190270_12016502 | Not Available | 635 | Open in IMG/M |
| 3300019767|Ga0190267_10189964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 949 | Open in IMG/M |
| 3300021560|Ga0126371_10348965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1615 | Open in IMG/M |
| 3300021560|Ga0126371_10398513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1518 | Open in IMG/M |
| 3300021560|Ga0126371_13306526 | Not Available | 545 | Open in IMG/M |
| 3300021560|Ga0126371_13753871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 512 | Open in IMG/M |
| 3300025928|Ga0207700_10258533 | Not Available | 1490 | Open in IMG/M |
| 3300025929|Ga0207664_10527504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1058 | Open in IMG/M |
| 3300026995|Ga0208761_1027098 | Not Available | 568 | Open in IMG/M |
| 3300027523|Ga0208890_1006084 | All Organisms → cellular organisms → Bacteria | 1477 | Open in IMG/M |
| 3300027646|Ga0209466_1014590 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1654 | Open in IMG/M |
| 3300027765|Ga0209073_10292867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 643 | Open in IMG/M |
| 3300031543|Ga0318516_10012839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4101 | Open in IMG/M |
| 3300031544|Ga0318534_10188721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1190 | Open in IMG/M |
| 3300031544|Ga0318534_10242376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales | 1040 | Open in IMG/M |
| 3300031544|Ga0318534_10603720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 623 | Open in IMG/M |
| 3300031546|Ga0318538_10015229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3308 | Open in IMG/M |
| 3300031546|Ga0318538_10059420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1892 | Open in IMG/M |
| 3300031546|Ga0318538_10130766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 1317 | Open in IMG/M |
| 3300031546|Ga0318538_10440279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → Microbispora sitophila | 706 | Open in IMG/M |
| 3300031549|Ga0318571_10253357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 648 | Open in IMG/M |
| 3300031572|Ga0318515_10284548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 886 | Open in IMG/M |
| 3300031573|Ga0310915_10230884 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
| 3300031573|Ga0310915_10443657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → Jatrophihabitans telluris | 922 | Open in IMG/M |
| 3300031640|Ga0318555_10230121 | Not Available | 1000 | Open in IMG/M |
| 3300031668|Ga0318542_10176267 | Not Available | 1071 | Open in IMG/M |
| 3300031681|Ga0318572_10890647 | Not Available | 529 | Open in IMG/M |
| 3300031713|Ga0318496_10113877 | Not Available | 1459 | Open in IMG/M |
| 3300031713|Ga0318496_10133853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1346 | Open in IMG/M |
| 3300031713|Ga0318496_10285953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 910 | Open in IMG/M |
| 3300031719|Ga0306917_10360215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales | 1132 | Open in IMG/M |
| 3300031719|Ga0306917_10820097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 729 | Open in IMG/M |
| 3300031720|Ga0307469_10064529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2389 | Open in IMG/M |
| 3300031723|Ga0318493_10146070 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300031724|Ga0318500_10074557 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
| 3300031724|Ga0318500_10082948 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300031724|Ga0318500_10154907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1080 | Open in IMG/M |
| 3300031724|Ga0318500_10349648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 730 | Open in IMG/M |
| 3300031736|Ga0318501_10172714 | Not Available | 1121 | Open in IMG/M |
| 3300031744|Ga0306918_10173206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1610 | Open in IMG/M |
| 3300031747|Ga0318502_10351172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 872 | Open in IMG/M |
| 3300031748|Ga0318492_10085186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes subtropicus | 1534 | Open in IMG/M |
| 3300031748|Ga0318492_10308462 | Not Available | 824 | Open in IMG/M |
| 3300031765|Ga0318554_10217384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1088 | Open in IMG/M |
| 3300031768|Ga0318509_10102715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales | 1543 | Open in IMG/M |
| 3300031769|Ga0318526_10247496 | Not Available | 729 | Open in IMG/M |
| 3300031769|Ga0318526_10294848 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300031771|Ga0318546_10723224 | Not Available | 700 | Open in IMG/M |
| 3300031777|Ga0318543_10419375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. SID2131 | 600 | Open in IMG/M |
| 3300031778|Ga0318498_10009950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3795 | Open in IMG/M |
| 3300031778|Ga0318498_10073031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1542 | Open in IMG/M |
| 3300031779|Ga0318566_10134347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → unclassified Kribbellaceae → Kribbellaceae bacterium | 1223 | Open in IMG/M |
| 3300031781|Ga0318547_10102194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1638 | Open in IMG/M |
| 3300031793|Ga0318548_10476771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 610 | Open in IMG/M |
| 3300031794|Ga0318503_10036653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1458 | Open in IMG/M |
| 3300031795|Ga0318557_10266999 | Not Available | 784 | Open in IMG/M |
| 3300031797|Ga0318550_10137617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora chersina | 1169 | Open in IMG/M |
| 3300031798|Ga0318523_10350369 | Not Available | 735 | Open in IMG/M |
| 3300031831|Ga0318564_10013955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3240 | Open in IMG/M |
| 3300031831|Ga0318564_10020579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2734 | Open in IMG/M |
| 3300031831|Ga0318564_10375753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 623 | Open in IMG/M |
| 3300031846|Ga0318512_10089984 | Not Available | 1430 | Open in IMG/M |
| 3300031879|Ga0306919_10150194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1698 | Open in IMG/M |
| 3300031879|Ga0306919_10572486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 871 | Open in IMG/M |
| 3300031890|Ga0306925_10062643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3902 | Open in IMG/M |
| 3300031890|Ga0306925_10260290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1869 | Open in IMG/M |
| 3300031890|Ga0306925_10805430 | Not Available | 974 | Open in IMG/M |
| 3300031890|Ga0306925_10816439 | Not Available | 966 | Open in IMG/M |
| 3300031893|Ga0318536_10147597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1194 | Open in IMG/M |
| 3300031893|Ga0318536_10230324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 942 | Open in IMG/M |
| 3300031896|Ga0318551_10636432 | Not Available | 616 | Open in IMG/M |
| 3300031910|Ga0306923_10117100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3018 | Open in IMG/M |
| 3300031912|Ga0306921_10286118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1930 | Open in IMG/M |
| 3300031941|Ga0310912_10214894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales | 1473 | Open in IMG/M |
| 3300031945|Ga0310913_10085155 | Not Available | 2115 | Open in IMG/M |
| 3300031945|Ga0310913_10174261 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
| 3300031945|Ga0310913_10314260 | Not Available | 1106 | Open in IMG/M |
| 3300031945|Ga0310913_10492490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 870 | Open in IMG/M |
| 3300031946|Ga0310910_10516400 | Not Available | 948 | Open in IMG/M |
| 3300031946|Ga0310910_11072198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
| 3300031947|Ga0310909_11030708 | Not Available | 671 | Open in IMG/M |
| 3300031947|Ga0310909_11643889 | Not Available | 508 | Open in IMG/M |
| 3300031959|Ga0318530_10392248 | Not Available | 575 | Open in IMG/M |
| 3300032001|Ga0306922_11785989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales | 606 | Open in IMG/M |
| 3300032008|Ga0318562_10068703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1973 | Open in IMG/M |
| 3300032009|Ga0318563_10757824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
| 3300032010|Ga0318569_10051760 | Not Available | 1777 | Open in IMG/M |
| 3300032010|Ga0318569_10136860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1122 | Open in IMG/M |
| 3300032010|Ga0318569_10146755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1084 | Open in IMG/M |
| 3300032010|Ga0318569_10270162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 791 | Open in IMG/M |
| 3300032035|Ga0310911_10209847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales | 1109 | Open in IMG/M |
| 3300032035|Ga0310911_10903949 | Not Available | 509 | Open in IMG/M |
| 3300032039|Ga0318559_10112956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1212 | Open in IMG/M |
| 3300032039|Ga0318559_10463367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 591 | Open in IMG/M |
| 3300032039|Ga0318559_10591100 | Not Available | 518 | Open in IMG/M |
| 3300032041|Ga0318549_10455545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 576 | Open in IMG/M |
| 3300032043|Ga0318556_10043350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2150 | Open in IMG/M |
| 3300032044|Ga0318558_10185145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1012 | Open in IMG/M |
| 3300032044|Ga0318558_10517392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 596 | Open in IMG/M |
| 3300032052|Ga0318506_10067298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1481 | Open in IMG/M |
| 3300032064|Ga0318510_10112493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1047 | Open in IMG/M |
| 3300032064|Ga0318510_10151232 | Not Available | 916 | Open in IMG/M |
| 3300032064|Ga0318510_10270596 | Not Available | 702 | Open in IMG/M |
| 3300032065|Ga0318513_10016131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3035 | Open in IMG/M |
| 3300032067|Ga0318524_10221559 | Not Available | 970 | Open in IMG/M |
| 3300032067|Ga0318524_10496173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 640 | Open in IMG/M |
| 3300032067|Ga0318524_10694102 | Not Available | 537 | Open in IMG/M |
| 3300032076|Ga0306924_10911580 | Not Available | 971 | Open in IMG/M |
| 3300032090|Ga0318518_10619799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 552 | Open in IMG/M |
| 3300032205|Ga0307472_102574020 | Not Available | 518 | Open in IMG/M |
| 3300032782|Ga0335082_10255620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1633 | Open in IMG/M |
| 3300032783|Ga0335079_10048582 | All Organisms → cellular organisms → Bacteria | 4862 | Open in IMG/M |
| 3300032783|Ga0335079_11482244 | Not Available | 671 | Open in IMG/M |
| 3300032828|Ga0335080_10503923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1285 | Open in IMG/M |
| 3300032828|Ga0335080_11024545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 839 | Open in IMG/M |
| 3300032828|Ga0335080_11051086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 826 | Open in IMG/M |
| 3300032828|Ga0335080_11409483 | Not Available | 692 | Open in IMG/M |
| 3300032828|Ga0335080_11556738 | Not Available | 652 | Open in IMG/M |
| 3300032955|Ga0335076_10369347 | Not Available | 1320 | Open in IMG/M |
| 3300032955|Ga0335076_10794090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 828 | Open in IMG/M |
| 3300032955|Ga0335076_11267992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
| 3300033004|Ga0335084_10506680 | Not Available | 1240 | Open in IMG/M |
| 3300033158|Ga0335077_10240422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2012 | Open in IMG/M |
| 3300033158|Ga0335077_10750916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 999 | Open in IMG/M |
| 3300033290|Ga0318519_10191376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales | 1163 | Open in IMG/M |
| 3300033805|Ga0314864_0040561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1039 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 19.16% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 11.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.36% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.32% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.79% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.74% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.39% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.05% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.70% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.70% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.35% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.35% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.35% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.35% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.35% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.35% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001403 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005899 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302 | Environmental | Open in IMG/M |
| 3300005900 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404 | Environmental | Open in IMG/M |
| 3300005901 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201 | Environmental | Open in IMG/M |
| 3300005902 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026995 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes) | Environmental | Open in IMG/M |
| 3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1049439142 | 3300000956 | Soil | MKGEGEAGGDRKAEEEFIAELWATTTTPRGARPVDAQQA |
| JGI20205J14842_10217991 | 3300001403 | Arctic Peat Soil | PSRAAAGGMHRKAEEEPIAELWATTTTQRGARPVDAQQAEDPRDMP* |
| Ga0066397_101477181 | 3300004281 | Tropical Forest Soil | MPSRAAVGGIDRKAEEETIVELPATTTTRRDARPADAQQAGD |
| Ga0066395_101747972 | 3300004633 | Tropical Forest Soil | MPSRAVAGGMDRKAEEEPIVELFGDDDNAADARPAAAQQAEDLWDTP* |
| Ga0066683_106615331 | 3300005172 | Soil | MPSRAVAGGMDRKAEEEPIVELSATTTTPRDARPADAQQARDL* |
| Ga0066388_1007195591 | 3300005332 | Tropical Forest Soil | PSRAAAGGMDRKAEEEPIAELLATTTTPRGARPVDAQQARDLRDTP* |
| Ga0066388_1008925483 | 3300005332 | Tropical Forest Soil | MGRRVGDRKAEEEPIVGLWATTTTQRGARPVDAQQAGGLRDTP |
| Ga0066388_1020501651 | 3300005332 | Tropical Forest Soil | VSRRSMPSRAAAGGMDRKAEEETIVELSAATATPRDARPAGAQQAGDLRDMA* |
| Ga0066388_1066280342 | 3300005332 | Tropical Forest Soil | MPSRAVAGGMDRKAEEELIVELSAMTATPRDARPADAQQAGDLRDTA* |
| Ga0066388_1079219861 | 3300005332 | Tropical Forest Soil | GGMDRKAEEETIVELSATTTTPRDARPAAAQQAEDLQDMP* |
| Ga0008090_101660411 | 3300005363 | Tropical Rainforest Soil | MGRRVGHRKAEEEPIAELCATTTTPRGARPVDAQQARDLRDTP |
| Ga0066905_1001719222 | 3300005713 | Tropical Forest Soil | MDRKAEEETIVELSATTTTPRNARPAAAQQAEDL* |
| Ga0066905_1005171842 | 3300005713 | Tropical Forest Soil | MDRKAEEETIVELSATTTTPRDARPAAAQQAGDLRDMA* |
| Ga0066905_1007047391 | 3300005713 | Tropical Forest Soil | PSRAVAGGMDRKAEEETIVELPATTATPRAARPATA* |
| Ga0066905_1007124621 | 3300005713 | Tropical Forest Soil | MPSRAIAGGMDRKAEKELMVELSATTTTPRDARPADAQQAGDLRDMA* |
| Ga0066905_1014634561 | 3300005713 | Tropical Forest Soil | DRKAEEETIVELSAATATPRAARPADAQQAGDLRDMA* |
| Ga0066905_1017068481 | 3300005713 | Tropical Forest Soil | MPSRAAVGGIDRKAEEETIVELPATTTTRRDARPADAQQAGDLRD |
| Ga0066903_1017403722 | 3300005764 | Tropical Forest Soil | SLPSRAAAGGMDRKAEEEPIAELLATTTTQRGARPVDAEQAGDLRDTPSRGWPA* |
| Ga0066903_1029482842 | 3300005764 | Tropical Forest Soil | MDRKAEEETIVELSATMATPRDARPAAAQQARDLRDMP* |
| Ga0066903_1035578412 | 3300005764 | Tropical Forest Soil | GGMHRKAEEEPIAELLATTTTPRGARPADAQQARDLRDTPWA* |
| Ga0066903_1038732501 | 3300005764 | Tropical Forest Soil | RERLSGGMDRKAEEELIAELWATTTTPRGARPAAAQQAE* |
| Ga0066903_1041832172 | 3300005764 | Tropical Forest Soil | AGGMDRKAEEEPIVGLWATTTTQRGARPVDAQQAGGLRDTP* |
| Ga0066903_1047168941 | 3300005764 | Tropical Forest Soil | MPSRAVAGGMDRKAEEETIVELSATTTTPRDARPA |
| Ga0066903_1064933451 | 3300005764 | Tropical Forest Soil | AGGMDRKAEEEPIVGLWATTTTQRGARPVDAQQAGGLRDMP* |
| Ga0075271_100128362 | 3300005899 | Rice Paddy Soil | MARKAEEEPIVELSAMTARQREARPGGAQQAEDCQDTP* |
| Ga0075272_11056591 | 3300005900 | Rice Paddy Soil | RKAEEERITELFATAATRRDARPGGAQQAEDLRNMA* |
| Ga0075274_10257962 | 3300005901 | Rice Paddy Soil | MARKAEEEPIVELSATTARQREARPGGAQQAEDCQDTP* |
| Ga0075273_100271111 | 3300005902 | Rice Paddy Soil | KADEERMVELFAVTATPRDARTGDAQQADDLRDPA* |
| Ga0070717_100696651 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GGMDRKAEEEPIVELWETTTTPRGARPGAAQQARDLRDTP* |
| Ga0070717_104354502 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRKAEEETIVELSATTTTPRDARPAAAQQAEDLLDMP* |
| Ga0066652_1008126641 | 3300006046 | Soil | GDRKTEEETIVELPATTTIPRDDRPAAAQQAGDLRDMA* |
| Ga0074055_118321882 | 3300006573 | Soil | AGGMDRKAEEETIVELSAATATPRDARPADAQQAGDLRDTA* |
| Ga0074053_120003762 | 3300006575 | Soil | MDRKAEEETIVELSATTTTPRDARPADAQQAGDLRDMA* |
| Ga0074050_100032462 | 3300006577 | Soil | AGGMDRKAEEEPIVELSATTTTPRDARPAAAQQAEDLWDTP* |
| Ga0074054_121319993 | 3300006579 | Soil | MDRKAEEELIVELSATTTTPRDARPADAQQAGDLR |
| Ga0074048_134653353 | 3300006581 | Soil | MDRKAEEEPIVELSATTTTPRAARPAVAQQAGDLRDMA |
| Ga0074057_122385281 | 3300006605 | Soil | MGRRAGDRKAEEETIVELSAATATPRDARPAVAQQAGD |
| Ga0079222_101501693 | 3300006755 | Agricultural Soil | GGMDRKAEEELIAELWATTTTPRAARPADAQQAE* |
| Ga0066665_103428762 | 3300006796 | Soil | MPSRAVAGGMDRKTEEEPIVELSATTTTPRDARPADAQQARDLRDTP* |
| Ga0066665_113630482 | 3300006796 | Soil | MPSRAAADGMDRKAEEEPIVVLWATTTTPRGARPVDAQ |
| Ga0079221_108585082 | 3300006804 | Agricultural Soil | GMGRRVGDRKAEEEPIAELWATTTTPRGARPVDAQQAG* |
| Ga0079221_111755072 | 3300006804 | Agricultural Soil | LPSRAPAGGMDRKAEEEPIAELLATTTTPRGARPADAQQAGDLRDTPWAPAGFFR* |
| Ga0075425_1002041084 | 3300006854 | Populus Rhizosphere | SMPSRAAAGGMDRKAEEELIAELWATTTTPRAARPADAQQAE* |
| Ga0075425_1007144913 | 3300006854 | Populus Rhizosphere | MDRKAEEETIVELSATTTTPRDARPAAAQQAEDLWDMP* |
| Ga0075426_104974881 | 3300006903 | Populus Rhizosphere | GRRVGDRKAEEEPIAELLATTTTQRGARPVDAQH* |
| Ga0079219_120920612 | 3300006954 | Agricultural Soil | VARIFAVASGRMKGMGRRVGHRKAEEEPIAELWATTTTPRGARPADAQQARDLRD |
| Ga0079219_124526591 | 3300006954 | Agricultural Soil | RGMGRRVGDRKAEEEPMAELLATTTTQRGARPADAQQAGDLQDSP* |
| Ga0066709_1014767392 | 3300009137 | Grasslands Soil | MPSRAVVGGMDRKAEEEPIVELSATTTTPRDARPADAQQARDLRDTP* |
| Ga0126374_103384692 | 3300009792 | Tropical Forest Soil | MDRKAEEETMVELSATTTTPRAARPAAAQQAGDLRDTP* |
| Ga0126374_104823522 | 3300009792 | Tropical Forest Soil | MPSRAVAGGMDRKAEEETIVELSATTTTPRDARPADAQQAGDPREMP* |
| Ga0126374_105143612 | 3300009792 | Tropical Forest Soil | MKGMGRRAGDRKAQEETMVELSATTTTPRDARPADAQQAGDLRDLA* |
| Ga0126374_105595872 | 3300009792 | Tropical Forest Soil | MPSRAVADGMDRKAEEELIVELSAMTATPRDARPADAQQAGDLRDTA* |
| Ga0126374_111265982 | 3300009792 | Tropical Forest Soil | MPSRAIAGGMDRKAEKELMVELSATTTTPRDARPADAQQAGDPRGMA* |
| Ga0126380_100934212 | 3300010043 | Tropical Forest Soil | MGRRAGDRKAEEETMVELSATTTTPRDARPAVAQQAGDLRDMA* |
| Ga0126380_102495631 | 3300010043 | Tropical Forest Soil | GGMDRKAEEETMVELSATTATPRDARPAGAQQAEDLRDMA* |
| Ga0126380_104749462 | 3300010043 | Tropical Forest Soil | MPSRAVAGGMDRKAEEELMVELSATTTTPRDARPAGAQQAGDLRDMA* |
| Ga0126384_104294401 | 3300010046 | Tropical Forest Soil | RKAEEEPIAELLATTTTPRGARAADAQQAGDLRDMP* |
| Ga0126382_112470672 | 3300010047 | Tropical Forest Soil | MPSRAAVGGIDRKAEEETIVELPATTTTRRDARPADAQQAGDLRDT |
| Ga0126382_113382911 | 3300010047 | Tropical Forest Soil | RSMPSRAAAGGMDRKAEEETIVELSATTTTPRDARPVDAQQAGDLRDTG* |
| Ga0126382_123140911 | 3300010047 | Tropical Forest Soil | MGRRVGDRKAEEEMIVELSATTATPRDARPADAQQA |
| Ga0126373_101447334 | 3300010048 | Tropical Forest Soil | AAAGGMDRKAEEEPIVGLWATTTTQRGARPVDAQQAGGLRGTP* |
| Ga0126373_107431031 | 3300010048 | Tropical Forest Soil | MPSRAVAGGMDRKAEEETIVELSATTTTPRDARPAAAQQAGDLRDMA* |
| Ga0126373_112928771 | 3300010048 | Tropical Forest Soil | AAGGMDRKAEEEPIVGLWATTTTQRGARPVDAQQAGGLRDTP* |
| Ga0126373_116794121 | 3300010048 | Tropical Forest Soil | AAGGMDRKAEEEPIVGLWATTTTQRGARPVDAQQAGGLRDMP* |
| Ga0126373_126173801 | 3300010048 | Tropical Forest Soil | SWPSRAAAGGMDRKAEEETIVELSATTTTPRDPRPVDAQQAQDLQEMP* |
| Ga0126373_128645281 | 3300010048 | Tropical Forest Soil | MDRKAEEEPIVELSATTTTPRDARPADAQQARDLRDTP* |
| Ga0126370_101146281 | 3300010358 | Tropical Forest Soil | MPSRAVAGGMDRKAEEETIVELSATATTPRDARPAAAQQAGDLRDMA* |
| Ga0126370_102785911 | 3300010358 | Tropical Forest Soil | GMDRKAEEETIVELSATTTTPRDARPAGAQQAGDLRDTA* |
| Ga0126370_103989601 | 3300010358 | Tropical Forest Soil | VSRRSMPSRAVAGGMDRKAEEETIVELSATTTTPRDTRPADAQQAGDLRDMA* |
| Ga0126370_120665942 | 3300010358 | Tropical Forest Soil | GDRKAEEEPIVGLWATTTTQRGARPVVAQQAGGLRDTP* |
| Ga0126376_112079891 | 3300010359 | Tropical Forest Soil | PSRAIAGGMDRKAEEETMVELSATTATPRDARPAGAQQAEDLRDMA* |
| Ga0126372_100293354 | 3300010360 | Tropical Forest Soil | MRSRAVAGGMDRKAEEEPIVELSATTTTPRAARPADAQQAGDL* |
| Ga0126372_101193512 | 3300010360 | Tropical Forest Soil | MPSRAVAGGMDRKAEEEAIVELSATTTTPRDARPAAAQQAGDLRDMA* |
| Ga0126372_103028652 | 3300010360 | Tropical Forest Soil | DGMDRKAEEELIVELSAMMATPRDARPADAQQAGDLRDTA* |
| Ga0126372_103405172 | 3300010360 | Tropical Forest Soil | MDRKAEEETIVELSATTTTPRDARPAAAQQAEDLQDMP* |
| Ga0126372_104703252 | 3300010360 | Tropical Forest Soil | AAGGMDRKAEEETIVELSATTTTPRDARPVDAQQAGDPRDMP* |
| Ga0126372_110099222 | 3300010360 | Tropical Forest Soil | MDRKAEEELIVELSAITTTPRDARPADAQQAGDLRDTA* |
| Ga0126372_115368101 | 3300010360 | Tropical Forest Soil | RVGDRKAEEEPIVGLWATTTTQRGARPVDAQQAGGLRDTP* |
| Ga0126372_128959151 | 3300010360 | Tropical Forest Soil | AEEETIVGLSATTATPRDARPAAAQQAGDLQDMA* |
| Ga0126372_130633871 | 3300010360 | Tropical Forest Soil | MPSRAVAGGMDRKAEEEPIVELSATTTTPRGARPADAQ |
| Ga0126378_101067091 | 3300010361 | Tropical Forest Soil | GLGRRVGDRKAEEEPIAELLATTTTQRGARPVDAQQARGLRDAP* |
| Ga0126378_101939104 | 3300010361 | Tropical Forest Soil | GMDRKAEEEPIVGLWATTTTQRGARPVDAQQAGGLRDTP* |
| Ga0126378_103243334 | 3300010361 | Tropical Forest Soil | MDRKAEEEEETSVELLAATATPRAARPAVAQQARDLRDMA* |
| Ga0126378_115022402 | 3300010361 | Tropical Forest Soil | MPSRAVAGGMDRKAEEELIVELSATTTTPRDARPADAQQAEDPRDTA* |
| Ga0126378_121241002 | 3300010361 | Tropical Forest Soil | AGGMDRKAEEEPIAELLATTTTQRGARPVDAQQARDLRDMP* |
| Ga0126378_122374622 | 3300010361 | Tropical Forest Soil | LRAVAGGMDRKAEEEPIVELSATTTTPRDARPAAAQQAEDLWDTP* |
| Ga0126377_113059411 | 3300010362 | Tropical Forest Soil | GGMDRKAEEEPIAELLATTTTPRGARPVDAQQAGDLRDMP* |
| Ga0126377_127100481 | 3300010362 | Tropical Forest Soil | MPSRAVAMKGMGRRAGDRKAQEETMVELSATTTTPRDARPADAQQAGDLRDLA* |
| Ga0126379_103983323 | 3300010366 | Tropical Forest Soil | VSRRSMPSRAVAGGMDRKAEEEPIVELSATTTTPRDARPADAQQARDLRDMP* |
| Ga0126379_121629411 | 3300010366 | Tropical Forest Soil | MPSRAVAGGMDRKAEEETIVELSATTTTPRDARPADAQQAGD |
| Ga0126379_121650602 | 3300010366 | Tropical Forest Soil | MPSRAAAGGMDRKAEEELIAELWATTTTLRAARPVDAQQAG* |
| Ga0126381_1001404492 | 3300010376 | Tropical Forest Soil | MPSRAVAGGMDRKAEKELIVELSATTTTPRDARPADAQQAEDPRDTA* |
| Ga0126383_110889921 | 3300010398 | Tropical Forest Soil | IARRRRKPIVELSATTTTPRDARPAAAQQAGDPRGIP* |
| Ga0126383_120675361 | 3300010398 | Tropical Forest Soil | GMDRKAEEETIVELSATTTTPRDARPADAQQAGDLRDMA* |
| Ga0137393_108898443 | 3300011271 | Vadose Zone Soil | GGMDRKAEEEPIAELLATTTTPRGARPAAAQQAG* |
| Ga0137364_101737731 | 3300012198 | Vadose Zone Soil | AGGMDRQAEEEPIVELSATTATPRDARPAGAQRAGDLRDMA* |
| Ga0137364_109743502 | 3300012198 | Vadose Zone Soil | MPSRAVAGAMERKAEEEPIVEVSATTATPRDARPAGAQQAGDLQDIAQSQPTGTEG |
| Ga0137383_108499762 | 3300012199 | Vadose Zone Soil | MPSRAVAVKGDGEAGGDRKTEEETIVELPATTTIPRDDRPAAAQQAGDLRDMA* |
| Ga0137382_100212745 | 3300012200 | Vadose Zone Soil | MDGKAEEETIAELSATTATPRAARPAVAQQARDLRDMA* |
| Ga0137365_100482162 | 3300012201 | Vadose Zone Soil | MDRKTEEETIVELSAATTTPRDDRPAAAQQAGDLRDMA* |
| Ga0137381_111793191 | 3300012207 | Vadose Zone Soil | MDRKAEEELIVEISATTTTPRAARPAAAQQAGDLRGM |
| Ga0137378_102058031 | 3300012210 | Vadose Zone Soil | LPSRAAAGGMARKAEEEPIVVLWATTTTQRGARPADAQQAE |
| Ga0137370_102441432 | 3300012285 | Vadose Zone Soil | CRSMPSRAVAGGMDRKAEEETIVELSATTTTPRDARPADAQQAGDLQDMA* |
| Ga0137387_104961532 | 3300012349 | Vadose Zone Soil | MDRKAEEEPIVELSATDDNAARRPAADAQQAGDP* |
| Ga0137371_102722792 | 3300012356 | Vadose Zone Soil | MDRKAEEETIVELSATTATPRAARPAAAQQARDLRGMA* |
| Ga0137371_112633241 | 3300012356 | Vadose Zone Soil | MPSRAVADGMDRKAEEAIVELSATTATLRDARPAGAQQAGDLRDMA* |
| Ga0137371_114459501 | 3300012356 | Vadose Zone Soil | AAAGGMARKAEEEPIVVLWATTTTQRGARPADAQQAE* |
| Ga0137385_111687962 | 3300012359 | Vadose Zone Soil | AAGGMARKAEEEPIVVLWATTTTQRGARPADAQQAE* |
| Ga0126375_103917461 | 3300012948 | Tropical Forest Soil | KAEEEPIVELSATRTTPRDARPAVAQQAGDLPGMA* |
| Ga0126369_104612881 | 3300012971 | Tropical Forest Soil | AVAGGMDRKAEEEPIVELSATTTTPRDARPADAQQARDLWDMP* |
| Ga0126369_110351302 | 3300012971 | Tropical Forest Soil | AGGMDRKAEEETIVELSATTTTPRDARPADAQQAGDLRDMA* |
| Ga0126369_117189052 | 3300012971 | Tropical Forest Soil | MDRNAEEETMVELSATTTTPRDARPAGAQQAGDLGDMA* |
| Ga0126369_119648102 | 3300012971 | Tropical Forest Soil | MDRKAEEETMGELSATRTTLRAARPAVTQQARDLRDMA |
| Ga0134110_104574542 | 3300012975 | Grasslands Soil | MPSRAAAGGMDRKAEEEPIVELSATDDNAARRPAADAQQAGDP* |
| Ga0132258_108404042 | 3300015371 | Arabidopsis Rhizosphere | MDRKAEEELIAELWVTTTTPRAARPADAQQAKDLRDTP* |
| Ga0132258_109749271 | 3300015371 | Arabidopsis Rhizosphere | RKAEEEPIAELLATTTTPRGARPADAQQAGDLRDMP* |
| Ga0182036_112107452 | 3300016270 | Soil | VGDRKAEEEPIAELWATTTTKRGARPADAQQARDL |
| Ga0182033_105728191 | 3300016319 | Soil | ERLSGGMDRKAEEEPIAELWATTTTPRAARPAVARQAE |
| Ga0182033_117769862 | 3300016319 | Soil | RAAVGGMDRKAEEEPIAELLATTTTQRDARPADAQQAGDLRDMA |
| Ga0182035_113182953 | 3300016341 | Soil | GGMDRKAEEEPIAELLATTTTPRGARPADAQQAGDLRDTP |
| Ga0182035_121718261 | 3300016341 | Soil | MGRWVGDRKAEEEPIAELLATTTTPRGARPADAQQAGDLR |
| Ga0182032_101549611 | 3300016357 | Soil | SRAVAGGMDRKAEEEFIAELWATTTTPRGARPADAQEARDLRDQDS |
| Ga0182032_107398061 | 3300016357 | Soil | RSLPSRAVAGGMDRKAEEEFIAELWATTTTPRGARPADAQQARDLRDTP |
| Ga0182037_103434061 | 3300016404 | Soil | RKAEEEFIAELWATTTTPRGARPADAQQARDLRDTL |
| Ga0182039_106321901 | 3300016422 | Soil | RKAEEEMIAELSATTTTPRDARPVAAQQAGDPRGMP |
| Ga0182039_120887441 | 3300016422 | Soil | MDRKAEEEPIAELLATTTTPRGARPADAQQAEDLRDTP |
| Ga0182038_121572651 | 3300016445 | Soil | AVAGGMDRKAEEETIVELSATTTTPRDVRPAAAQQAGDLRDMA |
| Ga0187775_101521501 | 3300017939 | Tropical Peatland | AVAGGMDRKAEEETIVELSATTTTPRDARPADAQQAEDLRDMP |
| Ga0187775_101708171 | 3300017939 | Tropical Peatland | MPSRAVADGMDRKAEEETIVELSATTTTPRDARPADAQQAG |
| Ga0187785_106773192 | 3300017947 | Tropical Peatland | MDRKAEEEPIVELSATTTTPRDARPADAQQAEDLRETP |
| Ga0187785_106978221 | 3300017947 | Tropical Peatland | MPSRAVAGGMDRKAEEETIVELSATTTTPRDARPAAAQQ |
| Ga0187776_104215721 | 3300017966 | Tropical Peatland | AGGMDRKAEEEPIVELSATTTTPRDARPADAQQAGDLGDMA |
| Ga0187776_107433692 | 3300017966 | Tropical Peatland | MPSRAVAGGMDRKAEEETIVELSATTTTPRDARPADA |
| Ga0187776_107953482 | 3300017966 | Tropical Peatland | KAEEEPIVELSATTTTPRDARPADAQQAGDLRGMA |
| Ga0187776_113136561 | 3300017966 | Tropical Peatland | GMDRKAEEETIVELSATTTTPRDARPADAQQAGDLRDMA |
| Ga0187776_114069731 | 3300017966 | Tropical Peatland | MPSRAGAGGMDRKAEEEPIVELSATRTTPRDARPADAQ |
| Ga0187780_100353735 | 3300017973 | Tropical Peatland | MDREAEEETIVELSATTTTPRDARLADAQQAEDLRDMP |
| Ga0187767_100614193 | 3300017999 | Tropical Peatland | PSRAGAGGMDRKAEEEPIVELSATTTTPRAARPAVAQQARDLRDMA |
| Ga0187788_100758411 | 3300018032 | Tropical Peatland | MPSRAVAGGMDRKAEEETIVELSATTTTPRDARPADAQQA |
| Ga0187788_101417113 | 3300018032 | Tropical Peatland | MDRKAEEETIVELSATTTTPRDARPADAQQAGIYEAWPKS |
| Ga0187766_101387491 | 3300018058 | Tropical Peatland | MPSRAVAGGMDRKAEEEPIVELSATTTTQRDARPAAAQQAEDLQDMP |
| Ga0187765_1000053711 | 3300018060 | Tropical Peatland | MDRKAEEETIVELSATTTTPRDARPADAQQAEDLRGMP |
| Ga0187765_100369961 | 3300018060 | Tropical Peatland | MGRRVGDRKAAEEETMVELPATTTTPRDARQAAAQQ |
| Ga0187765_100916633 | 3300018060 | Tropical Peatland | MPSRAVAGGMDRKAEEEPIVELSATTTTPRDARPAD |
| Ga0187765_101274203 | 3300018060 | Tropical Peatland | MDRKAEEEPIVELSATTTTPRAARPAVAQQARDLRD |
| Ga0187765_101867612 | 3300018060 | Tropical Peatland | MDRKAEEETIVELSAATAMQRDARPAAAQQAEDLQDMP |
| Ga0187765_105656822 | 3300018060 | Tropical Peatland | MPSRAVAGGMDRKAEEETIVELSATTTTQRDARPADAQQAGDL |
| Ga0187765_112531992 | 3300018060 | Tropical Peatland | MDRKAEEELIVELSATTTTRRDARPAYAQQAGDLGDMA |
| Ga0187773_100212532 | 3300018064 | Tropical Peatland | MDRKAEEELMVELSAAATTPRAARPAVAQQARDLRDMA |
| Ga0187773_100389174 | 3300018064 | Tropical Peatland | MPSRAADGGMDRKAEEELIVELSATTTTPRAARPAAA |
| Ga0187773_100448052 | 3300018064 | Tropical Peatland | MDRKAEKETIVELSATTTTPRDARPVAAQQAEDLREMP |
| Ga0187773_101053322 | 3300018064 | Tropical Peatland | MPSRAVAGGMDRKAEEETIVELSATTTTPRDARPADAQQAG |
| Ga0187773_103749062 | 3300018064 | Tropical Peatland | RSMPSRAGAGGMDRKAEEELIVELSAAAATPRDARPADAQQAGDLGDMA |
| Ga0187773_105276801 | 3300018064 | Tropical Peatland | MPSRAAVGGMDRKAEEETIVELSATTTTPRDARPADAQQAGDLRDMA |
| Ga0187773_106037271 | 3300018064 | Tropical Peatland | VAGGMDRKAEEEPIVELSATRTTPRDARPADAQQAGDLGDMA |
| Ga0187773_108151441 | 3300018064 | Tropical Peatland | MGRRVGDRKAEEETIVELSAATATPRDARPADAQQAGDLRDMA |
| Ga0187773_108418672 | 3300018064 | Tropical Peatland | VAGGMDRKAEEETIVELSATTTTPRDARPADAQQAEDLRDMP |
| Ga0187774_100858403 | 3300018089 | Tropical Peatland | VGDRKAEEEPIVELSATTTTPRDARPAGAQQAGDLRDMA |
| Ga0187774_102816021 | 3300018089 | Tropical Peatland | KAEEEPIVELSATRTTPRDARPADAQQAGDLGDTA |
| Ga0187774_104971352 | 3300018089 | Tropical Peatland | MDRKAEEELIVELSAAAATPRDARPADAQQAGDLGDMA |
| Ga0187774_110297552 | 3300018089 | Tropical Peatland | RAVAGGMDRKAEEETIVELSATTATPRDARPADAQQAGDLGDTA |
| Ga0190270_120165022 | 3300018469 | Soil | MVDRKAEEESIAVELSATTTTQRGAVLVVAQQIGGLGDTP |
| Ga0190267_101899641 | 3300019767 | Soil | MVDRKAEEEPTAELSATTTTRRDAVLASAQQAGDPGDTR |
| Ga0126371_103489652 | 3300021560 | Tropical Forest Soil | MPSRAAAGGMDRKAEEELIAELWATTTTLRAARPVDAQQAG |
| Ga0126371_103985131 | 3300021560 | Tropical Forest Soil | AAAGGMDRKAEEETIVELSATTTTPRDARPADAQQAGDLRDMA |
| Ga0126371_133065261 | 3300021560 | Tropical Forest Soil | DRKAEEEPIVELSATTTTPRDARPADAQQAEDLRDMP |
| Ga0126371_137538712 | 3300021560 | Tropical Forest Soil | AGGMYRKAEEEPIVELSAATTTPRDARPADAQQARDLWDMP |
| Ga0207700_102585331 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MGRRVGDRKAEEEFIAELWATTTTQRAARPAAAQQAE |
| Ga0207664_105275041 | 3300025929 | Agricultural Soil | VGDRKAEEEPIAELLATTTTQRGARPGDAQQARGLRDTP |
| Ga0208761_10270982 | 3300026995 | Soil | MGRWVGDRKAEEETIVELSATTTTPRDARPADAQQAGDLRDTA |
| Ga0208890_10060841 | 3300027523 | Soil | KAEEEPIVELSATTTTPRGARPAAAQQAGDLRDTPWS |
| Ga0209466_10145901 | 3300027646 | Tropical Forest Soil | RRRRQRRHRKAEEGLMVELSATAATPRETRPAAAQQAEDRQDMP |
| Ga0209073_102928671 | 3300027765 | Agricultural Soil | QSRAGAGGMDRKAEEETIVELSATTTTPRDARPADAQQAEDLLDMP |
| Ga0318516_100128391 | 3300031543 | Soil | RKAEEEPIAELWATTTTPRGARPADAQQARDLRDTP |
| Ga0318534_101887213 | 3300031544 | Soil | MDRKAEEEFIAELWATTTTPRGARPADAQQARDLRDTPEGA |
| Ga0318534_102423761 | 3300031544 | Soil | GGMDRKAEEEPIAELLATTTTPRGARPADAQQARDLRDMP |
| Ga0318534_106037201 | 3300031544 | Soil | DRKAEEELIAELWATTTTPRGARPADAQQARDLRDMP |
| Ga0318538_100152295 | 3300031546 | Soil | MGRKAEEEPIVELSATTTTPRNAPPVDAQQAEDLRDTP |
| Ga0318538_100594203 | 3300031546 | Soil | GMDRKAEEEPIAELLATTTTPRGARPADAQQAEDLRDTP |
| Ga0318538_101307662 | 3300031546 | Soil | MPSRAVAGGMDRKAEEETIVELSATTTTPRDARPVDAQQAGDL |
| Ga0318538_104402792 | 3300031546 | Soil | MDRKAEEEPIAELLATTTTPRGARPADAQQAEDLRDTPLGNPDQES |
| Ga0318571_102533572 | 3300031549 | Soil | MGREAEEEPIVELSATTTTPRNTPPVDAQQAEDLRDTP |
| Ga0318515_102845482 | 3300031572 | Soil | MGDRKAEEELIAELWATTTTPRGARPADAQQARDLRDMP |
| Ga0310915_102308843 | 3300031573 | Soil | MDRKAEEEPIAELLATTTTPRGARPADAQQAGDLRDTP |
| Ga0310915_104436571 | 3300031573 | Soil | KAVEEPIAELLATTTTPRGARPADAQQAGDLRDTP |
| Ga0318555_102301211 | 3300031640 | Soil | MDRKAEEEPIAELLATTTTPRGARPADAQQAEDLRD |
| Ga0318542_101762672 | 3300031668 | Soil | VGDRKAEEEPIAELLATTTTPRGARPADAQQAGDLRDTP |
| Ga0318572_108906472 | 3300031681 | Soil | DRKAEEEPIAELLATTTTPRGARPADAQQAGDLRDTP |
| Ga0318496_101138771 | 3300031713 | Soil | MPSRAAAGGMDRKAAEEPIAELLATTTTQRGARPVDAQQAR |
| Ga0318496_101338531 | 3300031713 | Soil | DRKAEEEFIAELWATTTTPRGARPADAQQARDLRDTP |
| Ga0318496_102859532 | 3300031713 | Soil | RRSLPSRAAVGGMDRKAEEEPIAELLATTTTQRGARPTNAQQARDLRDMP |
| Ga0306917_103602151 | 3300031719 | Soil | KAEEEPIAELLATTTTPRGARPADAQQARDLRDMP |
| Ga0306917_108200972 | 3300031719 | Soil | KAEEEPIVELSATTTTPRNAPPVDAQQAEDLRDTP |
| Ga0307469_100645293 | 3300031720 | Hardwood Forest Soil | MDRKAEEETIVELSATTTTPRDARPADAQQAGDLRDMA |
| Ga0318493_101460702 | 3300031723 | Soil | MPSRAVAGGMDRKAEEETIVELSATTTTPRDARPAAAQQAGDLRDMA |
| Ga0318500_100745573 | 3300031724 | Soil | MDRKAEEEFIAELWATTTTPRGARPADAQQARDLRAAR |
| Ga0318500_100829481 | 3300031724 | Soil | MDRKAEEEFIAELWATTTTPRGARPADAQQARDLRDTL |
| Ga0318500_101549071 | 3300031724 | Soil | RAVAGGMDRKAEEEFIAELWATTTTPRGARPADAQQARDLRDAP |
| Ga0318500_103496481 | 3300031724 | Soil | MDRKAEEEFIAELWATTTTPRGARPADAQQARDLRDTP |
| Ga0318501_101727141 | 3300031736 | Soil | LTLVSRRSLPSRAVAGGMDRKAEEEFIAELWATTTTPRGARPADAQQARDLRDTP |
| Ga0306918_101732061 | 3300031744 | Soil | MHRKAEEETMAELLATTTTPRGARPADAQQARDLRDTP |
| Ga0318502_103511721 | 3300031747 | Soil | RVDRKAEEELIAELWATTTTPRGARPADAQQARDLRDMP |
| Ga0318492_100851863 | 3300031748 | Soil | KAEEKPIVELSATTTTPRNAPPVDAQQAEDLRDTP |
| Ga0318492_103084622 | 3300031748 | Soil | RKAEEEFIAELWATTTTPRGARPADAQQARDLRDTP |
| Ga0318554_102173841 | 3300031765 | Soil | GKGRRVGDRKAEEEFIAELLATTTTPRGARPADAQQARDLRDMP |
| Ga0318509_101027151 | 3300031768 | Soil | AAAGGMHRKAEEETMAELLATTTTPRGARPADAQQARDLRDMP |
| Ga0318526_102474961 | 3300031769 | Soil | GRKAEEKPIVELSATTTTPRNAPPVDAQQAEDLRDTP |
| Ga0318526_102948481 | 3300031769 | Soil | GPQGGEEPIVELSATTTTPRNAPPVDAQQAEDLRDTP |
| Ga0318546_107232242 | 3300031771 | Soil | MAEEEPIVELSATTTTPRNAPPVDAQQAEDLRDTP |
| Ga0318543_104193751 | 3300031777 | Soil | MPSRSAAGGMHRKAEEEPIAELLATTTTQRGARPVDAQQAE |
| Ga0318498_100099501 | 3300031778 | Soil | GEEEEPIAELLATTTTPRGARPADAQQARDLRDMP |
| Ga0318498_100730311 | 3300031778 | Soil | VAGGMDRKAEEEFIAELWATTTTPRGARPADAQQARDLRDTP |
| Ga0318566_101343472 | 3300031779 | Soil | VVGGMDRKAEEERMAEPWATTTTPRGARPADAQQAGDLRGMP |
| Ga0318547_101021941 | 3300031781 | Soil | GMDRKTEEEFIAELWATTTTPRGARPADAQQARDLRDTP |
| Ga0318548_104767712 | 3300031793 | Soil | MGRRVGDRKAEEEFIAELWATTTTPRGARPADAQQARD |
| Ga0318503_100366531 | 3300031794 | Soil | PSRAAVGGMDRKAEEEPIAELLATTTTQRDARPADAQQAGDLRDMA |
| Ga0318557_102669991 | 3300031795 | Soil | RSLPSRAVAGGMDRKAEEEFIAKLWATTTTPRGARPADAQQARDLRDTP |
| Ga0318550_101376171 | 3300031797 | Soil | MDRKAEEEPIVELSATRTTLRAARPAAAQQARDLRD |
| Ga0318523_103503691 | 3300031798 | Soil | RKAEEEPIAELLATTTTPRGARPADAQQAGDLRDTP |
| Ga0318564_100139554 | 3300031831 | Soil | SGGMGRKAEEEPIVELSATTTTPRNAPPVDAQQAEDLRDTP |
| Ga0318564_100205791 | 3300031831 | Soil | AGGMDRKAEEEPIAELLATTTTPRGARPAGAQQAGDLRDMP |
| Ga0318564_103757531 | 3300031831 | Soil | RKAEEEPIVELSATTTTPRDARPAAAQQAGDLRDTA |
| Ga0318512_100899841 | 3300031846 | Soil | VGDRKAEEEFIAELWATTTTPRGARPADAQQARDLRDTP |
| Ga0306919_101501941 | 3300031879 | Soil | SRRSWPSRAAAGGMDRKAEEEPIAELLATTTTPRGARPADAQQAGDLRDTP |
| Ga0306919_105724862 | 3300031879 | Soil | DRKAEEEPIAELWATTTTKRGARPADAQQARDLRGMP |
| Ga0306925_100626431 | 3300031890 | Soil | AVAGGMDRKAEEEFIAELWATTTTPRGARPADAQQARDLRDTP |
| Ga0306925_102602901 | 3300031890 | Soil | KAEEEPIVELSATTTTPRNAPPVDAQQAKDLRDTP |
| Ga0306925_108054301 | 3300031890 | Soil | KAEEEFIAELWATTTTPRGARPADAQQARDLRDTP |
| Ga0306925_108164392 | 3300031890 | Soil | AVAGGMDRKAEEEFIAELWATTTTPRGARPADAQQARDLRDTL |
| Ga0318536_101475971 | 3300031893 | Soil | AAAGGMDRKAEEEPIAELLATTTTPRGARPADAQQAGDLRDMP |
| Ga0318536_102303242 | 3300031893 | Soil | RKAEEEPIAELLATTTTPRGARPADAQQARDLRDMP |
| Ga0318551_106364322 | 3300031896 | Soil | AAAGGMDRKAEEEPIVVLWATTTTQRGARPVDAQQAE |
| Ga0306923_101171002 | 3300031910 | Soil | MGRKAEEKPIVELSATTTTPRNAPPVDAQQAEDLRDTP |
| Ga0306921_102861181 | 3300031912 | Soil | AAAGGMDRKAEEEPIAELLATTTTPRGARPADAQQAEDLRDTP |
| Ga0310912_102148942 | 3300031941 | Soil | GMDRKAEEEPIAELLATTTTPRGARPADAQQARDLRDMP |
| Ga0310913_100851551 | 3300031945 | Soil | GVGGMDRKAEEEPIAELLATTTTPRGARPADAQQAGDLRETP |
| Ga0310913_101742612 | 3300031945 | Soil | RKAEEEFIAELWATTTTPRGARPADAQQARDLRDAP |
| Ga0310913_103142601 | 3300031945 | Soil | AGGMDRKTEEEFIAELWATTTTPRGARPADAQQARDLRDTP |
| Ga0310913_104924901 | 3300031945 | Soil | KAEEEPIAELLATTTTPRGARPADAQQAGDLRDMP |
| Ga0310910_105164002 | 3300031946 | Soil | AGGMDRKAEEEPIAELLATTTTPRGARPADAQQAGDLRDTP |
| Ga0310910_110721982 | 3300031946 | Soil | RLPREGVSHRSMPSRAAAGGMHRKAEEEPTAELLATTTTQRGARPAAAQQAE |
| Ga0310909_110307081 | 3300031947 | Soil | GGMDRKAEEEFIAELWATTTTPRGARPADAQQARDLRDTP |
| Ga0310909_116438892 | 3300031947 | Soil | MGRRVGDRKAEEEFIAELLATTTTPRGARPADAQQARD |
| Ga0318530_103922481 | 3300031959 | Soil | SRGSMPSRAAVGGMDRKAEEEPIAELLATTTTQRDARPADAQQAGDLRDMA |
| Ga0306922_117859892 | 3300032001 | Soil | VGDRKAEEEPIAELLATTTTPRGARPADAQQARDLRDMP |
| Ga0318562_100687031 | 3300032008 | Soil | DRKVEEEPIAELLATTTTPRGARPADAQQAEDLRDTP |
| Ga0318563_107578243 | 3300032009 | Soil | QAEEEFIAELWATTTTPRGARPADAQQARDLRDTP |
| Ga0318569_100517604 | 3300032010 | Soil | VADGMDRKAEEEFIAELWATTTTPRGARPADAQQARDLRDTP |
| Ga0318569_101368601 | 3300032010 | Soil | VMSRGSMPSRAAVGGMDRKAEEEPIAELLATTTTQRDARPADAQQAGDLRDMA |
| Ga0318569_101467551 | 3300032010 | Soil | GRKAEEEPIVELSATTTTPRNAPPVDAQQAEDLRDTP |
| Ga0318569_102701621 | 3300032010 | Soil | RKAEEELIAELWATTTTPRGARPADAQQARDLRDMP |
| Ga0310911_102098471 | 3300032035 | Soil | DRKGEEEPIAELLATTTTPRGARPADAQQARDLRDMP |
| Ga0310911_109039492 | 3300032035 | Soil | KAEEEPIAELLATTTTPRGARPADAQQAGDLRDTP |
| Ga0318559_101129561 | 3300032039 | Soil | MDRKAEEEPIAELLATTTTPRGARPADAQQAGELRD |
| Ga0318559_104633672 | 3300032039 | Soil | MPSRAVAGGMDRKAEEETIVELSATTTTPRDVRPAAAQQAGDLRDMA |
| Ga0318559_105911002 | 3300032039 | Soil | GMDRKAEEEPIAELLATTTTPRGARPADAQQAGDLRDTP |
| Ga0318549_104555451 | 3300032041 | Soil | MPSRAVAGGMDRKAEEETIVELSATTTTPRDARPAGAQQAGDLRDMAYAAPCSRR |
| Ga0318556_100433503 | 3300032043 | Soil | GMGRKAEEEPIVELSATTTTPRNAPPVDAQQAEDLRDTP |
| Ga0318558_101851453 | 3300032044 | Soil | GDRKAEEEPIAELWATTTTKRGARPADAQQARDLRGMP |
| Ga0318558_105173921 | 3300032044 | Soil | RLSGGMDRKAEEELIAELWATTTTQRAARPAVAQQAE |
| Ga0318506_100672981 | 3300032052 | Soil | GGMDRKAEEEPIAELLATTTTPRGARPAGAQQAGDLRDTP |
| Ga0318510_101124932 | 3300032064 | Soil | MGRKAEEEPIVELSATTTTPRNAPPVDAQQAKDLRDTP |
| Ga0318510_101512322 | 3300032064 | Soil | DRTAVEEPIAELLATTTTPRGARPADAQQAGDLRDTP |
| Ga0318510_102705962 | 3300032064 | Soil | DRTAEEEPIAELLATTTTPRGARPADAQQAGDLRDTP |
| Ga0318513_100161311 | 3300032065 | Soil | SEGMGRKAEEEPIVELSATTTTPRNAPPVDAQQAEDLRDTP |
| Ga0318524_102215592 | 3300032067 | Soil | GMGRWVGDRKAEEEPIAELLATTTTPRGARPADAQQAGDLRDTP |
| Ga0318524_104961731 | 3300032067 | Soil | MDRKAEEEPIAELRVTTTTPRGARPVDAQQAGDLRDTPYRRGSLA |
| Ga0318524_106941021 | 3300032067 | Soil | MGRRVGDRKAEEEPMAELLATTTTPRGARPADAQQARDLRDM |
| Ga0306924_109115801 | 3300032076 | Soil | MGRRVGDRKAEEEFIAELLATTTTPRGARPADAQQAR |
| Ga0318518_106197991 | 3300032090 | Soil | VGDRKAEEEPIAELWATTTTKRGARPADAQQARDLRGMP |
| Ga0307472_1025740202 | 3300032205 | Hardwood Forest Soil | AGAGGMDRKAEEEPIAELWATTTTPRGARPVDAQQAG |
| Ga0335082_102556202 | 3300032782 | Soil | MPSRAVGGGMDRKAEEELIVELSATTTTPRAARPAVA |
| Ga0335079_100485823 | 3300032783 | Soil | MPSRAVAGGMDRKAEKEPIVELSATTATPRDARPTAAQQARDLYGMA |
| Ga0335079_114822441 | 3300032783 | Soil | RAAASGMDREAEEETIVELSATTTTPRDARLADAQQAEDLRDMP |
| Ga0335080_105039232 | 3300032828 | Soil | MKGKGRRVGYRKAEEETIVELSATTTTPRDARPAAAQQAGDLRDTA |
| Ga0335080_110245452 | 3300032828 | Soil | MPSRAVVGGMDRKAEEELIVELSATTTTQRDARPAAAQQA |
| Ga0335080_110510861 | 3300032828 | Soil | MGRRVGDREAEEELIVVELSATTATRRDARPAYAQQAGDLGDMA |
| Ga0335080_114094831 | 3300032828 | Soil | MDRKAEEEPIVELSATTTTPRDARPADAQQAGIYEAWPK |
| Ga0335080_115567381 | 3300032828 | Soil | GKGRRVGDRKAEEETIVELSATTATQRHARPGAAQQAEDLQDMA |
| Ga0335076_103693474 | 3300032955 | Soil | MDRVAEEETIVELSATTTPRDPRPADAQQAEDPRDMPQ |
| Ga0335076_107940901 | 3300032955 | Soil | KAEEEPVVELSATRTTPRDARPADAQQAEDPRDTP |
| Ga0335076_112679921 | 3300032955 | Soil | KAEEETIVELSATTTTPRDARPVAAQQAEDPRDMP |
| Ga0335084_105066801 | 3300033004 | Soil | MDRKAEEQPTVELSATTTLPRGTRPVAVQQAGDLPDT |
| Ga0335077_102404221 | 3300033158 | Soil | DRKAEEETIVELSAATTMQRAARPAVAQQARDLRDMA |
| Ga0335077_107509161 | 3300033158 | Soil | MDREAEEETIVELSATTTTPRDARPADEQQAEDLRDMP |
| Ga0318519_101913761 | 3300033290 | Soil | WVGDRKAEEEPIAELLATTTTPRGARPADAQQARDLRDMP |
| Ga0314864_0040561_496_636 | 3300033805 | Peatland | MKGDGRRAGDRKAEEETIVELSATTTTPRDARPAAAQQAEDLWDAP |
| ⦗Top⦘ |