NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F011741

Metagenome / Metatranscriptome Family F011741

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F011741
Family Type Metagenome / Metatranscriptome
Number of Sequences 287
Average Sequence Length 39 residues
Representative Sequence MAENRLTRELETRQTTERPKQWAPAELLPEPDKQPG
Number of Associated Samples 211
Number of Associated Scaffolds 287

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 99.64 %
% of genes near scaffold ends (potentially truncated) 96.52 %
% of genes from short scaffolds (< 2000 bps) 87.46 %
Associated GOLD sequencing projects 196
AlphaFold2 3D model prediction Yes
3D model pTM-score0.21

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (52.613 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(24.042 % of family members)
Environment Ontology (ENVO) Unclassified
(62.369 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(71.429 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.69%    β-sheet: 0.00%    Coil/Unstructured: 95.31%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.21
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 287 Family Scaffolds
PF03237Terminase_6N 2.09
PF00166Cpn10 1.39
PF14890Intein_splicing 0.35
PF00271Helicase_C 0.35

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 287 Family Scaffolds
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 1.39


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A52.61 %
All OrganismsrootAll Organisms47.39 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000177|TB18AUG2009H_c020316Not Available638Open in IMG/M
3300000439|TBL_comb48_EPIDRAFT_1014238All Organisms → Viruses → Predicted Viral4028Open in IMG/M
3300001837|RCM39_1055206Not Available681Open in IMG/M
3300001842|RCM30_1021134All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage525Open in IMG/M
3300001842|RCM30_1034385All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1681Open in IMG/M
3300001843|RCM34_1153797Not Available538Open in IMG/M
3300002199|metazooDRAFT_1223402Not Available501Open in IMG/M
3300002408|B570J29032_109209052All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage636Open in IMG/M
3300002408|B570J29032_109755412Not Available1219Open in IMG/M
3300003277|JGI25908J49247_10043593Not Available1200Open in IMG/M
3300003277|JGI25908J49247_10134871Not Available580Open in IMG/M
3300003411|JGI25911J50253_10099831All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage887Open in IMG/M
3300003429|JGI25914J50564_10045765Not Available1198Open in IMG/M
3300003806|Ga0007864_1015651Not Available566Open in IMG/M
3300004481|Ga0069718_13253462Not Available631Open in IMG/M
3300004767|Ga0007750_1423836Not Available535Open in IMG/M
3300004804|Ga0007796_10187660All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage611Open in IMG/M
3300005527|Ga0068876_10041469All Organisms → Viruses → Predicted Viral2837Open in IMG/M
3300005581|Ga0049081_10192222Not Available734Open in IMG/M
3300005805|Ga0079957_1063173All Organisms → Viruses → Predicted Viral2183Open in IMG/M
3300006030|Ga0075470_10094281Not Available898Open in IMG/M
3300006030|Ga0075470_10109355Not Available823Open in IMG/M
3300006071|Ga0007876_1003309All Organisms → cellular organisms → Bacteria → Proteobacteria5037Open in IMG/M
3300006071|Ga0007876_1103739All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage733Open in IMG/M
3300006112|Ga0007857_1054554Not Available763Open in IMG/M
3300006128|Ga0007828_1021193Not Available1366Open in IMG/M
3300006802|Ga0070749_10710016All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage537Open in IMG/M
3300006803|Ga0075467_10584149All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage571Open in IMG/M
3300006920|Ga0070748_1323972All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage546Open in IMG/M
3300007541|Ga0099848_1148122Not Available871Open in IMG/M
3300007864|Ga0105749_1008340Not Available1681Open in IMG/M
3300007973|Ga0105746_1044111Not Available1389Open in IMG/M
3300007983|Ga0102941_1322926All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage525Open in IMG/M
3300008114|Ga0114347_1056973All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1641Open in IMG/M
3300008116|Ga0114350_1060506All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1334Open in IMG/M
3300008266|Ga0114363_1161429Not Available732Open in IMG/M
3300008266|Ga0114363_1205549Not Available600Open in IMG/M
3300008448|Ga0114876_1117481All Organisms → Viruses → Predicted Viral1026Open in IMG/M
3300009009|Ga0105105_10540393All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage672Open in IMG/M
3300009009|Ga0105105_10760430Not Available582Open in IMG/M
3300009037|Ga0105093_10307612All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage845Open in IMG/M
3300009082|Ga0105099_10706827All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage625Open in IMG/M
3300009151|Ga0114962_10051928All Organisms → Viruses → Predicted Viral2695Open in IMG/M
3300009151|Ga0114962_10303549All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage890Open in IMG/M
3300009152|Ga0114980_10000474Not Available29407Open in IMG/M
3300009155|Ga0114968_10007822Not Available7821Open in IMG/M
3300009159|Ga0114978_10551578All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage671Open in IMG/M
3300009161|Ga0114966_10703705Not Available553Open in IMG/M
3300009164|Ga0114975_10001010Not Available20563Open in IMG/M
3300009165|Ga0105102_10260373Not Available886Open in IMG/M
3300009165|Ga0105102_10341749All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage784Open in IMG/M
3300009168|Ga0105104_10973647Not Available501Open in IMG/M
3300009169|Ga0105097_10126762All Organisms → Viruses → Predicted Viral1400Open in IMG/M
3300009183|Ga0114974_10815475Not Available500Open in IMG/M
3300009184|Ga0114976_10133444Not Available1400Open in IMG/M
3300009186|Ga0114965_11567Not Available1159Open in IMG/M
3300009187|Ga0114972_10457117Not Available728Open in IMG/M
3300010334|Ga0136644_10083846Not Available2000Open in IMG/M
3300010334|Ga0136644_10383741All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage799Open in IMG/M
3300010354|Ga0129333_10606178All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage950Open in IMG/M
3300010370|Ga0129336_10533410Not Available630Open in IMG/M
3300010885|Ga0133913_10209194Not Available5198Open in IMG/M
3300010885|Ga0133913_11500219All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1708Open in IMG/M
3300010885|Ga0133913_13629990Not Available1001Open in IMG/M
3300011010|Ga0139557_1047145All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage738Open in IMG/M
3300011995|Ga0153800_1029456All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage575Open in IMG/M
3300012665|Ga0157210_1016206Not Available1238Open in IMG/M
3300012707|Ga0157623_1023879Not Available505Open in IMG/M
3300012717|Ga0157609_1227112All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage516Open in IMG/M
3300012721|Ga0157612_1053161All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage516Open in IMG/M
3300012760|Ga0138273_1125220Not Available614Open in IMG/M
3300012766|Ga0138282_1003668Not Available765Open in IMG/M
3300012766|Ga0138282_1240727Not Available514Open in IMG/M
3300013089|Ga0163203_1114007Not Available809Open in IMG/M
(restricted) 3300013132|Ga0172372_10481927All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage826Open in IMG/M
3300013286|Ga0136641_1056691Not Available1131Open in IMG/M
3300013295|Ga0170791_11995325All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage508Open in IMG/M
3300014502|Ga0182021_11250538All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage894Open in IMG/M
3300014502|Ga0182021_13325602Not Available536Open in IMG/M
3300014811|Ga0119960_1002701All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1093Open in IMG/M
3300014962|Ga0134315_1028284Not Available869Open in IMG/M
3300014962|Ga0134315_1058980Not Available590Open in IMG/M
3300015050|Ga0181338_1001643Not Available4017Open in IMG/M
3300015050|Ga0181338_1011700All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1430Open in IMG/M
3300015050|Ga0181338_1042023Not Available678Open in IMG/M
3300017700|Ga0181339_1034455Not Available553Open in IMG/M
3300017701|Ga0181364_1059307All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage593Open in IMG/M
3300017722|Ga0181347_1026187All Organisms → Viruses → Predicted Viral1826Open in IMG/M
3300017722|Ga0181347_1041831All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1403Open in IMG/M
3300017722|Ga0181347_1076978Not Available977Open in IMG/M
3300017722|Ga0181347_1194045All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage536Open in IMG/M
3300017723|Ga0181362_1046457All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage908Open in IMG/M
3300017736|Ga0181365_1025525All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1490Open in IMG/M
3300017736|Ga0181365_1029372Not Available1387Open in IMG/M
3300017747|Ga0181352_1010660Not Available2976Open in IMG/M
3300017747|Ga0181352_1076723Not Available938Open in IMG/M
3300017747|Ga0181352_1085500Not Available878Open in IMG/M
3300017754|Ga0181344_1036504All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1492Open in IMG/M
3300017754|Ga0181344_1056246All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1169Open in IMG/M
3300017754|Ga0181344_1064740All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1081Open in IMG/M
3300017754|Ga0181344_1070622All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1030Open in IMG/M
3300017754|Ga0181344_1097337All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage856Open in IMG/M
3300017761|Ga0181356_1222078Not Available550Open in IMG/M
3300017766|Ga0181343_1049363All Organisms → Viruses → Predicted Viral1240Open in IMG/M
3300017766|Ga0181343_1135776Not Available688Open in IMG/M
3300017766|Ga0181343_1156927All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage633Open in IMG/M
3300017766|Ga0181343_1182780All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage578Open in IMG/M
3300017774|Ga0181358_1016259Not Available3009Open in IMG/M
3300017778|Ga0181349_1081424All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1231Open in IMG/M
3300017778|Ga0181349_1126610All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage937Open in IMG/M
3300017778|Ga0181349_1263060All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage571Open in IMG/M
3300017778|Ga0181349_1303227Not Available517Open in IMG/M
3300017780|Ga0181346_1014769Not Available3312Open in IMG/M
3300017784|Ga0181348_1060097All Organisms → Viruses → Predicted Viral1539Open in IMG/M
3300017784|Ga0181348_1085535All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1246Open in IMG/M
3300017785|Ga0181355_1035816All Organisms → Viruses → Predicted Viral2133Open in IMG/M
3300017785|Ga0181355_1041173Not Available1980Open in IMG/M
3300017785|Ga0181355_1273209Not Available642Open in IMG/M
3300017785|Ga0181355_1305793Not Available595Open in IMG/M
3300017963|Ga0180437_10303490All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1215Open in IMG/M
3300017987|Ga0180431_10983140All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage556Open in IMG/M
3300017991|Ga0180434_10434957All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1014Open in IMG/M
3300018080|Ga0180433_11249992All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage538Open in IMG/M
3300018868|Ga0187844_10204172All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage848Open in IMG/M
3300019784|Ga0181359_1085001All Organisms → Viruses → Predicted Viral1180Open in IMG/M
3300019784|Ga0181359_1119264All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage945Open in IMG/M
3300019784|Ga0181359_1143885All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage826Open in IMG/M
3300019784|Ga0181359_1261723Not Available518Open in IMG/M
3300019784|Ga0181359_1269340All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage506Open in IMG/M
3300020048|Ga0207193_1286771All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1198Open in IMG/M
3300020048|Ga0207193_1619709All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage719Open in IMG/M
3300020048|Ga0207193_1792704All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage601Open in IMG/M
3300020083|Ga0194111_10851558Not Available545Open in IMG/M
3300020159|Ga0211734_10932539Not Available519Open in IMG/M
3300020204|Ga0194116_10563129Not Available521Open in IMG/M
3300020221|Ga0194127_10059013Not Available3010Open in IMG/M
3300020513|Ga0208090_1027996Not Available784Open in IMG/M
3300020710|Ga0214198_1003923All Organisms → Viruses → Predicted Viral2129Open in IMG/M
3300020731|Ga0214170_1039569Not Available723Open in IMG/M
3300021128|Ga0214176_1006046All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1385Open in IMG/M
3300021131|Ga0214206_1017173Not Available925Open in IMG/M
3300021136|Ga0214167_1094840Not Available553Open in IMG/M
3300021139|Ga0214166_1004597Not Available4688Open in IMG/M
3300021139|Ga0214166_1075782All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage689Open in IMG/M
3300021140|Ga0214168_1110669Not Available581Open in IMG/M
3300021142|Ga0214192_1012634All Organisms → Viruses → Predicted Viral3309Open in IMG/M
3300021424|Ga0194117_10124222All Organisms → Viruses → Predicted Viral1345Open in IMG/M
3300021438|Ga0213920_1047750All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage899Open in IMG/M
3300021956|Ga0213922_1084207Not Available658Open in IMG/M
3300021956|Ga0213922_1124380Not Available506Open in IMG/M
3300022063|Ga0212029_1012901All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1055Open in IMG/M
3300022179|Ga0181353_1159046All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage515Open in IMG/M
3300022179|Ga0181353_1159354All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage514Open in IMG/M
3300022190|Ga0181354_1090021All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1006Open in IMG/M
3300022190|Ga0181354_1106050All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage912Open in IMG/M
3300022200|Ga0196901_1228446All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage586Open in IMG/M
3300022407|Ga0181351_1000327Not Available13145Open in IMG/M
3300022407|Ga0181351_1092351All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1185Open in IMG/M
3300022407|Ga0181351_1239241All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage574Open in IMG/M
3300022407|Ga0181351_1245032All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage562Open in IMG/M
3300022752|Ga0214917_10259696Not Available803Open in IMG/M
3300024306|Ga0255148_1063318Not Available644Open in IMG/M
3300024484|Ga0256332_1147506Not Available504Open in IMG/M
3300024536|Ga0256338_1159748Not Available504Open in IMG/M
3300024541|Ga0256343_1095068Not Available519Open in IMG/M
3300024557|Ga0255283_1098980Not Available625Open in IMG/M
3300024574|Ga0255275_1146695Not Available636Open in IMG/M
3300024862|Ga0256317_1153444Not Available500Open in IMG/M
3300024863|Ga0255246_1110069All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage642Open in IMG/M
3300024863|Ga0255246_1163681Not Available515Open in IMG/M
3300025075|Ga0209615_102103All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1291Open in IMG/M
3300025336|Ga0208619_116220Not Available550Open in IMG/M
3300025358|Ga0208504_1033057Not Available655Open in IMG/M
3300025369|Ga0208382_1012997All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1245Open in IMG/M
3300025372|Ga0207957_1007238Not Available1650Open in IMG/M
3300025383|Ga0208250_1033193All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage805Open in IMG/M
3300025389|Ga0208257_1000883Not Available7808Open in IMG/M
3300025389|Ga0208257_1009488All Organisms → Viruses → Predicted Viral1658Open in IMG/M
3300025396|Ga0208874_1001445Not Available6773Open in IMG/M
3300025400|Ga0208387_1045255Not Available703Open in IMG/M
3300025400|Ga0208387_1067983Not Available532Open in IMG/M
3300025407|Ga0208378_1077950Not Available511Open in IMG/M
3300025416|Ga0208877_1045285Not Available717Open in IMG/M
3300025426|Ga0208739_1004756Not Available2890Open in IMG/M
3300025466|Ga0208497_1049045Not Available851Open in IMG/M
3300025606|Ga0207954_1037394Not Available1381Open in IMG/M
3300025646|Ga0208161_1170139Not Available524Open in IMG/M
3300025647|Ga0208160_1035117All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1496Open in IMG/M
3300025647|Ga0208160_1168778Not Available517Open in IMG/M
3300025648|Ga0208507_1013943Not Available3207Open in IMG/M
3300025749|Ga0256314_1041746All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage677Open in IMG/M
3300025757|Ga0256313_1066631Not Available535Open in IMG/M
3300025757|Ga0256313_1075802Not Available501Open in IMG/M
3300025777|Ga0208110_1011783All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1027Open in IMG/M
3300025779|Ga0208869_1018406Not Available943Open in IMG/M
3300025838|Ga0208872_1039541Not Available2031Open in IMG/M
3300025838|Ga0208872_1065321Not Available1457Open in IMG/M
3300026454|Ga0256319_1117955All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage518Open in IMG/M
3300026562|Ga0255285_1106135Not Available540Open in IMG/M
3300026573|Ga0255269_1223587All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage500Open in IMG/M
3300027136|Ga0255107_1059950All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage610Open in IMG/M
3300027468|Ga0209247_1066983Not Available531Open in IMG/M
3300027534|Ga0255125_1124677Not Available515Open in IMG/M
3300027586|Ga0208966_1173181All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage562Open in IMG/M
3300027600|Ga0255117_1097127Not Available558Open in IMG/M
3300027621|Ga0208951_1169377All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage560Open in IMG/M
3300027659|Ga0208975_1011387Not Available3044Open in IMG/M
3300027659|Ga0208975_1106620Not Available810Open in IMG/M
3300027697|Ga0209033_1239265All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage527Open in IMG/M
3300027708|Ga0209188_1188691Not Available750Open in IMG/M
3300027734|Ga0209087_1089165All Organisms → Viruses1326Open in IMG/M
3300027747|Ga0209189_1073148Not Available1593Open in IMG/M
3300027747|Ga0209189_1404332All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage506Open in IMG/M
3300027749|Ga0209084_1111302Not Available1192Open in IMG/M
3300027749|Ga0209084_1330259All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage565Open in IMG/M
3300027754|Ga0209596_1356817Not Available562Open in IMG/M
3300027763|Ga0209088_10237115All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage763Open in IMG/M
3300027785|Ga0209246_10171939All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage850Open in IMG/M
3300027785|Ga0209246_10177419Not Available836Open in IMG/M
3300027792|Ga0209287_10404694Not Available525Open in IMG/M
3300027798|Ga0209353_10048245All Organisms → Viruses → Predicted Viral1961Open in IMG/M
3300027798|Ga0209353_10109050Not Available1247Open in IMG/M
3300027798|Ga0209353_10253848Not Available756Open in IMG/M
3300027798|Ga0209353_10388534All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage575Open in IMG/M
3300027798|Ga0209353_10405497All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage559Open in IMG/M
3300027808|Ga0209354_10107541All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1138Open in IMG/M
3300027808|Ga0209354_10293248All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage648Open in IMG/M
3300027808|Ga0209354_10347115Not Available584Open in IMG/M
3300027892|Ga0209550_10217520All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1289Open in IMG/M
3300027896|Ga0209777_10349565All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1127Open in IMG/M
3300027901|Ga0209427_10897661All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage616Open in IMG/M
3300027902|Ga0209048_10696905Not Available669Open in IMG/M
3300027917|Ga0209536_101562953Not Available801Open in IMG/M
3300027963|Ga0209400_1038435Not Available2584Open in IMG/M
3300027969|Ga0209191_1043249All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2091Open in IMG/M
3300027969|Ga0209191_1323841Not Available564Open in IMG/M
3300028261|Ga0256316_1081914All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage563Open in IMG/M
3300028271|Ga0255256_1088917Not Available539Open in IMG/M
3300028392|Ga0304729_1259662All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage520Open in IMG/M
3300028394|Ga0304730_1216843All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage712Open in IMG/M
3300028394|Ga0304730_1271982Not Available599Open in IMG/M
3300028530|Ga0255279_1041654All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage796Open in IMG/M
(restricted) 3300028571|Ga0247844_1078878Not Available1634Open in IMG/M
3300031539|Ga0307380_10532040All Organisms → Viruses → Predicted Viral1026Open in IMG/M
3300031566|Ga0307378_10880531Not Available744Open in IMG/M
3300031669|Ga0307375_10221896Not Available1255Open in IMG/M
3300031707|Ga0315291_10975787Not Available716Open in IMG/M
3300031707|Ga0315291_11040977Not Available685Open in IMG/M
3300031758|Ga0315907_10282021Not Available1369Open in IMG/M
3300031787|Ga0315900_10373819All Organisms → Viruses → Predicted Viral1138Open in IMG/M
3300031787|Ga0315900_10646478All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage762Open in IMG/M
3300031813|Ga0316217_10091581All Organisms → Viruses → Predicted Viral1428Open in IMG/M
3300031857|Ga0315909_10881885All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage554Open in IMG/M
3300031857|Ga0315909_11000672All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage505Open in IMG/M
3300031885|Ga0315285_10752236Not Available619Open in IMG/M
3300031951|Ga0315904_10410338All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1224Open in IMG/M
3300031951|Ga0315904_10705074Not Available848Open in IMG/M
3300031951|Ga0315904_11272706All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage559Open in IMG/M
3300031952|Ga0315294_10510530All Organisms → Viruses → Predicted Viral1097Open in IMG/M
3300032046|Ga0315289_11331886Not Available564Open in IMG/M
3300032116|Ga0315903_10482884All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage984Open in IMG/M
3300032156|Ga0315295_11944290Not Available554Open in IMG/M
3300032177|Ga0315276_12089841Not Available576Open in IMG/M
3300032668|Ga0316230_1044621Not Available2000Open in IMG/M
3300033488|Ga0316621_10248855All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1140Open in IMG/M
3300033521|Ga0316616_103125075Not Available624Open in IMG/M
3300033979|Ga0334978_0065882All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1863Open in IMG/M
3300034062|Ga0334995_0213473All Organisms → Viruses → Predicted Viral1330Open in IMG/M
3300034062|Ga0334995_0764625Not Available534Open in IMG/M
3300034082|Ga0335020_0398340Not Available663Open in IMG/M
3300034101|Ga0335027_0289134All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1113Open in IMG/M
3300034102|Ga0335029_0713866Not Available542Open in IMG/M
3300034112|Ga0335066_0297867All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage914Open in IMG/M
3300034112|Ga0335066_0574594All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage586Open in IMG/M
3300034116|Ga0335068_0215923All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage998Open in IMG/M
3300034120|Ga0335056_0023025All Organisms → Viruses → Predicted Viral4300Open in IMG/M
3300034120|Ga0335056_0270735All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage952Open in IMG/M
3300034166|Ga0335016_0138351Not Available1679Open in IMG/M
3300034200|Ga0335065_0627128Not Available624Open in IMG/M
3300034283|Ga0335007_0596402All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage640Open in IMG/M
3300034284|Ga0335013_0794805Not Available530Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake24.04%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake11.50%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater9.76%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater7.67%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater7.32%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.53%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater3.48%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment3.14%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater3.14%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.44%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.74%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.74%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.74%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater1.39%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.39%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton1.39%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment1.39%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment1.05%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater1.05%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.05%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.70%
Surface WaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water0.70%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.70%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.70%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.70%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.70%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.70%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.35%
LakeEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake0.35%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.35%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.35%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.35%
AquaticEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic0.35%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater0.35%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.35%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.35%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.35%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.35%
Pond SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil0.35%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000177Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 hypolimnionEnvironmentalOpen in IMG/M
3300000439Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem)EnvironmentalOpen in IMG/M
3300001837Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM39, ROCA_DNA237_0.2um_Ob_C_3aEnvironmentalOpen in IMG/M
3300001842Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2bEnvironmentalOpen in IMG/M
3300001843Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM34, ROCA_DNA218_2.0um_bLM_C_2bEnvironmentalOpen in IMG/M
3300002199Freshwater microbial communities from San Paulo Zoo lake, Brazil - JUN 2013EnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300003411Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SDEnvironmentalOpen in IMG/M
3300003429Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300003806Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07EnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300004767Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004804Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0MEnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006071Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09EnvironmentalOpen in IMG/M
3300006112Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08EnvironmentalOpen in IMG/M
3300006128Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07EnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007609Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MGEnvironmentalOpen in IMG/M
3300007864Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0umEnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300007983Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_C_D2_MGEnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300009009Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009037Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009082Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009161Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaGEnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300009186Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaGEnvironmentalOpen in IMG/M
3300009187Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaGEnvironmentalOpen in IMG/M
3300010334Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011010Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface IceEnvironmentalOpen in IMG/M
3300011995Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012394Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_201_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012665Freshwater microbial communities from Talbot River, Ontario, Canada - S11EnvironmentalOpen in IMG/M
3300012707Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES154 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012717Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012721Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES139 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012760Freshwater microbial communities from Lake Croche, Canada - C_130709_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012766Freshwater microbial communities from Lake Montjoie, Canada - M_140807_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013089Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_330mEnvironmentalOpen in IMG/M
3300013132 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5mEnvironmentalOpen in IMG/M
3300013286Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23YEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014811Aquatic viral communities from ballast water - Michigan State University - AB_ballast waterEnvironmentalOpen in IMG/M
3300014962Surface water microbial communities from Bangladesh - BaraHaldiaSW0309EnvironmentalOpen in IMG/M
3300015050Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300016754Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017700Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.DEnvironmentalOpen in IMG/M
3300017701Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017722Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017723Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017963Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaGEnvironmentalOpen in IMG/M
3300017987Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_1 metaGEnvironmentalOpen in IMG/M
3300017991Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaGEnvironmentalOpen in IMG/M
3300018080Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaGEnvironmentalOpen in IMG/M
3300018868Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_50EnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020083Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300mEnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020204Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surfaceEnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300020513Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020710Freshwater microbial communities from Trout Bog Lake, WI - 20SEP2008 epilimnionEnvironmentalOpen in IMG/M
3300020731Freshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 epilimnionEnvironmentalOpen in IMG/M
3300021128Freshwater microbial communities from Trout Bog Lake, WI - 20AUG2007 epilimnionEnvironmentalOpen in IMG/M
3300021131Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnionEnvironmentalOpen in IMG/M
3300021136Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 hypolimnionEnvironmentalOpen in IMG/M
3300021139Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnionEnvironmentalOpen in IMG/M
3300021140Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnionEnvironmentalOpen in IMG/M
3300021142Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnionEnvironmentalOpen in IMG/M
3300021424Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surfaceEnvironmentalOpen in IMG/M
3300021438Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MGEnvironmentalOpen in IMG/M
3300021956Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MGEnvironmentalOpen in IMG/M
3300022063Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300024306Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8hEnvironmentalOpen in IMG/M
3300024484Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024536Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024541Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024557Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024574Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024862Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024863Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025075Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025336Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Jul07 (SPAdes)EnvironmentalOpen in IMG/M
3300025358Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes)EnvironmentalOpen in IMG/M
3300025369Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes)EnvironmentalOpen in IMG/M
3300025372Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes)EnvironmentalOpen in IMG/M
3300025383Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes)EnvironmentalOpen in IMG/M
3300025389Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes)EnvironmentalOpen in IMG/M
3300025396Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 (SPAdes)EnvironmentalOpen in IMG/M
3300025400Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 (SPAdes)EnvironmentalOpen in IMG/M
3300025407Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 (SPAdes)EnvironmentalOpen in IMG/M
3300025416Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH29Jun09 (SPAdes)EnvironmentalOpen in IMG/M
3300025426Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 (SPAdes)EnvironmentalOpen in IMG/M
3300025466Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 (SPAdes)EnvironmentalOpen in IMG/M
3300025606Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025648Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 (SPAdes)EnvironmentalOpen in IMG/M
3300025749Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025751Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025757Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025777Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH13Jun08 (SPAdes)EnvironmentalOpen in IMG/M
3300025779Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun08 (SPAdes)EnvironmentalOpen in IMG/M
3300025838Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 (SPAdes)EnvironmentalOpen in IMG/M
3300026454Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026562Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026573Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027136Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8hEnvironmentalOpen in IMG/M
3300027468Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027534Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8dEnvironmentalOpen in IMG/M
3300027586Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027600Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8hEnvironmentalOpen in IMG/M
3300027621Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027697Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027708Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027734Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027747Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027749Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027754Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027763Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027792Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027892Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027896Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)EnvironmentalOpen in IMG/M
3300027901Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300027963Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027969Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028261Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028271Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028392Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300028394Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300028530Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028571 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1EnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300031566Soil microbial communities from Risofladan, Vaasa, Finland - UN-1EnvironmentalOpen in IMG/M
3300031669Soil microbial communities from Risofladan, Vaasa, Finland - TR-1EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031813Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoAEnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031885Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300032046Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032668Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025EnvironmentalOpen in IMG/M
3300033488Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_CEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033979Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034082Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034102Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112EnvironmentalOpen in IMG/M
3300034112Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191EnvironmentalOpen in IMG/M
3300034116Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOREnvironmentalOpen in IMG/M
3300034120Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172EnvironmentalOpen in IMG/M
3300034166Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M
3300034284Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
TB18AUG2009H_02031613300000177FreshwaterMATNRLKREMENREITERPKQWMPPELLPEPDKQAG
TBL_comb48_EPIDRAFT_101423853300000439FreshwaterMAEVKKTRELETRAVVERPQQWMNPELLPEPDKQAGYAYRWIRVS
RCM39_105520623300001837Marine PlanktonMSDNKVTRELKTRATQERPKQWAPAELLPEPDKEAG
RCM30_102113413300001842Marine PlanktonMAENRLTRELETRAVSERPKQWQQAEMLPEPDKQPGY
RCM30_103438513300001842Marine PlanktonMAENRLARDVVTRTTSERPKQWQQPELLPEPDKQPG
RCM34_115379713300001843Marine PlanktonMAENRLSRDAETRESKARPKQWQQPESLPEPDKMPGY
metazooDRAFT_122340223300002199LakeMKMTANNKISRDMQTRELTERPKQWAPPELLPEPD
B570J29032_10920905213300002408FreshwaterMTTNKLARELDTRETATRPKQWQQPELLPEPDKQPGYKY
B570J29032_10975541233300002408FreshwaterMADNRLQREITSRTSQERPKQWQQAELLPEPDRAPGFAYR
JGI25908J49247_1004359323300003277Freshwater LakeMATDVKVAESRLSREMQSRATQERPKKWQQAELLPEPDKQPGY
JGI25908J49247_1013487123300003277Freshwater LakeMATDVKAAENRLSREMQSRATQERPKKWQQAELLPEPDKQPGY
JGI25911J50253_1009983113300003411Freshwater LakeMAENRITRELETRAVQERPKQWTQPELLPEPDRQAGFDYR
JGI25914J50564_1004576533300003429Freshwater LakeMPTNRLQREVDNREVAERPKQWMPPDLLPEPDKQAGYAYRW
Ga0007864_101565113300003806FreshwaterMAESNRNPREIETRQQELRPKVWALPELLPEPDKHPDWGY
Ga0069718_1325346223300004481SedimentMAEVKDNRLTRELETRAVQERPKQWMQAELLPEPDKHPDFAYRWIRVS
Ga0007750_142383613300004767Freshwater LakeMANNRLTRELESRKEVERPKQWAPAETLPEPDKQPGFAYRWIRIS
Ga0007796_1018766023300004804FreshwaterMATKNNTPRELDTRATYERPQQWAPAELLPEPDKQAGYAYR
Ga0068876_1004146953300005527Freshwater LakeMAENRLTRELETRTVQERPKQWTPPELLPEPDKQP
Ga0049081_1019222213300005581Freshwater LenticMAENKLNRDVSTREFGERPTQWKQAELLPEPDKQAGY
Ga0079957_106317353300005805LakeMAEQMKGRLDRELETRTQSERPKTWAPPELLPEPDKQPGY
Ga0075470_1009428113300006030AqueousMAENRLTRELEARTQQERPKQWAPAELLPEPDKQP
Ga0075470_1010935523300006030AqueousMANTRVTREVENREFSERPKQWMPAELLPEPDKEAGF
Ga0007876_100330913300006071FreshwaterMAENNRTPREVATRQQAERPKAWSLPELLPEPDKQAGF
Ga0007876_110373923300006071FreshwaterMAEQRIPRELTTRTTMERPKQWTPPELLPEPDREPGM
Ga0007857_105455423300006112FreshwaterMTTNPINKITRASETRALTERPKQWMPPEALPEPDKQA
Ga0007828_102119333300006128FreshwaterMANAQQLNRETESRSLTERPKQWMPPELLPEPDKQPGY
Ga0070749_1071001613300006802AqueousMAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPDYRYRWIRVSNLN
Ga0075467_1058414923300006803AqueousMAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPDYA
Ga0070748_132397223300006920AqueousMAENKSRIDRELETRAVTERPKQWMPAELLPEPDKQAG
Ga0099848_114812223300007541AqueousMAEQNRIKRELESRAISARPQQWMPPELLPEPDKEAGYA
Ga0102945_104221723300007609Pond WaterMATQEKATSNNRLARELETRATSERPKAWQPASVLPEPDKQPGYSYRW
Ga0105749_100834043300007864Estuary WaterMAENRIPREVDTRQQDERLKQWQAPELLPEPDKQAGF
Ga0105746_104411143300007973Estuary WaterMATENRLQREMTSRAVQERPKQWQQADLLPEPDKEP
Ga0102941_132292613300007983Pond SoilMAENRIPRDTQSRAQAERPQQWKPPELLPEPIKEEGF
Ga0075480_1021680913300008012AqueousMATQEKATSDNRLARELETRATSERPKAWQPASVLPEPDKQPGY
Ga0114347_105697313300008114Freshwater, PlanktonMAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPD
Ga0114350_106050633300008116Freshwater, PlanktonMAENKLTRELETRAVQERPKQWTPPELLPEPDKQPGF
Ga0114363_116142923300008266Freshwater, PlanktonMAENRLQREFESRSTTERPKAWMPASALPEPDKQPGYAYR
Ga0114363_120554923300008266Freshwater, PlanktonMAENRLTRELENRAQQERPKQWAPAETLPEPDKRPGFAYRWV
Ga0114876_111748113300008448Freshwater LakeMTENRVAREHEDRTSAKRPESWAPAGGLPEPDRQPGYAYRWIRVSMVE
Ga0105105_1054039323300009009Freshwater SedimentMAENRLTRELETRQTTERPKQWAPAELLPEPDKQPG
Ga0105105_1076043013300009009Freshwater SedimentMAEQRTPREVANRQQDMRPQQWKPPELLPEPDKMDGYSY
Ga0105093_1030761213300009037Freshwater SedimentMAENRVQREVQTRATTERPKQWMPAELLPEPDKQAG
Ga0105099_1070682713300009082Freshwater SedimentMAEKRLDRELETRELVERPKQWMPADLLPEPDKQAG
Ga0118687_1021273023300009124SedimentMATQEKATSENRLARELETRATSERPKSWQPASVLPEPDKQPGYTYRWVR
Ga0114962_1005192853300009151Freshwater LakeMAEIKDNKLTRELTTRAVQERPKQWMQPEMLPEPDKEPGYNY
Ga0114962_1030354923300009151Freshwater LakeMAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPDYNYRWIRVSNLNVS
Ga0114980_1000047413300009152Freshwater LakeMAGNNRITRELESREVTERPKQWQLPELLPEPDKQAGF
Ga0114968_1000782213300009155Freshwater LakeMAENKLNREVTTREFEERTKQWMNPELITETDKKEGYAYRLFR
Ga0114978_1055157813300009159Freshwater LakeMAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPDYSYRWIRVAN
Ga0114966_1070370523300009161Freshwater LakeMAENRLSRELQNRATTERPKQWMPAELLPEPDKQA
Ga0114975_1000101013300009164Freshwater LakeMAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPDY
Ga0105102_1026037323300009165Freshwater SedimentMAENRLKRELDNRTQAERPKQWAPASLLPEPDKEPGFV
Ga0105102_1034174913300009165Freshwater SedimentMADIKDNKLTRELTTRAVQERPKQWAQPELLPEPDKQPGYNYRWIRV
Ga0105104_1097364723300009168Freshwater SedimentMAETRIPREVSNRQQSMRIENWKPPELLPEPDMQP
Ga0105097_1012676213300009169Freshwater SedimentMAENRLTRELENRAQQERPKQWAPAETLPEPDKQAGFAYR
Ga0114974_1081547523300009183Freshwater LakeMAESRLQREITNRTSQERPKQWQQAELLPEPDKAPGFAYRWI
Ga0114976_1013344433300009184Freshwater LakeMADNTNARTTRELETRALVERPKQWMQPELLPEPDKEA
Ga0114965_1156733300009186Freshwater LakeMATENRLQREMTSRATQERPKQWQQADLLPEPDKEP
Ga0114972_1045711713300009187Freshwater LakeMAEIKENRIPREIATRAEFERPKQWAQPESLPEPDKQPG
Ga0136644_1008384613300010334Freshwater LakeMATDNRLQREMTSRAAQERPKQWQQADLLPEPDKEPGYAYRWIR
Ga0136644_1038374123300010334Freshwater LakeMAENRLARELENRTATERPKQWQPASTLPEPDKQPGYAYRWIR
Ga0129333_1060617813300010354Freshwater To Marine Saline GradientMAENRLARELETRSEVERPKAWQPASALPEPDKQPGYSY
Ga0129336_1053341023300010370Freshwater To Marine Saline GradientMAENRTPRNIETRTQAERPKQWMPPELLPEPDKQPGY
Ga0133913_1020919413300010885Freshwater LakeMAENRKPREIETRQQSVRPEAWKPPELLPEPDKQAGF
Ga0133913_1150021913300010885Freshwater LakeMATSNTRATRDLESRELTERPKQWALPELLPEPDKQAGYSYRWIRV
Ga0133913_1362999013300010885Freshwater LakeMTTKRIDREVETRDKSERLQQWAPAELLPEPVKMPGYKYH
Ga0139557_104714523300011010FreshwaterMAENRLTRELDTRATSERPKQWTPAELLPEPDKQAGYAYR
Ga0153800_102945613300011995FreshwaterMATNRLERELENRTMQERPKQWQQPELLPEPDKQTGYAY
Ga0123365_128575723300012394MarineMATQEKATSNNRLARELETRATAERPKSWQPASVLPEPDQQPGYTYRWVRIAQLN
Ga0157210_101620633300012665FreshwaterMATENRLQREMTSRTMQERPKQWQQADLLPEPDKE
Ga0157623_102387913300012707FreshwaterMAENRKPREVEDRQQSMRPQQWKPPELLPEPDKQAGFS
Ga0157609_122711223300012717FreshwaterMAENRLARELDTRSTAERPKQWMRPETLPQPDKQPGYAY
Ga0157612_105316113300012721FreshwaterMANNRLTRELDTRATSERPQQWAPAELLPEPDKQAGYAY
Ga0138273_112522023300012760Freshwater LakeMAESRLQREMTSRSTQERPQQWKPAELLPEPDKAPGYAYR
Ga0138282_100366813300012766Freshwater LakeMAESRLQREMTVRTEQERPKSWRPAETLPEPDKQP
Ga0138282_124072713300012766Freshwater LakeMAGNNKVTRDLETREVVERPKQWALPELLPEPDKEAGFSYRWI
Ga0163203_111400713300013089FreshwaterMAENRIPREVEDRKQDERPKQWQAPELLPEPDKEPGF
(restricted) Ga0172372_1048192723300013132FreshwaterMADKTPRSIETRTMAERPKMWTPPELLPEPDKQPGYAY
Ga0136641_105669133300013286FreshwaterMATNRLQRELESRTQQERPKQWTPPELLPEPDKEEG*
Ga0170791_1199532523300013295FreshwaterMAENRKPRELEDRMMMERPKQWQLPDSLPEPDKQPGYDYRWIRVA
Ga0182021_1125053823300014502FenMTTKRIDREVETRDKSERLQQWAPAELLPEPVKIPGY
Ga0182021_1332560213300014502FenMSENNRLKREMESRAVQERPKQWQEASLLPEPDKEPG
Ga0119960_100270113300014811AquaticMAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPDYSYR*
Ga0134315_102828413300014962Surface WaterMATNRLDRELENRSLQERPKQWQPPELLPEPDKQPGYAY
Ga0134315_105898013300014962Surface WaterMADNTNARTTRELETRALTERPKQWMPPELLPEPD
Ga0181338_100164353300015050Freshwater LakeMATDVKVAESRLSREMQSRATQERPKKWQQAELLPEPDKQPGYA
Ga0181338_101170013300015050Freshwater LakeMAEIKENRIPREIATRAEFERPKQWAQPELLPEPDKEPGYN
Ga0181338_104202323300015050Freshwater LakeMATDVKAAENRLSREMQSRATQERPKKWQQAELLPEPDKQPGYA
Ga0182072_123082113300016754Salt MarshMATQEKATSDNRLARELETRATSERPKAWQPASVLPEPDKQPGYAYRWVR
Ga0181339_103445523300017700Freshwater LakeMANNRLTREVDTRVTSERPQQWAPAELLPEPDKQAG
Ga0181364_105930713300017701Freshwater LakeMAEIKETRAPREIETRAEFERPKQWAQPELLPEPDKQPGYNY
Ga0181347_102618713300017722Freshwater LakeMVAENKLTRELDTRVQAERPKSWQPASTLPEPDREPGF
Ga0181347_104183133300017722Freshwater LakeMARNDLARELETRTALERPKSWQPASSLPEPDKQPG
Ga0181347_107697823300017722Freshwater LakeMAENRTPRSIETRTTEERPKQWQQPELLPEPDKQEGYAY
Ga0181347_119404513300017722Freshwater LakeMSENNRLKREVESRTMQERPKQWMPAELLPEPDKEP
Ga0181362_104645723300017723Freshwater LakeMAENRKPRELEDRLMAERPKQWQEPDTLPKPDKHPDYAYR
Ga0181365_102552513300017736Freshwater LakeMAENRLTRELETRAVQERPKQWMLPDMLPEPDKQA
Ga0181365_102937213300017736Freshwater LakeMATNRLDREVDTRATSERPKQWAPAELLPEPDKQAGY
Ga0181352_101066053300017747Freshwater LakeMTDKRINRELENRTNVERPQAWAPASALPEPDKQPGYSYRWI
Ga0181352_107672313300017747Freshwater LakeMANNRLTRELDTRVEVERPTHWAPPELLPEPDKQAGY
Ga0181352_108550013300017747Freshwater LakeMAENRKPREVEDRQQSMRPQQWKPPELLPEPDKQAG
Ga0181344_103650433300017754Freshwater LakeMAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPDYAY
Ga0181344_105624613300017754Freshwater LakeMAENRLARELENRSNVERPQAWAPASALPEPDKQPG
Ga0181344_106474023300017754Freshwater LakeMAENRKPRELEDRLLAERPKQWQQAELLPEPDKHPDYSY
Ga0181344_107062223300017754Freshwater LakeMANTRLTRELETREVQVRPKQWAPAELLPEPDKQPGF
Ga0181344_109733723300017754Freshwater LakeMNTKRIDREVETRVASERPQQWAPAELLPEPKKNGGV
Ga0181356_122207823300017761Freshwater LakeMATDVKVAESRLSREMQSRATQERPKKWQQAELLPEPDKQPGYAY
Ga0181343_104936313300017766Freshwater LakeMATNRLERELQNRTQSERPKQWSQPELLPEPDKQA
Ga0181343_113577623300017766Freshwater LakeMAENRLTRELETRAVQERPKQWALPEILPEPDKQAG
Ga0181343_115692713300017766Freshwater LakeMAENRLARELEKRSDVERPKAWAPASALPEPDKQPGYSYR
Ga0181343_118278023300017766Freshwater LakeMAENRKPRDLEDRIQAERPKQWQQAELLPEPDKDPDYAYRWIRVANLN
Ga0181358_101625913300017774Freshwater LakeMATNRLDRSIDTRELVERPKQWAPAELLPEPDKQAGYAY
Ga0181349_108142413300017778Freshwater LakeMAENRLTRELETRAVQERPKQWMLPDMLPEPDKQAGYNYR
Ga0181349_112661023300017778Freshwater LakeMTKKLDREAETRATSERPTQWAPAELLPEPDKQAGYSY
Ga0181349_126306013300017778Freshwater LakeMAENRKPRELEDRLMAERPKQWQEPDTLPEPDKHPDYAYRW
Ga0181349_130322713300017778Freshwater LakeMATDVKAAESRLSREMQSRATQERPKKWQQAELLPEPDKQPGYAYR
Ga0181346_101476913300017780Freshwater LakeMSEVRESREFDTRAIYERPTQWQQPELLPEPDKQAGYSYRWIRVANL
Ga0181348_106009713300017784Freshwater LakeMAENRLARELENRTNVERPQAWAPASALPEPDKQPGYAYRS
Ga0181348_108553513300017784Freshwater LakeMAEVKENRISREIETRAVLERPKQWAQPELLPEPDKTLGW
Ga0181355_103581663300017785Freshwater LakeMAENRITRDVDTRAQAERPKAWQPASTLPEPDKLDGY
Ga0181355_104117353300017785Freshwater LakeMATNRLQRELQSRTQSERPKQWAQPELLPEPDKQPGY
Ga0181355_127320913300017785Freshwater LakeMAENRLQREFQNRSTTERPKAWMPASALPEPDKQP
Ga0181355_130579323300017785Freshwater LakeMATNRLERELQNRTQSERPKQWSQPELLPEPDKQAGYAYRWIRISSLN
Ga0180437_1030349013300017963Hypersaline Lake SedimentMAEQKETRLARELETREVTERPKTWAPASTLPEPDR
Ga0180431_1098314023300017987Hypersaline Lake SedimentMAEQKETRLARELETREVTERPKTWAPASTLPEPDKEPGY
Ga0180434_1043495713300017991Hypersaline Lake SedimentMAEQNRVSREVSTRATTERPKQWMPPEMLPEPDKQA
Ga0180433_1124999223300018080Hypersaline Lake SedimentMAQNRLAREIEDRTAAERPKQWQPASALPEPDKQPGYAYRW
Ga0187844_1020417213300018868FreshwaterMADRTPRNLETRDSETRPAFWRPPELLPEPDKQAGYT
Ga0181359_108500133300019784Freshwater LakeMVDVKDNKLTRELTTRAVQERPKQWMQPELLPEPDKEPGYNYRWT
Ga0181359_111926413300019784Freshwater LakeMAENRKPRELEDRLMAERPKQWQQAELLPEPDKHP
Ga0181359_114388523300019784Freshwater LakeMAEVKENRISREIETRAVLERPKQWAQPELLPEPDT
Ga0181359_126172323300019784Freshwater LakeMATDVKVAESRLSREMQSRATQERPKKWQQAELLPEPDKQPG
Ga0181359_126934013300019784Freshwater LakeMAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPDYAYRWIRV
Ga0207193_128677133300020048Freshwater Lake SedimentMTKKLDRESETRATSQRPQQWAPAELLPEPDKQAGY
Ga0207193_161970913300020048Freshwater Lake SedimentMAENRLARELEKRSDVERPKAWMPASALPEPDKQPGYAYRW
Ga0207193_179270413300020048Freshwater Lake SedimentMADIKDNKLTRELTTRAVQERPKQWMQPELLPEPDKQPGYNY
Ga0194111_1085155813300020083Freshwater LakeMSTQNRLSRELNTRALQERPKQWMPPETLPEPDKMPGYAY
Ga0211734_1093253913300020159FreshwaterMATNRLQRELESRTQSERPKQWSQPELLPEPDKQPGYA
Ga0194116_1056312913300020204Freshwater LakeMPENKLERELTSRAMSERPKQWTPPELLPEPDKEAGY
Ga0194127_1005901313300020221Freshwater LakeMAENRLARELETRSRTERPKQWQRPDAIPEPHKEPGY
Ga0208090_102799623300020513FreshwaterMADNTNARTTRELETRALVERPKQWMQPELLPEPDKEAGFAYRWIRV
Ga0214198_100392353300020710FreshwaterMAENRTPREIQTRIADERPKQWQAPELLPEPDKEAGYA
Ga0214170_103956923300020731FreshwaterMSDTRAPREIKTREFEERPKQWMPPDLLPEPDKQPGFEYRWIRV
Ga0214176_100604613300021128FreshwaterMTTNPINKITRASETRALTERPKQWMPPEALPEPDKQAG
Ga0214206_101717323300021131FreshwaterMTQTAEKSRLTREMESRNLTERPKQWQQPELLPEPDKEP
Ga0214167_109484013300021136FreshwaterMANAPKSSTRELETREFAERPKQWMPPELLPEPDKQPGFAY
Ga0214166_100459763300021139FreshwaterMATKATREVTNREFDERPKSWAPPELLPEPDKESGFEYR
Ga0214166_107578213300021139FreshwaterMAQNKLDRELDNRELSERPKQWMPPELLPQPDIQPGYAYRWIRTATL
Ga0214168_111066923300021140FreshwaterMATTQNRITRELETRALTERPKQWMPPEALPEPDKEDGFAYRW
Ga0214192_101263413300021142FreshwaterMAESNRNPREIETRQQDLRPKTWSLPELLPEPDKN
Ga0194117_1012422233300021424Freshwater LakeMAENKLARELETREQTERPKTWQPASALPEPDKQPGYA
Ga0213920_104775013300021438FreshwaterMAENRTPRNVETRVQAERPKQWKPAELLPEPDKLPGYAYR
Ga0213922_108420723300021956FreshwaterMAESRLQREITNRTSQERPKQWQQAELLPEPDKAPGFAYRW
Ga0213922_112438013300021956FreshwaterMAGTKLTRELETRETQVRPKQWAPAELLPEPDKQPGFN
Ga0212029_101290123300022063AqueousMAESRTPRDVDTRESKARPKQWQQPESLPEPDKMPGYAYRWIR
Ga0181353_115904613300022179Freshwater LakeMAENRVARELESRSTVERPKAWAPASALPEPDKQPGYAYRWIRA
Ga0181353_115935423300022179Freshwater LakeMAENRLARELENRSNVERPQAWMPASALPEPDKQPGYSYRW
Ga0181354_109002113300022190Freshwater LakeMAENRKPRELEDRLMAERPKQWQEPDTLPKPDKHPDYAYRWIRVATLN
Ga0181354_110605013300022190Freshwater LakeMAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPDYAYRWI
Ga0196901_122844623300022200AqueousMAEQNRVSREVSTRATTERPKQWMPPEMLPEPDKQAGFDY
Ga0181351_100032713300022407Freshwater LakeMAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPDYAYRWIRVANLN
Ga0181351_109235113300022407Freshwater LakeMSEVRESREFDTRAIYERPTQWQQPELLPEPDKQAGYSYRWIRVANLN
Ga0181351_123924123300022407Freshwater LakeMAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPDYAYRW
Ga0181351_124503213300022407Freshwater LakeMAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPDYAYR
Ga0214917_1025969613300022752FreshwaterMAEVRIKRDVETRATYERPTEWSQPELLPEPDKEA
Ga0255148_106331823300024306FreshwaterMAENRLTRELETRVTQERPKQWAPAELLPEPDMQP
Ga0256332_114750623300024484FreshwaterMAENRTPRNIETRTQAERPKQWAPPELLPEPDKQPGYKY
Ga0256338_115974813300024536FreshwaterMAENRLTRELETRAVQERPKQWAPAELLPEPDKEPGF
Ga0256343_109506823300024541FreshwaterMAENRLTRELDKRTAVERPTHWAPPELLPEPDKQAGYPY
Ga0255283_109898013300024557FreshwaterMAENRLTRELDKRTAVERPTHWAPPELLPEPDKQAGYAYRW
Ga0255275_114669513300024574FreshwaterMAENRTPRNIETRTQAERPKQWAPPELLPEPDKQP
Ga0256317_115344413300024862FreshwaterMAEKRLTREFETRDAEERPKQWALPEILPEPDKQAGYNYR
Ga0255246_111006913300024863FreshwaterMAENRKPRELEDRNAEERPKQWAQPELLPEPDKHPDYKYRWIR
Ga0255246_116368123300024863FreshwaterMANTRLQREVDTRATSERPTQWAPAELLPEPDKQTGYAY
Ga0209615_10210313300025075FreshwaterMAENRASRELESRVVSERPKQWAPAELLPEPDKQPGF
Ga0208619_11622013300025336FreshwaterMTANPINKITRASETRALTERPKQWMPPEALPEPDKQAGYTYR
Ga0208504_103305713300025358FreshwaterMADTRIPREVSNRQQDERPKAWRPPELLPEPDKQTG
Ga0208382_101299713300025369FreshwaterMTKATREVTNREFDERPKSWAPPELLPEPDKQAGF
Ga0207957_100723813300025372FreshwaterMAENRVPREVSNRQQAERPKAWRPPELLPEPDKQAG
Ga0208250_103319323300025383FreshwaterMAQNKLDRELDNRELSERPKQWMPPELLPQPDIQPGYAYRWIRTATLN
Ga0208257_100088383300025389FreshwaterMAVNRIDREADNRVVAERPKQWAPAELLPEPIKQPGYAYR
Ga0208257_100948813300025389FreshwaterMAENKLNRDLTTRALTERPKQWMPPELLPEPDKEPGYG
Ga0208874_100144563300025396FreshwaterMAQNRITRETDNREFAERPKQWMPPELLPEPDKEAGYSY
Ga0208387_104525523300025400FreshwaterMAENRLTRELETRAVVERPKQWSQPELLPEPDKQPGFAY
Ga0208387_106798313300025400FreshwaterMAQNRITRETDNREFAERPKQWMPPELLPEPDKEA
Ga0208378_107795013300025407FreshwaterMADTRIPREVSNRQQTERPKTWRPPELLPEPDKQA
Ga0208877_104528523300025416FreshwaterMTAKRNNRDTEVREMAERPKQWRPPELLPEPDKEEGYE
Ga0208739_100475613300025426FreshwaterMTEQNRTQRELTSRALTERPKQWTPPELLPEPDKEAGMSY
Ga0208497_104904513300025466FreshwaterMAETRTPREIQTRIADERPKQWQAPELLPEPDKQPGYE
Ga0207954_103739433300025606FreshwaterMATNRLQRELEVRTQQERPKQWTPPELLPEPDKEEGYVY
Ga0208161_117013913300025646AqueousMAENRIKRELESRALTERPKQWMPPELLPEPDKEAGYE
Ga0208160_103511713300025647AqueousMAESRTPRDVDTRESKARPKQWQQPESLPEPDKMPGYAY
Ga0208160_116877813300025647AqueousMAENRIKRELESRALTERPKQWMPPELLPEPDKEAGYEYR
Ga0208507_101394353300025648FreshwaterMADNRTPRELTTRVTMERPKQWTPPDLLPEPDKEAGMSTDGLEF
Ga0256314_104174623300025749FreshwaterMAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPDYRYRWIRVANLNAA
Ga0208150_120954913300025751AqueousMATQEKATSDNRLARELETRATSERPKAWQPASVLPEPDKQPGYAYR
Ga0256313_106663113300025757FreshwaterMATDVKVAESRLSREMQSRATQERPKKWQQAELLPEPDKQPGYAYRW
Ga0256313_107580223300025757FreshwaterMPTNRLQREADSREVTERPKQWSPPDLLPEPDKQA
Ga0208110_101178323300025777FreshwaterMTEQNRTQRELTSRALTERPKQWTPPELLPEPDKEAGMSYR
Ga0208869_101840613300025779FreshwaterMANNNRTPREIETRQQEARPMAWKPPELLPEPDKQA
Ga0208872_103954153300025838FreshwaterMANTRIPREVSDRQQSERPKQWRPPELLPEPDKQP
Ga0208872_106532113300025838FreshwaterMANNNRIPREVETRQQAERPKAWTPPELLPEPDKQA
Ga0256319_111795513300026454FreshwaterMAENRKPRELEDRNAEERPKQWAQPELLPEPDKHPDYKYRWIRV
Ga0255285_110613523300026562FreshwaterMAENRLTRELDKRTAVERPTHWAPPELLPEPDKQAGYAYRWI
Ga0255269_122358723300026573FreshwaterMTETRLARELDTRVEAERPKVWQPASTLPEPDKQPGFAYR
Ga0255107_105995023300027136FreshwaterMADIKDNKLTRELTTRAVQERPKQWAQPELLPEPDKQPGYNYRWIR
Ga0209247_106698313300027468Freshwater LakeMAENRIPREVEDRKQDERPKQWQAPELLPEPDKEPGFAY
Ga0255125_112467723300027534FreshwaterMANTRLQREVDTRATSERPTQWAPAELLPEPDKQTGYAYR
Ga0208966_117318113300027586Freshwater LenticMAENRKPRELEDRLMAERPKQWQEPDTLPEPDKHPDY
Ga0255117_109712713300027600FreshwaterMANTRLQREVDTRATSERPTQWAPAELLPEPDKQTG
Ga0208951_116937723300027621Freshwater LenticMAENKLNRELETRAVQERPKQWAPPELLPEPDKQPGYAY
Ga0208975_101138713300027659Freshwater LenticMAENRKPREVEDRQQSMRPQQWKPPELLPEPDKQA
Ga0208975_110662023300027659Freshwater LenticMAEKRLTREFETRDVEQRPKQWALPEILPEPDKQAGYN
Ga0209033_123926523300027697Freshwater LakeMAENRLARELEKRSDVERPKAWAPASALPEPDKQPGYAY
Ga0209188_118869123300027708Freshwater LakeMAESRLEREMTVRTEQERPKSWRPAETLPEPDKQPGYA
Ga0209087_108916513300027734Freshwater LakeMAENKLNREVTTREFEERPKQWMPPELLPEPDKQEG
Ga0209189_107314833300027747Freshwater LakeMATDNRLQREMTSRAAQERPKQWQQADLLPEPDKEPGYAYRWIRV
Ga0209189_140433223300027747Freshwater LakeMAENRLARELENRTATERPKQWQPASTLPEPDKQPGYAYRW
Ga0209084_111130213300027749Freshwater LakeMATENRLQREMTSRTMQERPKQWQQADLLPEPDKEPGYAYR
Ga0209084_133025913300027749Freshwater LakeMAEIKDNKLTRELTTRAVQERPKQWMQPEMLPEPDKEPGYN
Ga0209596_135681723300027754Freshwater LakeMAESRLQREMTVRTEQERPKSWRPAETLPDPDKQP
Ga0209088_1023711523300027763Freshwater LakeMAENRKPRELEERLMTEHPKQWMPAELLPEPDKEPGY
Ga0209246_1017193913300027785Freshwater LakeMAENRLTRELETRAVQERPKQWMLPDMLPEPDKQAG
Ga0209246_1017741913300027785Freshwater LakeMATENRLQREMTSRAVQERPKQWQQADLLPEPDKAPGY
Ga0209287_1040469413300027792Freshwater SedimentMAANRLTRELDTRVTFERPTQWSQPELLPEPDKQPGYAYR
Ga0209353_1004824513300027798Freshwater LakeMSENNRLKREVESRTMQERPKQWMPAELLPEPDKE
Ga0209353_1010905033300027798Freshwater LakeMATDVKAAESRLSREMQSRATQERPKKWQQAELLP
Ga0209353_1025384823300027798Freshwater LakeMATDVKAAENRLSREMQSRATQERPKKWQQAELLPEPDKQPGYAY
Ga0209353_1038853413300027798Freshwater LakeMAENRKPRELEDRLMAERPKQWQEPDTLPEPDKHPDYAYRWIRVANLNAPD
Ga0209353_1040549723300027798Freshwater LakeMAENRIVRETETRAQAERPKSWQPASTLPEPDKLDG
Ga0209354_1010754123300027808Freshwater LakeMAENRLTRELNTRATSERPTQWAPAELLPEPDKQAGYAYR
Ga0209354_1029324813300027808Freshwater LakeMSETRISRELDTRADFERPKSWQPASLLPEPDKQPGYAYRWV
Ga0209354_1034711513300027808Freshwater LakeMANNRLTRELESRETQMRPKQWAPAELLPEPDKQPGF
Ga0209550_1021752033300027892Freshwater LakeMANNRITREADTRATSERPQRWAPAELLPEPDKQAGYAY
Ga0209777_1034956523300027896Freshwater Lake SedimentMAENRLTRELETRAVAERPKQWMPAEMLPEPDKQPGYSYRWV
Ga0209427_1089766113300027901Marine SedimentMANERKEVTRELDRRTSHERPKSWQPASLLPEPDKQPGYAYKW
Ga0209048_1069690513300027902Freshwater Lake SedimentMAEVKKTRELETRAVVERPQRWMNPELLPEPDKQA
Ga0209536_10156295313300027917Marine SedimentMAEQNRIKRELESRALAERPRQWMPPELLPEPDKQAG
Ga0209400_103843513300027963Freshwater LakeMAEIKENRIPREIATRAEFERPKQWAQPESLPEPDK
Ga0209191_104324953300027969Freshwater LakeMAENRLTRELDTRVEVERPTHWAPPELLPEPDKQA
Ga0209191_132384113300027969Freshwater LakeMATNRLARELESRTQTERPKQWSQPELLPEPDKQAGYAYRWI
Ga0256316_108191413300028261FreshwaterMAENKLNRELETRAVQERPKQWAPPELLPEPDKQPGYA
Ga0255256_108891713300028271FreshwaterMAESRLQREITNRTTQERPKQWQQAELLPEPDKTPGYAYRWI
Ga0304729_125966223300028392Freshwater LakeMAENKIPREMITRAMTERPKQWTPPELLPEPDREAGM
Ga0304730_121684313300028394Freshwater LakeMAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPDYSYRW
Ga0304730_127198223300028394Freshwater LakeMAENRLARELETRAIVERPKQWMQPELLPEPDKQA
Ga0255279_104165413300028530FreshwaterMAENRTPRNIETRTQAERPKQWAPPELLPEPDKQPGYKYRCM
(restricted) Ga0247844_107887843300028571FreshwaterMAEKRIDREVETRATSERPKQWAPAELLPEPDKQA
Ga0307380_1053204013300031539SoilMTEQNRIKRELESRALTERPKRWMPPELLPEPDKQAG
Ga0307378_1088053113300031566SoilMATENRLQREMASRATQERPKQWQQAELLPEPDREPGY
Ga0307375_1022189633300031669SoilMAEQNRVSREVATRVTAERPKQWSPPELLPEPDKEAGY
Ga0315291_1097578713300031707SedimentMVDVKDNKLTRELTTRAVQERPKQWAQPELLPEPDRVPG
Ga0315291_1104097713300031707SedimentMTTKPREIETREFTERVKVWKQAELLPEPDKQAGY
Ga0315907_1028202113300031758FreshwaterMATNRLQRELESRTQSERPKQWSQPELLPEPDKQTGYAYRW
Ga0315900_1037381923300031787FreshwaterMAENRLTRELENRAQQERPKQWAPAETLPEPDKQPGFAYR
Ga0315900_1064647823300031787FreshwaterMATNKLARELDTRATSEGPKQWAPAELLPEPDKQAGYA
Ga0316217_1009158133300031813FreshwaterMAENRLARELETRIEGERPKSWQPASLLPEPDKQPGYDY
Ga0315909_1088188523300031857FreshwaterMAENRLARELENRTNVERPKAWAPASALPEPDKQPGYAY
Ga0315909_1100067213300031857FreshwaterMAENRKPRELEDRLMAERPKQWQEPDTLPEPDKHPDYAYRWIRVATLN
Ga0315285_1075223613300031885SedimentMAENRTPREVATRQQDARPQQWKQPELLPEPDKQEGY
Ga0315904_1041033813300031951FreshwaterMAENRLARELEKRSDVERPKAWAPASALPEPDKQPGYA
Ga0315904_1070507423300031951FreshwaterMTTPNRVTRDLETRALQERPKQWMPPELLPEPDKQAGFSYRW
Ga0315904_1127270623300031951FreshwaterMAENRKPRELEDRLMAERPKQWQEPDTLPEPDKHPDYA
Ga0315294_1051053013300031952SedimentMAEVRIQRDVETRAIYERPTEWSQPELLPEPDKEAGFSYR
Ga0315289_1133188623300032046SedimentMATDVKVAENRLSREMQSRATQERPKKWQQAELLPEPDKQPGYAYRW
Ga0315903_1048288413300032116FreshwaterMSENRLTREMQNRAQQERPKQWAPAELLPEPDKQA
Ga0315295_1194429013300032156SedimentMSENKIPRDMQTRELTERPKQWTPAELLPEPDKQAGF
Ga0315276_1208984123300032177SedimentMEQNRKSRSIETRVQEERPKQWSQPELLPEPDKQAGFSYRWVR
Ga0316230_104462153300032668FreshwaterMAENRIPRDVQTRQQAERPKAWTPPELLPEPDKQAGY
Ga0316621_1024885523300033488SoilMAENRLARELESRTQTERPKQWQRPETLPQPDKQPGYA
Ga0316616_10312507513300033521SoilMAENRIKRDTDTRELQARPTQWQQPELLPEPDKEA
Ga0334978_0065882_1749_18623300033979FreshwaterMAENRLAREIQTRSEAERPKSWHRPETLPEPDKQPGYA
Ga0334995_0213473_2_1183300034062FreshwaterMAENRTPRNVETRVQAERPKQWKPAELLPEPDKLPGYAY
Ga0334995_0764625_2_1273300034062FreshwaterMTTNRLTRELESRKEVERPKQWAPAETLPEPDKQPGFAYRWI
Ga0335020_0398340_3_1223300034082FreshwaterMAESRLQREITNRTTQERPKQWQQAELLPEPDKTPGYAYR
Ga0335027_0289134_999_11123300034101FreshwaterMAESRTPREIETRESKARPKQWQQPESLPEPDKMPGYS
Ga0335029_0713866_2_1243300034102FreshwaterMAESRLQREITNRTTQERPKQWQQAELLPEPDKAPGFAYRW
Ga0335066_0297867_801_9143300034112FreshwaterMAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPDYK
Ga0335066_0574594_472_5853300034112FreshwaterMAENKTPRELETRAVQERPKQWTQPELLPEPDKQEGFA
Ga0335068_0215923_1_1053300034116FreshwaterMAENRTPRNVETRVQAERPKQWKPAELLPEPDKLP
Ga0335056_0023025_4180_42993300034120FreshwaterMAENRLAREIQTRSEAERPKSWHRPETLPEPDKQPGYAYR
Ga0335056_0270735_847_9513300034120FreshwaterMAENRLVRELENRTQTERPKAWQPASTLPEPDKQP
Ga0335016_0138351_3_1223300034166FreshwaterMAENRKPREVETRQQDMRPQQWKPPELLPEPDKQAGFSYR
Ga0335065_0627128_3_1193300034200FreshwaterMAENRLSRELETRATQQRPKQWAPAELLPEPDKQAGFAY
Ga0335007_0596402_1_1053300034283FreshwaterMTTNKLARELDTRELVERPKQWQQPELLPEPDKQA
Ga0335013_0794805_402_5303300034284FreshwaterMADNTNARTTRELETRALVERPKQWMQPELLPEPDKEAGFAYR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.