Basic Information | |
---|---|
Family ID | F011741 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 287 |
Average Sequence Length | 39 residues |
Representative Sequence | MAENRLTRELETRQTTERPKQWAPAELLPEPDKQPG |
Number of Associated Samples | 211 |
Number of Associated Scaffolds | 287 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 99.64 % |
% of genes near scaffold ends (potentially truncated) | 96.52 % |
% of genes from short scaffolds (< 2000 bps) | 87.46 % |
Associated GOLD sequencing projects | 196 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.21 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (52.613 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (24.042 % of family members) |
Environment Ontology (ENVO) | Unclassified (62.369 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (71.429 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.69% β-sheet: 0.00% Coil/Unstructured: 95.31% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 287 Family Scaffolds |
---|---|---|
PF03237 | Terminase_6N | 2.09 |
PF00166 | Cpn10 | 1.39 |
PF14890 | Intein_splicing | 0.35 |
PF00271 | Helicase_C | 0.35 |
COG ID | Name | Functional Category | % Frequency in 287 Family Scaffolds |
---|---|---|---|
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 1.39 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 52.61 % |
All Organisms | root | All Organisms | 47.39 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000177|TB18AUG2009H_c020316 | Not Available | 638 | Open in IMG/M |
3300000439|TBL_comb48_EPIDRAFT_1014238 | All Organisms → Viruses → Predicted Viral | 4028 | Open in IMG/M |
3300001837|RCM39_1055206 | Not Available | 681 | Open in IMG/M |
3300001842|RCM30_1021134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
3300001842|RCM30_1034385 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1681 | Open in IMG/M |
3300001843|RCM34_1153797 | Not Available | 538 | Open in IMG/M |
3300002199|metazooDRAFT_1223402 | Not Available | 501 | Open in IMG/M |
3300002408|B570J29032_109209052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
3300002408|B570J29032_109755412 | Not Available | 1219 | Open in IMG/M |
3300003277|JGI25908J49247_10043593 | Not Available | 1200 | Open in IMG/M |
3300003277|JGI25908J49247_10134871 | Not Available | 580 | Open in IMG/M |
3300003411|JGI25911J50253_10099831 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 887 | Open in IMG/M |
3300003429|JGI25914J50564_10045765 | Not Available | 1198 | Open in IMG/M |
3300003806|Ga0007864_1015651 | Not Available | 566 | Open in IMG/M |
3300004481|Ga0069718_13253462 | Not Available | 631 | Open in IMG/M |
3300004767|Ga0007750_1423836 | Not Available | 535 | Open in IMG/M |
3300004804|Ga0007796_10187660 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
3300005527|Ga0068876_10041469 | All Organisms → Viruses → Predicted Viral | 2837 | Open in IMG/M |
3300005581|Ga0049081_10192222 | Not Available | 734 | Open in IMG/M |
3300005805|Ga0079957_1063173 | All Organisms → Viruses → Predicted Viral | 2183 | Open in IMG/M |
3300006030|Ga0075470_10094281 | Not Available | 898 | Open in IMG/M |
3300006030|Ga0075470_10109355 | Not Available | 823 | Open in IMG/M |
3300006071|Ga0007876_1003309 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5037 | Open in IMG/M |
3300006071|Ga0007876_1103739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
3300006112|Ga0007857_1054554 | Not Available | 763 | Open in IMG/M |
3300006128|Ga0007828_1021193 | Not Available | 1366 | Open in IMG/M |
3300006802|Ga0070749_10710016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
3300006803|Ga0075467_10584149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
3300006920|Ga0070748_1323972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300007541|Ga0099848_1148122 | Not Available | 871 | Open in IMG/M |
3300007864|Ga0105749_1008340 | Not Available | 1681 | Open in IMG/M |
3300007973|Ga0105746_1044111 | Not Available | 1389 | Open in IMG/M |
3300007983|Ga0102941_1322926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
3300008114|Ga0114347_1056973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1641 | Open in IMG/M |
3300008116|Ga0114350_1060506 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1334 | Open in IMG/M |
3300008266|Ga0114363_1161429 | Not Available | 732 | Open in IMG/M |
3300008266|Ga0114363_1205549 | Not Available | 600 | Open in IMG/M |
3300008448|Ga0114876_1117481 | All Organisms → Viruses → Predicted Viral | 1026 | Open in IMG/M |
3300009009|Ga0105105_10540393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
3300009009|Ga0105105_10760430 | Not Available | 582 | Open in IMG/M |
3300009037|Ga0105093_10307612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 845 | Open in IMG/M |
3300009082|Ga0105099_10706827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
3300009151|Ga0114962_10051928 | All Organisms → Viruses → Predicted Viral | 2695 | Open in IMG/M |
3300009151|Ga0114962_10303549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 890 | Open in IMG/M |
3300009152|Ga0114980_10000474 | Not Available | 29407 | Open in IMG/M |
3300009155|Ga0114968_10007822 | Not Available | 7821 | Open in IMG/M |
3300009159|Ga0114978_10551578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
3300009161|Ga0114966_10703705 | Not Available | 553 | Open in IMG/M |
3300009164|Ga0114975_10001010 | Not Available | 20563 | Open in IMG/M |
3300009165|Ga0105102_10260373 | Not Available | 886 | Open in IMG/M |
3300009165|Ga0105102_10341749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
3300009168|Ga0105104_10973647 | Not Available | 501 | Open in IMG/M |
3300009169|Ga0105097_10126762 | All Organisms → Viruses → Predicted Viral | 1400 | Open in IMG/M |
3300009183|Ga0114974_10815475 | Not Available | 500 | Open in IMG/M |
3300009184|Ga0114976_10133444 | Not Available | 1400 | Open in IMG/M |
3300009186|Ga0114965_11567 | Not Available | 1159 | Open in IMG/M |
3300009187|Ga0114972_10457117 | Not Available | 728 | Open in IMG/M |
3300010334|Ga0136644_10083846 | Not Available | 2000 | Open in IMG/M |
3300010334|Ga0136644_10383741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 799 | Open in IMG/M |
3300010354|Ga0129333_10606178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 950 | Open in IMG/M |
3300010370|Ga0129336_10533410 | Not Available | 630 | Open in IMG/M |
3300010885|Ga0133913_10209194 | Not Available | 5198 | Open in IMG/M |
3300010885|Ga0133913_11500219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1708 | Open in IMG/M |
3300010885|Ga0133913_13629990 | Not Available | 1001 | Open in IMG/M |
3300011010|Ga0139557_1047145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
3300011995|Ga0153800_1029456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300012665|Ga0157210_1016206 | Not Available | 1238 | Open in IMG/M |
3300012707|Ga0157623_1023879 | Not Available | 505 | Open in IMG/M |
3300012717|Ga0157609_1227112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
3300012721|Ga0157612_1053161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
3300012760|Ga0138273_1125220 | Not Available | 614 | Open in IMG/M |
3300012766|Ga0138282_1003668 | Not Available | 765 | Open in IMG/M |
3300012766|Ga0138282_1240727 | Not Available | 514 | Open in IMG/M |
3300013089|Ga0163203_1114007 | Not Available | 809 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10481927 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 826 | Open in IMG/M |
3300013286|Ga0136641_1056691 | Not Available | 1131 | Open in IMG/M |
3300013295|Ga0170791_11995325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
3300014502|Ga0182021_11250538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 894 | Open in IMG/M |
3300014502|Ga0182021_13325602 | Not Available | 536 | Open in IMG/M |
3300014811|Ga0119960_1002701 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1093 | Open in IMG/M |
3300014962|Ga0134315_1028284 | Not Available | 869 | Open in IMG/M |
3300014962|Ga0134315_1058980 | Not Available | 590 | Open in IMG/M |
3300015050|Ga0181338_1001643 | Not Available | 4017 | Open in IMG/M |
3300015050|Ga0181338_1011700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1430 | Open in IMG/M |
3300015050|Ga0181338_1042023 | Not Available | 678 | Open in IMG/M |
3300017700|Ga0181339_1034455 | Not Available | 553 | Open in IMG/M |
3300017701|Ga0181364_1059307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
3300017722|Ga0181347_1026187 | All Organisms → Viruses → Predicted Viral | 1826 | Open in IMG/M |
3300017722|Ga0181347_1041831 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1403 | Open in IMG/M |
3300017722|Ga0181347_1076978 | Not Available | 977 | Open in IMG/M |
3300017722|Ga0181347_1194045 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
3300017723|Ga0181362_1046457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 908 | Open in IMG/M |
3300017736|Ga0181365_1025525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1490 | Open in IMG/M |
3300017736|Ga0181365_1029372 | Not Available | 1387 | Open in IMG/M |
3300017747|Ga0181352_1010660 | Not Available | 2976 | Open in IMG/M |
3300017747|Ga0181352_1076723 | Not Available | 938 | Open in IMG/M |
3300017747|Ga0181352_1085500 | Not Available | 878 | Open in IMG/M |
3300017754|Ga0181344_1036504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1492 | Open in IMG/M |
3300017754|Ga0181344_1056246 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1169 | Open in IMG/M |
3300017754|Ga0181344_1064740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1081 | Open in IMG/M |
3300017754|Ga0181344_1070622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1030 | Open in IMG/M |
3300017754|Ga0181344_1097337 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 856 | Open in IMG/M |
3300017761|Ga0181356_1222078 | Not Available | 550 | Open in IMG/M |
3300017766|Ga0181343_1049363 | All Organisms → Viruses → Predicted Viral | 1240 | Open in IMG/M |
3300017766|Ga0181343_1135776 | Not Available | 688 | Open in IMG/M |
3300017766|Ga0181343_1156927 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
3300017766|Ga0181343_1182780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
3300017774|Ga0181358_1016259 | Not Available | 3009 | Open in IMG/M |
3300017778|Ga0181349_1081424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1231 | Open in IMG/M |
3300017778|Ga0181349_1126610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 937 | Open in IMG/M |
3300017778|Ga0181349_1263060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
3300017778|Ga0181349_1303227 | Not Available | 517 | Open in IMG/M |
3300017780|Ga0181346_1014769 | Not Available | 3312 | Open in IMG/M |
3300017784|Ga0181348_1060097 | All Organisms → Viruses → Predicted Viral | 1539 | Open in IMG/M |
3300017784|Ga0181348_1085535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1246 | Open in IMG/M |
3300017785|Ga0181355_1035816 | All Organisms → Viruses → Predicted Viral | 2133 | Open in IMG/M |
3300017785|Ga0181355_1041173 | Not Available | 1980 | Open in IMG/M |
3300017785|Ga0181355_1273209 | Not Available | 642 | Open in IMG/M |
3300017785|Ga0181355_1305793 | Not Available | 595 | Open in IMG/M |
3300017963|Ga0180437_10303490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1215 | Open in IMG/M |
3300017987|Ga0180431_10983140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
3300017991|Ga0180434_10434957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1014 | Open in IMG/M |
3300018080|Ga0180433_11249992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
3300018868|Ga0187844_10204172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 848 | Open in IMG/M |
3300019784|Ga0181359_1085001 | All Organisms → Viruses → Predicted Viral | 1180 | Open in IMG/M |
3300019784|Ga0181359_1119264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 945 | Open in IMG/M |
3300019784|Ga0181359_1143885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 826 | Open in IMG/M |
3300019784|Ga0181359_1261723 | Not Available | 518 | Open in IMG/M |
3300019784|Ga0181359_1269340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300020048|Ga0207193_1286771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1198 | Open in IMG/M |
3300020048|Ga0207193_1619709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
3300020048|Ga0207193_1792704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
3300020083|Ga0194111_10851558 | Not Available | 545 | Open in IMG/M |
3300020159|Ga0211734_10932539 | Not Available | 519 | Open in IMG/M |
3300020204|Ga0194116_10563129 | Not Available | 521 | Open in IMG/M |
3300020221|Ga0194127_10059013 | Not Available | 3010 | Open in IMG/M |
3300020513|Ga0208090_1027996 | Not Available | 784 | Open in IMG/M |
3300020710|Ga0214198_1003923 | All Organisms → Viruses → Predicted Viral | 2129 | Open in IMG/M |
3300020731|Ga0214170_1039569 | Not Available | 723 | Open in IMG/M |
3300021128|Ga0214176_1006046 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1385 | Open in IMG/M |
3300021131|Ga0214206_1017173 | Not Available | 925 | Open in IMG/M |
3300021136|Ga0214167_1094840 | Not Available | 553 | Open in IMG/M |
3300021139|Ga0214166_1004597 | Not Available | 4688 | Open in IMG/M |
3300021139|Ga0214166_1075782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
3300021140|Ga0214168_1110669 | Not Available | 581 | Open in IMG/M |
3300021142|Ga0214192_1012634 | All Organisms → Viruses → Predicted Viral | 3309 | Open in IMG/M |
3300021424|Ga0194117_10124222 | All Organisms → Viruses → Predicted Viral | 1345 | Open in IMG/M |
3300021438|Ga0213920_1047750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 899 | Open in IMG/M |
3300021956|Ga0213922_1084207 | Not Available | 658 | Open in IMG/M |
3300021956|Ga0213922_1124380 | Not Available | 506 | Open in IMG/M |
3300022063|Ga0212029_1012901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1055 | Open in IMG/M |
3300022179|Ga0181353_1159046 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
3300022179|Ga0181353_1159354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
3300022190|Ga0181354_1090021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1006 | Open in IMG/M |
3300022190|Ga0181354_1106050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 912 | Open in IMG/M |
3300022200|Ga0196901_1228446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
3300022407|Ga0181351_1000327 | Not Available | 13145 | Open in IMG/M |
3300022407|Ga0181351_1092351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1185 | Open in IMG/M |
3300022407|Ga0181351_1239241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
3300022407|Ga0181351_1245032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
3300022752|Ga0214917_10259696 | Not Available | 803 | Open in IMG/M |
3300024306|Ga0255148_1063318 | Not Available | 644 | Open in IMG/M |
3300024484|Ga0256332_1147506 | Not Available | 504 | Open in IMG/M |
3300024536|Ga0256338_1159748 | Not Available | 504 | Open in IMG/M |
3300024541|Ga0256343_1095068 | Not Available | 519 | Open in IMG/M |
3300024557|Ga0255283_1098980 | Not Available | 625 | Open in IMG/M |
3300024574|Ga0255275_1146695 | Not Available | 636 | Open in IMG/M |
3300024862|Ga0256317_1153444 | Not Available | 500 | Open in IMG/M |
3300024863|Ga0255246_1110069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
3300024863|Ga0255246_1163681 | Not Available | 515 | Open in IMG/M |
3300025075|Ga0209615_102103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1291 | Open in IMG/M |
3300025336|Ga0208619_116220 | Not Available | 550 | Open in IMG/M |
3300025358|Ga0208504_1033057 | Not Available | 655 | Open in IMG/M |
3300025369|Ga0208382_1012997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1245 | Open in IMG/M |
3300025372|Ga0207957_1007238 | Not Available | 1650 | Open in IMG/M |
3300025383|Ga0208250_1033193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 805 | Open in IMG/M |
3300025389|Ga0208257_1000883 | Not Available | 7808 | Open in IMG/M |
3300025389|Ga0208257_1009488 | All Organisms → Viruses → Predicted Viral | 1658 | Open in IMG/M |
3300025396|Ga0208874_1001445 | Not Available | 6773 | Open in IMG/M |
3300025400|Ga0208387_1045255 | Not Available | 703 | Open in IMG/M |
3300025400|Ga0208387_1067983 | Not Available | 532 | Open in IMG/M |
3300025407|Ga0208378_1077950 | Not Available | 511 | Open in IMG/M |
3300025416|Ga0208877_1045285 | Not Available | 717 | Open in IMG/M |
3300025426|Ga0208739_1004756 | Not Available | 2890 | Open in IMG/M |
3300025466|Ga0208497_1049045 | Not Available | 851 | Open in IMG/M |
3300025606|Ga0207954_1037394 | Not Available | 1381 | Open in IMG/M |
3300025646|Ga0208161_1170139 | Not Available | 524 | Open in IMG/M |
3300025647|Ga0208160_1035117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1496 | Open in IMG/M |
3300025647|Ga0208160_1168778 | Not Available | 517 | Open in IMG/M |
3300025648|Ga0208507_1013943 | Not Available | 3207 | Open in IMG/M |
3300025749|Ga0256314_1041746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
3300025757|Ga0256313_1066631 | Not Available | 535 | Open in IMG/M |
3300025757|Ga0256313_1075802 | Not Available | 501 | Open in IMG/M |
3300025777|Ga0208110_1011783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1027 | Open in IMG/M |
3300025779|Ga0208869_1018406 | Not Available | 943 | Open in IMG/M |
3300025838|Ga0208872_1039541 | Not Available | 2031 | Open in IMG/M |
3300025838|Ga0208872_1065321 | Not Available | 1457 | Open in IMG/M |
3300026454|Ga0256319_1117955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300026562|Ga0255285_1106135 | Not Available | 540 | Open in IMG/M |
3300026573|Ga0255269_1223587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
3300027136|Ga0255107_1059950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
3300027468|Ga0209247_1066983 | Not Available | 531 | Open in IMG/M |
3300027534|Ga0255125_1124677 | Not Available | 515 | Open in IMG/M |
3300027586|Ga0208966_1173181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
3300027600|Ga0255117_1097127 | Not Available | 558 | Open in IMG/M |
3300027621|Ga0208951_1169377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
3300027659|Ga0208975_1011387 | Not Available | 3044 | Open in IMG/M |
3300027659|Ga0208975_1106620 | Not Available | 810 | Open in IMG/M |
3300027697|Ga0209033_1239265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
3300027708|Ga0209188_1188691 | Not Available | 750 | Open in IMG/M |
3300027734|Ga0209087_1089165 | All Organisms → Viruses | 1326 | Open in IMG/M |
3300027747|Ga0209189_1073148 | Not Available | 1593 | Open in IMG/M |
3300027747|Ga0209189_1404332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300027749|Ga0209084_1111302 | Not Available | 1192 | Open in IMG/M |
3300027749|Ga0209084_1330259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
3300027754|Ga0209596_1356817 | Not Available | 562 | Open in IMG/M |
3300027763|Ga0209088_10237115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
3300027785|Ga0209246_10171939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 850 | Open in IMG/M |
3300027785|Ga0209246_10177419 | Not Available | 836 | Open in IMG/M |
3300027792|Ga0209287_10404694 | Not Available | 525 | Open in IMG/M |
3300027798|Ga0209353_10048245 | All Organisms → Viruses → Predicted Viral | 1961 | Open in IMG/M |
3300027798|Ga0209353_10109050 | Not Available | 1247 | Open in IMG/M |
3300027798|Ga0209353_10253848 | Not Available | 756 | Open in IMG/M |
3300027798|Ga0209353_10388534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300027798|Ga0209353_10405497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
3300027808|Ga0209354_10107541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1138 | Open in IMG/M |
3300027808|Ga0209354_10293248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
3300027808|Ga0209354_10347115 | Not Available | 584 | Open in IMG/M |
3300027892|Ga0209550_10217520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1289 | Open in IMG/M |
3300027896|Ga0209777_10349565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1127 | Open in IMG/M |
3300027901|Ga0209427_10897661 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
3300027902|Ga0209048_10696905 | Not Available | 669 | Open in IMG/M |
3300027917|Ga0209536_101562953 | Not Available | 801 | Open in IMG/M |
3300027963|Ga0209400_1038435 | Not Available | 2584 | Open in IMG/M |
3300027969|Ga0209191_1043249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2091 | Open in IMG/M |
3300027969|Ga0209191_1323841 | Not Available | 564 | Open in IMG/M |
3300028261|Ga0256316_1081914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
3300028271|Ga0255256_1088917 | Not Available | 539 | Open in IMG/M |
3300028392|Ga0304729_1259662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
3300028394|Ga0304730_1216843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
3300028394|Ga0304730_1271982 | Not Available | 599 | Open in IMG/M |
3300028530|Ga0255279_1041654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 796 | Open in IMG/M |
(restricted) 3300028571|Ga0247844_1078878 | Not Available | 1634 | Open in IMG/M |
3300031539|Ga0307380_10532040 | All Organisms → Viruses → Predicted Viral | 1026 | Open in IMG/M |
3300031566|Ga0307378_10880531 | Not Available | 744 | Open in IMG/M |
3300031669|Ga0307375_10221896 | Not Available | 1255 | Open in IMG/M |
3300031707|Ga0315291_10975787 | Not Available | 716 | Open in IMG/M |
3300031707|Ga0315291_11040977 | Not Available | 685 | Open in IMG/M |
3300031758|Ga0315907_10282021 | Not Available | 1369 | Open in IMG/M |
3300031787|Ga0315900_10373819 | All Organisms → Viruses → Predicted Viral | 1138 | Open in IMG/M |
3300031787|Ga0315900_10646478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
3300031813|Ga0316217_10091581 | All Organisms → Viruses → Predicted Viral | 1428 | Open in IMG/M |
3300031857|Ga0315909_10881885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
3300031857|Ga0315909_11000672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
3300031885|Ga0315285_10752236 | Not Available | 619 | Open in IMG/M |
3300031951|Ga0315904_10410338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1224 | Open in IMG/M |
3300031951|Ga0315904_10705074 | Not Available | 848 | Open in IMG/M |
3300031951|Ga0315904_11272706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
3300031952|Ga0315294_10510530 | All Organisms → Viruses → Predicted Viral | 1097 | Open in IMG/M |
3300032046|Ga0315289_11331886 | Not Available | 564 | Open in IMG/M |
3300032116|Ga0315903_10482884 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 984 | Open in IMG/M |
3300032156|Ga0315295_11944290 | Not Available | 554 | Open in IMG/M |
3300032177|Ga0315276_12089841 | Not Available | 576 | Open in IMG/M |
3300032668|Ga0316230_1044621 | Not Available | 2000 | Open in IMG/M |
3300033488|Ga0316621_10248855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1140 | Open in IMG/M |
3300033521|Ga0316616_103125075 | Not Available | 624 | Open in IMG/M |
3300033979|Ga0334978_0065882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1863 | Open in IMG/M |
3300034062|Ga0334995_0213473 | All Organisms → Viruses → Predicted Viral | 1330 | Open in IMG/M |
3300034062|Ga0334995_0764625 | Not Available | 534 | Open in IMG/M |
3300034082|Ga0335020_0398340 | Not Available | 663 | Open in IMG/M |
3300034101|Ga0335027_0289134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1113 | Open in IMG/M |
3300034102|Ga0335029_0713866 | Not Available | 542 | Open in IMG/M |
3300034112|Ga0335066_0297867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 914 | Open in IMG/M |
3300034112|Ga0335066_0574594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
3300034116|Ga0335068_0215923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 998 | Open in IMG/M |
3300034120|Ga0335056_0023025 | All Organisms → Viruses → Predicted Viral | 4300 | Open in IMG/M |
3300034120|Ga0335056_0270735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 952 | Open in IMG/M |
3300034166|Ga0335016_0138351 | Not Available | 1679 | Open in IMG/M |
3300034200|Ga0335065_0627128 | Not Available | 624 | Open in IMG/M |
3300034283|Ga0335007_0596402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
3300034284|Ga0335013_0794805 | Not Available | 530 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 24.04% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 11.50% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 9.76% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.67% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 7.32% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.53% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.48% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.14% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.14% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.44% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.74% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.74% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.74% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 1.39% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.39% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.39% |
Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 1.39% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 1.05% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.05% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.05% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.70% |
Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.70% |
Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.70% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.70% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.70% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.70% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.70% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.35% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.35% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.35% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.35% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.35% |
Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.35% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.35% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.35% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.35% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.35% |
Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.35% |
Pond Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil | 0.35% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000177 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 hypolimnion | Environmental | Open in IMG/M |
3300000439 | Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
3300001837 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM39, ROCA_DNA237_0.2um_Ob_C_3a | Environmental | Open in IMG/M |
3300001842 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2b | Environmental | Open in IMG/M |
3300001843 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM34, ROCA_DNA218_2.0um_bLM_C_2b | Environmental | Open in IMG/M |
3300002199 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - JUN 2013 | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003806 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300004767 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
3300006112 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 | Environmental | Open in IMG/M |
3300006128 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007609 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG | Environmental | Open in IMG/M |
3300007864 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0um | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300007983 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_C_D2_MG | Environmental | Open in IMG/M |
3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009186 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG | Environmental | Open in IMG/M |
3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012394 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_201_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
3300012707 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES154 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012717 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012721 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES139 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012760 | Freshwater microbial communities from Lake Croche, Canada - C_130709_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012766 | Freshwater microbial communities from Lake Montjoie, Canada - M_140807_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013089 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_330m | Environmental | Open in IMG/M |
3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300016754 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017700 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
3300017987 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_1 metaG | Environmental | Open in IMG/M |
3300017991 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaG | Environmental | Open in IMG/M |
3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
3300018868 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_50 | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
3300020513 | Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020710 | Freshwater microbial communities from Trout Bog Lake, WI - 20SEP2008 epilimnion | Environmental | Open in IMG/M |
3300020731 | Freshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 epilimnion | Environmental | Open in IMG/M |
3300021128 | Freshwater microbial communities from Trout Bog Lake, WI - 20AUG2007 epilimnion | Environmental | Open in IMG/M |
3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
3300021136 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 hypolimnion | Environmental | Open in IMG/M |
3300021139 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
3300021140 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
3300021142 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion | Environmental | Open in IMG/M |
3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300024306 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h | Environmental | Open in IMG/M |
3300024484 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024536 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024541 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024557 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024574 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024862 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024863 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025075 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025336 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Jul07 (SPAdes) | Environmental | Open in IMG/M |
3300025358 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes) | Environmental | Open in IMG/M |
3300025369 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes) | Environmental | Open in IMG/M |
3300025372 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes) | Environmental | Open in IMG/M |
3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025389 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes) | Environmental | Open in IMG/M |
3300025396 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 (SPAdes) | Environmental | Open in IMG/M |
3300025400 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 (SPAdes) | Environmental | Open in IMG/M |
3300025407 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025416 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH29Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025426 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 (SPAdes) | Environmental | Open in IMG/M |
3300025466 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 (SPAdes) | Environmental | Open in IMG/M |
3300025606 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M (SPAdes) | Environmental | Open in IMG/M |
3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025648 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 (SPAdes) | Environmental | Open in IMG/M |
3300025749 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025757 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025777 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH13Jun08 (SPAdes) | Environmental | Open in IMG/M |
3300025779 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun08 (SPAdes) | Environmental | Open in IMG/M |
3300025838 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 (SPAdes) | Environmental | Open in IMG/M |
3300026454 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026562 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027136 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8h | Environmental | Open in IMG/M |
3300027468 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
3300027534 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8d | Environmental | Open in IMG/M |
3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027600 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h | Environmental | Open in IMG/M |
3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
3300027901 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 (SPAdes) | Environmental | Open in IMG/M |
3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028261 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028271 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300028530 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031813 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoA | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032668 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025 | Environmental | Open in IMG/M |
3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
TB18AUG2009H_0203161 | 3300000177 | Freshwater | MATNRLKREMENREITERPKQWMPPELLPEPDKQAG |
TBL_comb48_EPIDRAFT_10142385 | 3300000439 | Freshwater | MAEVKKTRELETRAVVERPQQWMNPELLPEPDKQAGYAYRWIRVS |
RCM39_10552062 | 3300001837 | Marine Plankton | MSDNKVTRELKTRATQERPKQWAPAELLPEPDKEAG |
RCM30_10211341 | 3300001842 | Marine Plankton | MAENRLTRELETRAVSERPKQWQQAEMLPEPDKQPGY |
RCM30_10343851 | 3300001842 | Marine Plankton | MAENRLARDVVTRTTSERPKQWQQPELLPEPDKQPG |
RCM34_11537971 | 3300001843 | Marine Plankton | MAENRLSRDAETRESKARPKQWQQPESLPEPDKMPGY |
metazooDRAFT_12234022 | 3300002199 | Lake | MKMTANNKISRDMQTRELTERPKQWAPPELLPEPD |
B570J29032_1092090521 | 3300002408 | Freshwater | MTTNKLARELDTRETATRPKQWQQPELLPEPDKQPGYKY |
B570J29032_1097554123 | 3300002408 | Freshwater | MADNRLQREITSRTSQERPKQWQQAELLPEPDRAPGFAYR |
JGI25908J49247_100435932 | 3300003277 | Freshwater Lake | MATDVKVAESRLSREMQSRATQERPKKWQQAELLPEPDKQPGY |
JGI25908J49247_101348712 | 3300003277 | Freshwater Lake | MATDVKAAENRLSREMQSRATQERPKKWQQAELLPEPDKQPGY |
JGI25911J50253_100998311 | 3300003411 | Freshwater Lake | MAENRITRELETRAVQERPKQWTQPELLPEPDRQAGFDYR |
JGI25914J50564_100457653 | 3300003429 | Freshwater Lake | MPTNRLQREVDNREVAERPKQWMPPDLLPEPDKQAGYAYRW |
Ga0007864_10156511 | 3300003806 | Freshwater | MAESNRNPREIETRQQELRPKVWALPELLPEPDKHPDWGY |
Ga0069718_132534622 | 3300004481 | Sediment | MAEVKDNRLTRELETRAVQERPKQWMQAELLPEPDKHPDFAYRWIRVS |
Ga0007750_14238361 | 3300004767 | Freshwater Lake | MANNRLTRELESRKEVERPKQWAPAETLPEPDKQPGFAYRWIRIS |
Ga0007796_101876602 | 3300004804 | Freshwater | MATKNNTPRELDTRATYERPQQWAPAELLPEPDKQAGYAYR |
Ga0068876_100414695 | 3300005527 | Freshwater Lake | MAENRLTRELETRTVQERPKQWTPPELLPEPDKQP |
Ga0049081_101922221 | 3300005581 | Freshwater Lentic | MAENKLNRDVSTREFGERPTQWKQAELLPEPDKQAGY |
Ga0079957_10631735 | 3300005805 | Lake | MAEQMKGRLDRELETRTQSERPKTWAPPELLPEPDKQPGY |
Ga0075470_100942811 | 3300006030 | Aqueous | MAENRLTRELEARTQQERPKQWAPAELLPEPDKQP |
Ga0075470_101093552 | 3300006030 | Aqueous | MANTRVTREVENREFSERPKQWMPAELLPEPDKEAGF |
Ga0007876_10033091 | 3300006071 | Freshwater | MAENNRTPREVATRQQAERPKAWSLPELLPEPDKQAGF |
Ga0007876_11037392 | 3300006071 | Freshwater | MAEQRIPRELTTRTTMERPKQWTPPELLPEPDREPGM |
Ga0007857_10545542 | 3300006112 | Freshwater | MTTNPINKITRASETRALTERPKQWMPPEALPEPDKQA |
Ga0007828_10211933 | 3300006128 | Freshwater | MANAQQLNRETESRSLTERPKQWMPPELLPEPDKQPGY |
Ga0070749_107100161 | 3300006802 | Aqueous | MAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPDYRYRWIRVSNLN |
Ga0075467_105841492 | 3300006803 | Aqueous | MAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPDYA |
Ga0070748_13239722 | 3300006920 | Aqueous | MAENKSRIDRELETRAVTERPKQWMPAELLPEPDKQAG |
Ga0099848_11481222 | 3300007541 | Aqueous | MAEQNRIKRELESRAISARPQQWMPPELLPEPDKEAGYA |
Ga0102945_10422172 | 3300007609 | Pond Water | MATQEKATSNNRLARELETRATSERPKAWQPASVLPEPDKQPGYSYRW |
Ga0105749_10083404 | 3300007864 | Estuary Water | MAENRIPREVDTRQQDERLKQWQAPELLPEPDKQAGF |
Ga0105746_10441114 | 3300007973 | Estuary Water | MATENRLQREMTSRAVQERPKQWQQADLLPEPDKEP |
Ga0102941_13229261 | 3300007983 | Pond Soil | MAENRIPRDTQSRAQAERPQQWKPPELLPEPIKEEGF |
Ga0075480_102168091 | 3300008012 | Aqueous | MATQEKATSDNRLARELETRATSERPKAWQPASVLPEPDKQPGY |
Ga0114347_10569731 | 3300008114 | Freshwater, Plankton | MAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPD |
Ga0114350_10605063 | 3300008116 | Freshwater, Plankton | MAENKLTRELETRAVQERPKQWTPPELLPEPDKQPGF |
Ga0114363_11614292 | 3300008266 | Freshwater, Plankton | MAENRLQREFESRSTTERPKAWMPASALPEPDKQPGYAYR |
Ga0114363_12055492 | 3300008266 | Freshwater, Plankton | MAENRLTRELENRAQQERPKQWAPAETLPEPDKRPGFAYRWV |
Ga0114876_11174811 | 3300008448 | Freshwater Lake | MTENRVAREHEDRTSAKRPESWAPAGGLPEPDRQPGYAYRWIRVSMVE |
Ga0105105_105403932 | 3300009009 | Freshwater Sediment | MAENRLTRELETRQTTERPKQWAPAELLPEPDKQPG |
Ga0105105_107604301 | 3300009009 | Freshwater Sediment | MAEQRTPREVANRQQDMRPQQWKPPELLPEPDKMDGYSY |
Ga0105093_103076121 | 3300009037 | Freshwater Sediment | MAENRVQREVQTRATTERPKQWMPAELLPEPDKQAG |
Ga0105099_107068271 | 3300009082 | Freshwater Sediment | MAEKRLDRELETRELVERPKQWMPADLLPEPDKQAG |
Ga0118687_102127302 | 3300009124 | Sediment | MATQEKATSENRLARELETRATSERPKSWQPASVLPEPDKQPGYTYRWVR |
Ga0114962_100519285 | 3300009151 | Freshwater Lake | MAEIKDNKLTRELTTRAVQERPKQWMQPEMLPEPDKEPGYNY |
Ga0114962_103035492 | 3300009151 | Freshwater Lake | MAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPDYNYRWIRVSNLNVS |
Ga0114980_100004741 | 3300009152 | Freshwater Lake | MAGNNRITRELESREVTERPKQWQLPELLPEPDKQAGF |
Ga0114968_100078221 | 3300009155 | Freshwater Lake | MAENKLNREVTTREFEERTKQWMNPELITETDKKEGYAYRLFR |
Ga0114978_105515781 | 3300009159 | Freshwater Lake | MAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPDYSYRWIRVAN |
Ga0114966_107037052 | 3300009161 | Freshwater Lake | MAENRLSRELQNRATTERPKQWMPAELLPEPDKQA |
Ga0114975_100010101 | 3300009164 | Freshwater Lake | MAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPDY |
Ga0105102_102603732 | 3300009165 | Freshwater Sediment | MAENRLKRELDNRTQAERPKQWAPASLLPEPDKEPGFV |
Ga0105102_103417491 | 3300009165 | Freshwater Sediment | MADIKDNKLTRELTTRAVQERPKQWAQPELLPEPDKQPGYNYRWIRV |
Ga0105104_109736472 | 3300009168 | Freshwater Sediment | MAETRIPREVSNRQQSMRIENWKPPELLPEPDMQP |
Ga0105097_101267621 | 3300009169 | Freshwater Sediment | MAENRLTRELENRAQQERPKQWAPAETLPEPDKQAGFAYR |
Ga0114974_108154752 | 3300009183 | Freshwater Lake | MAESRLQREITNRTSQERPKQWQQAELLPEPDKAPGFAYRWI |
Ga0114976_101334443 | 3300009184 | Freshwater Lake | MADNTNARTTRELETRALVERPKQWMQPELLPEPDKEA |
Ga0114965_115673 | 3300009186 | Freshwater Lake | MATENRLQREMTSRATQERPKQWQQADLLPEPDKEP |
Ga0114972_104571171 | 3300009187 | Freshwater Lake | MAEIKENRIPREIATRAEFERPKQWAQPESLPEPDKQPG |
Ga0136644_100838461 | 3300010334 | Freshwater Lake | MATDNRLQREMTSRAAQERPKQWQQADLLPEPDKEPGYAYRWIR |
Ga0136644_103837412 | 3300010334 | Freshwater Lake | MAENRLARELENRTATERPKQWQPASTLPEPDKQPGYAYRWIR |
Ga0129333_106061781 | 3300010354 | Freshwater To Marine Saline Gradient | MAENRLARELETRSEVERPKAWQPASALPEPDKQPGYSY |
Ga0129336_105334102 | 3300010370 | Freshwater To Marine Saline Gradient | MAENRTPRNIETRTQAERPKQWMPPELLPEPDKQPGY |
Ga0133913_102091941 | 3300010885 | Freshwater Lake | MAENRKPREIETRQQSVRPEAWKPPELLPEPDKQAGF |
Ga0133913_115002191 | 3300010885 | Freshwater Lake | MATSNTRATRDLESRELTERPKQWALPELLPEPDKQAGYSYRWIRV |
Ga0133913_136299901 | 3300010885 | Freshwater Lake | MTTKRIDREVETRDKSERLQQWAPAELLPEPVKMPGYKYH |
Ga0139557_10471452 | 3300011010 | Freshwater | MAENRLTRELDTRATSERPKQWTPAELLPEPDKQAGYAYR |
Ga0153800_10294561 | 3300011995 | Freshwater | MATNRLERELENRTMQERPKQWQQPELLPEPDKQTGYAY |
Ga0123365_12857572 | 3300012394 | Marine | MATQEKATSNNRLARELETRATAERPKSWQPASVLPEPDQQPGYTYRWVRIAQLN |
Ga0157210_10162063 | 3300012665 | Freshwater | MATENRLQREMTSRTMQERPKQWQQADLLPEPDKE |
Ga0157623_10238791 | 3300012707 | Freshwater | MAENRKPREVEDRQQSMRPQQWKPPELLPEPDKQAGFS |
Ga0157609_12271122 | 3300012717 | Freshwater | MAENRLARELDTRSTAERPKQWMRPETLPQPDKQPGYAY |
Ga0157612_10531611 | 3300012721 | Freshwater | MANNRLTRELDTRATSERPQQWAPAELLPEPDKQAGYAY |
Ga0138273_11252202 | 3300012760 | Freshwater Lake | MAESRLQREMTSRSTQERPQQWKPAELLPEPDKAPGYAYR |
Ga0138282_10036681 | 3300012766 | Freshwater Lake | MAESRLQREMTVRTEQERPKSWRPAETLPEPDKQP |
Ga0138282_12407271 | 3300012766 | Freshwater Lake | MAGNNKVTRDLETREVVERPKQWALPELLPEPDKEAGFSYRWI |
Ga0163203_11140071 | 3300013089 | Freshwater | MAENRIPREVEDRKQDERPKQWQAPELLPEPDKEPGF |
(restricted) Ga0172372_104819272 | 3300013132 | Freshwater | MADKTPRSIETRTMAERPKMWTPPELLPEPDKQPGYAY |
Ga0136641_10566913 | 3300013286 | Freshwater | MATNRLQRELESRTQQERPKQWTPPELLPEPDKEEG* |
Ga0170791_119953252 | 3300013295 | Freshwater | MAENRKPRELEDRMMMERPKQWQLPDSLPEPDKQPGYDYRWIRVA |
Ga0182021_112505382 | 3300014502 | Fen | MTTKRIDREVETRDKSERLQQWAPAELLPEPVKIPGY |
Ga0182021_133256021 | 3300014502 | Fen | MSENNRLKREMESRAVQERPKQWQEASLLPEPDKEPG |
Ga0119960_10027011 | 3300014811 | Aquatic | MAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPDYSYR* |
Ga0134315_10282841 | 3300014962 | Surface Water | MATNRLDRELENRSLQERPKQWQPPELLPEPDKQPGYAY |
Ga0134315_10589801 | 3300014962 | Surface Water | MADNTNARTTRELETRALTERPKQWMPPELLPEPD |
Ga0181338_10016435 | 3300015050 | Freshwater Lake | MATDVKVAESRLSREMQSRATQERPKKWQQAELLPEPDKQPGYA |
Ga0181338_10117001 | 3300015050 | Freshwater Lake | MAEIKENRIPREIATRAEFERPKQWAQPELLPEPDKEPGYN |
Ga0181338_10420232 | 3300015050 | Freshwater Lake | MATDVKAAENRLSREMQSRATQERPKKWQQAELLPEPDKQPGYA |
Ga0182072_12308211 | 3300016754 | Salt Marsh | MATQEKATSDNRLARELETRATSERPKAWQPASVLPEPDKQPGYAYRWVR |
Ga0181339_10344552 | 3300017700 | Freshwater Lake | MANNRLTREVDTRVTSERPQQWAPAELLPEPDKQAG |
Ga0181364_10593071 | 3300017701 | Freshwater Lake | MAEIKETRAPREIETRAEFERPKQWAQPELLPEPDKQPGYNY |
Ga0181347_10261871 | 3300017722 | Freshwater Lake | MVAENKLTRELDTRVQAERPKSWQPASTLPEPDREPGF |
Ga0181347_10418313 | 3300017722 | Freshwater Lake | MARNDLARELETRTALERPKSWQPASSLPEPDKQPG |
Ga0181347_10769782 | 3300017722 | Freshwater Lake | MAENRTPRSIETRTTEERPKQWQQPELLPEPDKQEGYAY |
Ga0181347_11940451 | 3300017722 | Freshwater Lake | MSENNRLKREVESRTMQERPKQWMPAELLPEPDKEP |
Ga0181362_10464572 | 3300017723 | Freshwater Lake | MAENRKPRELEDRLMAERPKQWQEPDTLPKPDKHPDYAYR |
Ga0181365_10255251 | 3300017736 | Freshwater Lake | MAENRLTRELETRAVQERPKQWMLPDMLPEPDKQA |
Ga0181365_10293721 | 3300017736 | Freshwater Lake | MATNRLDREVDTRATSERPKQWAPAELLPEPDKQAGY |
Ga0181352_10106605 | 3300017747 | Freshwater Lake | MTDKRINRELENRTNVERPQAWAPASALPEPDKQPGYSYRWI |
Ga0181352_10767231 | 3300017747 | Freshwater Lake | MANNRLTRELDTRVEVERPTHWAPPELLPEPDKQAGY |
Ga0181352_10855001 | 3300017747 | Freshwater Lake | MAENRKPREVEDRQQSMRPQQWKPPELLPEPDKQAG |
Ga0181344_10365043 | 3300017754 | Freshwater Lake | MAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPDYAY |
Ga0181344_10562461 | 3300017754 | Freshwater Lake | MAENRLARELENRSNVERPQAWAPASALPEPDKQPG |
Ga0181344_10647402 | 3300017754 | Freshwater Lake | MAENRKPRELEDRLLAERPKQWQQAELLPEPDKHPDYSY |
Ga0181344_10706222 | 3300017754 | Freshwater Lake | MANTRLTRELETREVQVRPKQWAPAELLPEPDKQPGF |
Ga0181344_10973372 | 3300017754 | Freshwater Lake | MNTKRIDREVETRVASERPQQWAPAELLPEPKKNGGV |
Ga0181356_12220782 | 3300017761 | Freshwater Lake | MATDVKVAESRLSREMQSRATQERPKKWQQAELLPEPDKQPGYAY |
Ga0181343_10493631 | 3300017766 | Freshwater Lake | MATNRLERELQNRTQSERPKQWSQPELLPEPDKQA |
Ga0181343_11357762 | 3300017766 | Freshwater Lake | MAENRLTRELETRAVQERPKQWALPEILPEPDKQAG |
Ga0181343_11569271 | 3300017766 | Freshwater Lake | MAENRLARELEKRSDVERPKAWAPASALPEPDKQPGYSYR |
Ga0181343_11827802 | 3300017766 | Freshwater Lake | MAENRKPRDLEDRIQAERPKQWQQAELLPEPDKDPDYAYRWIRVANLN |
Ga0181358_10162591 | 3300017774 | Freshwater Lake | MATNRLDRSIDTRELVERPKQWAPAELLPEPDKQAGYAY |
Ga0181349_10814241 | 3300017778 | Freshwater Lake | MAENRLTRELETRAVQERPKQWMLPDMLPEPDKQAGYNYR |
Ga0181349_11266102 | 3300017778 | Freshwater Lake | MTKKLDREAETRATSERPTQWAPAELLPEPDKQAGYSY |
Ga0181349_12630601 | 3300017778 | Freshwater Lake | MAENRKPRELEDRLMAERPKQWQEPDTLPEPDKHPDYAYRW |
Ga0181349_13032271 | 3300017778 | Freshwater Lake | MATDVKAAESRLSREMQSRATQERPKKWQQAELLPEPDKQPGYAYR |
Ga0181346_10147691 | 3300017780 | Freshwater Lake | MSEVRESREFDTRAIYERPTQWQQPELLPEPDKQAGYSYRWIRVANL |
Ga0181348_10600971 | 3300017784 | Freshwater Lake | MAENRLARELENRTNVERPQAWAPASALPEPDKQPGYAYRS |
Ga0181348_10855351 | 3300017784 | Freshwater Lake | MAEVKENRISREIETRAVLERPKQWAQPELLPEPDKTLGW |
Ga0181355_10358166 | 3300017785 | Freshwater Lake | MAENRITRDVDTRAQAERPKAWQPASTLPEPDKLDGY |
Ga0181355_10411735 | 3300017785 | Freshwater Lake | MATNRLQRELQSRTQSERPKQWAQPELLPEPDKQPGY |
Ga0181355_12732091 | 3300017785 | Freshwater Lake | MAENRLQREFQNRSTTERPKAWMPASALPEPDKQP |
Ga0181355_13057932 | 3300017785 | Freshwater Lake | MATNRLERELQNRTQSERPKQWSQPELLPEPDKQAGYAYRWIRISSLN |
Ga0180437_103034901 | 3300017963 | Hypersaline Lake Sediment | MAEQKETRLARELETREVTERPKTWAPASTLPEPDR |
Ga0180431_109831402 | 3300017987 | Hypersaline Lake Sediment | MAEQKETRLARELETREVTERPKTWAPASTLPEPDKEPGY |
Ga0180434_104349571 | 3300017991 | Hypersaline Lake Sediment | MAEQNRVSREVSTRATTERPKQWMPPEMLPEPDKQA |
Ga0180433_112499922 | 3300018080 | Hypersaline Lake Sediment | MAQNRLAREIEDRTAAERPKQWQPASALPEPDKQPGYAYRW |
Ga0187844_102041721 | 3300018868 | Freshwater | MADRTPRNLETRDSETRPAFWRPPELLPEPDKQAGYT |
Ga0181359_10850013 | 3300019784 | Freshwater Lake | MVDVKDNKLTRELTTRAVQERPKQWMQPELLPEPDKEPGYNYRWT |
Ga0181359_11192641 | 3300019784 | Freshwater Lake | MAENRKPRELEDRLMAERPKQWQQAELLPEPDKHP |
Ga0181359_11438852 | 3300019784 | Freshwater Lake | MAEVKENRISREIETRAVLERPKQWAQPELLPEPDT |
Ga0181359_12617232 | 3300019784 | Freshwater Lake | MATDVKVAESRLSREMQSRATQERPKKWQQAELLPEPDKQPG |
Ga0181359_12693401 | 3300019784 | Freshwater Lake | MAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPDYAYRWIRV |
Ga0207193_12867713 | 3300020048 | Freshwater Lake Sediment | MTKKLDRESETRATSQRPQQWAPAELLPEPDKQAGY |
Ga0207193_16197091 | 3300020048 | Freshwater Lake Sediment | MAENRLARELEKRSDVERPKAWMPASALPEPDKQPGYAYRW |
Ga0207193_17927041 | 3300020048 | Freshwater Lake Sediment | MADIKDNKLTRELTTRAVQERPKQWMQPELLPEPDKQPGYNY |
Ga0194111_108515581 | 3300020083 | Freshwater Lake | MSTQNRLSRELNTRALQERPKQWMPPETLPEPDKMPGYAY |
Ga0211734_109325391 | 3300020159 | Freshwater | MATNRLQRELESRTQSERPKQWSQPELLPEPDKQPGYA |
Ga0194116_105631291 | 3300020204 | Freshwater Lake | MPENKLERELTSRAMSERPKQWTPPELLPEPDKEAGY |
Ga0194127_100590131 | 3300020221 | Freshwater Lake | MAENRLARELETRSRTERPKQWQRPDAIPEPHKEPGY |
Ga0208090_10279962 | 3300020513 | Freshwater | MADNTNARTTRELETRALVERPKQWMQPELLPEPDKEAGFAYRWIRV |
Ga0214198_10039235 | 3300020710 | Freshwater | MAENRTPREIQTRIADERPKQWQAPELLPEPDKEAGYA |
Ga0214170_10395692 | 3300020731 | Freshwater | MSDTRAPREIKTREFEERPKQWMPPDLLPEPDKQPGFEYRWIRV |
Ga0214176_10060461 | 3300021128 | Freshwater | MTTNPINKITRASETRALTERPKQWMPPEALPEPDKQAG |
Ga0214206_10171732 | 3300021131 | Freshwater | MTQTAEKSRLTREMESRNLTERPKQWQQPELLPEPDKEP |
Ga0214167_10948401 | 3300021136 | Freshwater | MANAPKSSTRELETREFAERPKQWMPPELLPEPDKQPGFAY |
Ga0214166_10045976 | 3300021139 | Freshwater | MATKATREVTNREFDERPKSWAPPELLPEPDKESGFEYR |
Ga0214166_10757821 | 3300021139 | Freshwater | MAQNKLDRELDNRELSERPKQWMPPELLPQPDIQPGYAYRWIRTATL |
Ga0214168_11106692 | 3300021140 | Freshwater | MATTQNRITRELETRALTERPKQWMPPEALPEPDKEDGFAYRW |
Ga0214192_10126341 | 3300021142 | Freshwater | MAESNRNPREIETRQQDLRPKTWSLPELLPEPDKN |
Ga0194117_101242223 | 3300021424 | Freshwater Lake | MAENKLARELETREQTERPKTWQPASALPEPDKQPGYA |
Ga0213920_10477501 | 3300021438 | Freshwater | MAENRTPRNVETRVQAERPKQWKPAELLPEPDKLPGYAYR |
Ga0213922_10842072 | 3300021956 | Freshwater | MAESRLQREITNRTSQERPKQWQQAELLPEPDKAPGFAYRW |
Ga0213922_11243801 | 3300021956 | Freshwater | MAGTKLTRELETRETQVRPKQWAPAELLPEPDKQPGFN |
Ga0212029_10129012 | 3300022063 | Aqueous | MAESRTPRDVDTRESKARPKQWQQPESLPEPDKMPGYAYRWIR |
Ga0181353_11590461 | 3300022179 | Freshwater Lake | MAENRVARELESRSTVERPKAWAPASALPEPDKQPGYAYRWIRA |
Ga0181353_11593542 | 3300022179 | Freshwater Lake | MAENRLARELENRSNVERPQAWMPASALPEPDKQPGYSYRW |
Ga0181354_10900211 | 3300022190 | Freshwater Lake | MAENRKPRELEDRLMAERPKQWQEPDTLPKPDKHPDYAYRWIRVATLN |
Ga0181354_11060501 | 3300022190 | Freshwater Lake | MAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPDYAYRWI |
Ga0196901_12284462 | 3300022200 | Aqueous | MAEQNRVSREVSTRATTERPKQWMPPEMLPEPDKQAGFDY |
Ga0181351_10003271 | 3300022407 | Freshwater Lake | MAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPDYAYRWIRVANLN |
Ga0181351_10923511 | 3300022407 | Freshwater Lake | MSEVRESREFDTRAIYERPTQWQQPELLPEPDKQAGYSYRWIRVANLN |
Ga0181351_12392412 | 3300022407 | Freshwater Lake | MAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPDYAYRW |
Ga0181351_12450321 | 3300022407 | Freshwater Lake | MAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPDYAYR |
Ga0214917_102596961 | 3300022752 | Freshwater | MAEVRIKRDVETRATYERPTEWSQPELLPEPDKEA |
Ga0255148_10633182 | 3300024306 | Freshwater | MAENRLTRELETRVTQERPKQWAPAELLPEPDMQP |
Ga0256332_11475062 | 3300024484 | Freshwater | MAENRTPRNIETRTQAERPKQWAPPELLPEPDKQPGYKY |
Ga0256338_11597481 | 3300024536 | Freshwater | MAENRLTRELETRAVQERPKQWAPAELLPEPDKEPGF |
Ga0256343_10950682 | 3300024541 | Freshwater | MAENRLTRELDKRTAVERPTHWAPPELLPEPDKQAGYPY |
Ga0255283_10989801 | 3300024557 | Freshwater | MAENRLTRELDKRTAVERPTHWAPPELLPEPDKQAGYAYRW |
Ga0255275_11466951 | 3300024574 | Freshwater | MAENRTPRNIETRTQAERPKQWAPPELLPEPDKQP |
Ga0256317_11534441 | 3300024862 | Freshwater | MAEKRLTREFETRDAEERPKQWALPEILPEPDKQAGYNYR |
Ga0255246_11100691 | 3300024863 | Freshwater | MAENRKPRELEDRNAEERPKQWAQPELLPEPDKHPDYKYRWIR |
Ga0255246_11636812 | 3300024863 | Freshwater | MANTRLQREVDTRATSERPTQWAPAELLPEPDKQTGYAY |
Ga0209615_1021031 | 3300025075 | Freshwater | MAENRASRELESRVVSERPKQWAPAELLPEPDKQPGF |
Ga0208619_1162201 | 3300025336 | Freshwater | MTANPINKITRASETRALTERPKQWMPPEALPEPDKQAGYTYR |
Ga0208504_10330571 | 3300025358 | Freshwater | MADTRIPREVSNRQQDERPKAWRPPELLPEPDKQTG |
Ga0208382_10129971 | 3300025369 | Freshwater | MTKATREVTNREFDERPKSWAPPELLPEPDKQAGF |
Ga0207957_10072381 | 3300025372 | Freshwater | MAENRVPREVSNRQQAERPKAWRPPELLPEPDKQAG |
Ga0208250_10331932 | 3300025383 | Freshwater | MAQNKLDRELDNRELSERPKQWMPPELLPQPDIQPGYAYRWIRTATLN |
Ga0208257_10008838 | 3300025389 | Freshwater | MAVNRIDREADNRVVAERPKQWAPAELLPEPIKQPGYAYR |
Ga0208257_10094881 | 3300025389 | Freshwater | MAENKLNRDLTTRALTERPKQWMPPELLPEPDKEPGYG |
Ga0208874_10014456 | 3300025396 | Freshwater | MAQNRITRETDNREFAERPKQWMPPELLPEPDKEAGYSY |
Ga0208387_10452552 | 3300025400 | Freshwater | MAENRLTRELETRAVVERPKQWSQPELLPEPDKQPGFAY |
Ga0208387_10679831 | 3300025400 | Freshwater | MAQNRITRETDNREFAERPKQWMPPELLPEPDKEA |
Ga0208378_10779501 | 3300025407 | Freshwater | MADTRIPREVSNRQQTERPKTWRPPELLPEPDKQA |
Ga0208877_10452852 | 3300025416 | Freshwater | MTAKRNNRDTEVREMAERPKQWRPPELLPEPDKEEGYE |
Ga0208739_10047561 | 3300025426 | Freshwater | MTEQNRTQRELTSRALTERPKQWTPPELLPEPDKEAGMSY |
Ga0208497_10490451 | 3300025466 | Freshwater | MAETRTPREIQTRIADERPKQWQAPELLPEPDKQPGYE |
Ga0207954_10373943 | 3300025606 | Freshwater | MATNRLQRELEVRTQQERPKQWTPPELLPEPDKEEGYVY |
Ga0208161_11701391 | 3300025646 | Aqueous | MAENRIKRELESRALTERPKQWMPPELLPEPDKEAGYE |
Ga0208160_10351171 | 3300025647 | Aqueous | MAESRTPRDVDTRESKARPKQWQQPESLPEPDKMPGYAY |
Ga0208160_11687781 | 3300025647 | Aqueous | MAENRIKRELESRALTERPKQWMPPELLPEPDKEAGYEYR |
Ga0208507_10139435 | 3300025648 | Freshwater | MADNRTPRELTTRVTMERPKQWTPPDLLPEPDKEAGMSTDGLEF |
Ga0256314_10417462 | 3300025749 | Freshwater | MAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPDYRYRWIRVANLNAA |
Ga0208150_12095491 | 3300025751 | Aqueous | MATQEKATSDNRLARELETRATSERPKAWQPASVLPEPDKQPGYAYR |
Ga0256313_10666311 | 3300025757 | Freshwater | MATDVKVAESRLSREMQSRATQERPKKWQQAELLPEPDKQPGYAYRW |
Ga0256313_10758022 | 3300025757 | Freshwater | MPTNRLQREADSREVTERPKQWSPPDLLPEPDKQA |
Ga0208110_10117832 | 3300025777 | Freshwater | MTEQNRTQRELTSRALTERPKQWTPPELLPEPDKEAGMSYR |
Ga0208869_10184061 | 3300025779 | Freshwater | MANNNRTPREIETRQQEARPMAWKPPELLPEPDKQA |
Ga0208872_10395415 | 3300025838 | Freshwater | MANTRIPREVSDRQQSERPKQWRPPELLPEPDKQP |
Ga0208872_10653211 | 3300025838 | Freshwater | MANNNRIPREVETRQQAERPKAWTPPELLPEPDKQA |
Ga0256319_11179551 | 3300026454 | Freshwater | MAENRKPRELEDRNAEERPKQWAQPELLPEPDKHPDYKYRWIRV |
Ga0255285_11061352 | 3300026562 | Freshwater | MAENRLTRELDKRTAVERPTHWAPPELLPEPDKQAGYAYRWI |
Ga0255269_12235872 | 3300026573 | Freshwater | MTETRLARELDTRVEAERPKVWQPASTLPEPDKQPGFAYR |
Ga0255107_10599502 | 3300027136 | Freshwater | MADIKDNKLTRELTTRAVQERPKQWAQPELLPEPDKQPGYNYRWIR |
Ga0209247_10669831 | 3300027468 | Freshwater Lake | MAENRIPREVEDRKQDERPKQWQAPELLPEPDKEPGFAY |
Ga0255125_11246772 | 3300027534 | Freshwater | MANTRLQREVDTRATSERPTQWAPAELLPEPDKQTGYAYR |
Ga0208966_11731811 | 3300027586 | Freshwater Lentic | MAENRKPRELEDRLMAERPKQWQEPDTLPEPDKHPDY |
Ga0255117_10971271 | 3300027600 | Freshwater | MANTRLQREVDTRATSERPTQWAPAELLPEPDKQTG |
Ga0208951_11693772 | 3300027621 | Freshwater Lentic | MAENKLNRELETRAVQERPKQWAPPELLPEPDKQPGYAY |
Ga0208975_10113871 | 3300027659 | Freshwater Lentic | MAENRKPREVEDRQQSMRPQQWKPPELLPEPDKQA |
Ga0208975_11066202 | 3300027659 | Freshwater Lentic | MAEKRLTREFETRDVEQRPKQWALPEILPEPDKQAGYN |
Ga0209033_12392652 | 3300027697 | Freshwater Lake | MAENRLARELEKRSDVERPKAWAPASALPEPDKQPGYAY |
Ga0209188_11886912 | 3300027708 | Freshwater Lake | MAESRLEREMTVRTEQERPKSWRPAETLPEPDKQPGYA |
Ga0209087_10891651 | 3300027734 | Freshwater Lake | MAENKLNREVTTREFEERPKQWMPPELLPEPDKQEG |
Ga0209189_10731483 | 3300027747 | Freshwater Lake | MATDNRLQREMTSRAAQERPKQWQQADLLPEPDKEPGYAYRWIRV |
Ga0209189_14043322 | 3300027747 | Freshwater Lake | MAENRLARELENRTATERPKQWQPASTLPEPDKQPGYAYRW |
Ga0209084_11113021 | 3300027749 | Freshwater Lake | MATENRLQREMTSRTMQERPKQWQQADLLPEPDKEPGYAYR |
Ga0209084_13302591 | 3300027749 | Freshwater Lake | MAEIKDNKLTRELTTRAVQERPKQWMQPEMLPEPDKEPGYN |
Ga0209596_13568172 | 3300027754 | Freshwater Lake | MAESRLQREMTVRTEQERPKSWRPAETLPDPDKQP |
Ga0209088_102371152 | 3300027763 | Freshwater Lake | MAENRKPRELEERLMTEHPKQWMPAELLPEPDKEPGY |
Ga0209246_101719391 | 3300027785 | Freshwater Lake | MAENRLTRELETRAVQERPKQWMLPDMLPEPDKQAG |
Ga0209246_101774191 | 3300027785 | Freshwater Lake | MATENRLQREMTSRAVQERPKQWQQADLLPEPDKAPGY |
Ga0209287_104046941 | 3300027792 | Freshwater Sediment | MAANRLTRELDTRVTFERPTQWSQPELLPEPDKQPGYAYR |
Ga0209353_100482451 | 3300027798 | Freshwater Lake | MSENNRLKREVESRTMQERPKQWMPAELLPEPDKE |
Ga0209353_101090503 | 3300027798 | Freshwater Lake | MATDVKAAESRLSREMQSRATQERPKKWQQAELLP |
Ga0209353_102538482 | 3300027798 | Freshwater Lake | MATDVKAAENRLSREMQSRATQERPKKWQQAELLPEPDKQPGYAY |
Ga0209353_103885341 | 3300027798 | Freshwater Lake | MAENRKPRELEDRLMAERPKQWQEPDTLPEPDKHPDYAYRWIRVANLNAPD |
Ga0209353_104054972 | 3300027798 | Freshwater Lake | MAENRIVRETETRAQAERPKSWQPASTLPEPDKLDG |
Ga0209354_101075412 | 3300027808 | Freshwater Lake | MAENRLTRELNTRATSERPTQWAPAELLPEPDKQAGYAYR |
Ga0209354_102932481 | 3300027808 | Freshwater Lake | MSETRISRELDTRADFERPKSWQPASLLPEPDKQPGYAYRWV |
Ga0209354_103471151 | 3300027808 | Freshwater Lake | MANNRLTRELESRETQMRPKQWAPAELLPEPDKQPGF |
Ga0209550_102175203 | 3300027892 | Freshwater Lake | MANNRITREADTRATSERPQRWAPAELLPEPDKQAGYAY |
Ga0209777_103495652 | 3300027896 | Freshwater Lake Sediment | MAENRLTRELETRAVAERPKQWMPAEMLPEPDKQPGYSYRWV |
Ga0209427_108976611 | 3300027901 | Marine Sediment | MANERKEVTRELDRRTSHERPKSWQPASLLPEPDKQPGYAYKW |
Ga0209048_106969051 | 3300027902 | Freshwater Lake Sediment | MAEVKKTRELETRAVVERPQRWMNPELLPEPDKQA |
Ga0209536_1015629531 | 3300027917 | Marine Sediment | MAEQNRIKRELESRALAERPRQWMPPELLPEPDKQAG |
Ga0209400_10384351 | 3300027963 | Freshwater Lake | MAEIKENRIPREIATRAEFERPKQWAQPESLPEPDK |
Ga0209191_10432495 | 3300027969 | Freshwater Lake | MAENRLTRELDTRVEVERPTHWAPPELLPEPDKQA |
Ga0209191_13238411 | 3300027969 | Freshwater Lake | MATNRLARELESRTQTERPKQWSQPELLPEPDKQAGYAYRWI |
Ga0256316_10819141 | 3300028261 | Freshwater | MAENKLNRELETRAVQERPKQWAPPELLPEPDKQPGYA |
Ga0255256_10889171 | 3300028271 | Freshwater | MAESRLQREITNRTTQERPKQWQQAELLPEPDKTPGYAYRWI |
Ga0304729_12596622 | 3300028392 | Freshwater Lake | MAENKIPREMITRAMTERPKQWTPPELLPEPDREAGM |
Ga0304730_12168431 | 3300028394 | Freshwater Lake | MAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPDYSYRW |
Ga0304730_12719822 | 3300028394 | Freshwater Lake | MAENRLARELETRAIVERPKQWMQPELLPEPDKQA |
Ga0255279_10416541 | 3300028530 | Freshwater | MAENRTPRNIETRTQAERPKQWAPPELLPEPDKQPGYKYRCM |
(restricted) Ga0247844_10788784 | 3300028571 | Freshwater | MAEKRIDREVETRATSERPKQWAPAELLPEPDKQA |
Ga0307380_105320401 | 3300031539 | Soil | MTEQNRIKRELESRALTERPKRWMPPELLPEPDKQAG |
Ga0307378_108805311 | 3300031566 | Soil | MATENRLQREMASRATQERPKQWQQAELLPEPDREPGY |
Ga0307375_102218963 | 3300031669 | Soil | MAEQNRVSREVATRVTAERPKQWSPPELLPEPDKEAGY |
Ga0315291_109757871 | 3300031707 | Sediment | MVDVKDNKLTRELTTRAVQERPKQWAQPELLPEPDRVPG |
Ga0315291_110409771 | 3300031707 | Sediment | MTTKPREIETREFTERVKVWKQAELLPEPDKQAGY |
Ga0315907_102820211 | 3300031758 | Freshwater | MATNRLQRELESRTQSERPKQWSQPELLPEPDKQTGYAYRW |
Ga0315900_103738192 | 3300031787 | Freshwater | MAENRLTRELENRAQQERPKQWAPAETLPEPDKQPGFAYR |
Ga0315900_106464782 | 3300031787 | Freshwater | MATNKLARELDTRATSEGPKQWAPAELLPEPDKQAGYA |
Ga0316217_100915813 | 3300031813 | Freshwater | MAENRLARELETRIEGERPKSWQPASLLPEPDKQPGYDY |
Ga0315909_108818852 | 3300031857 | Freshwater | MAENRLARELENRTNVERPKAWAPASALPEPDKQPGYAY |
Ga0315909_110006721 | 3300031857 | Freshwater | MAENRKPRELEDRLMAERPKQWQEPDTLPEPDKHPDYAYRWIRVATLN |
Ga0315285_107522361 | 3300031885 | Sediment | MAENRTPREVATRQQDARPQQWKQPELLPEPDKQEGY |
Ga0315904_104103381 | 3300031951 | Freshwater | MAENRLARELEKRSDVERPKAWAPASALPEPDKQPGYA |
Ga0315904_107050742 | 3300031951 | Freshwater | MTTPNRVTRDLETRALQERPKQWMPPELLPEPDKQAGFSYRW |
Ga0315904_112727062 | 3300031951 | Freshwater | MAENRKPRELEDRLMAERPKQWQEPDTLPEPDKHPDYA |
Ga0315294_105105301 | 3300031952 | Sediment | MAEVRIQRDVETRAIYERPTEWSQPELLPEPDKEAGFSYR |
Ga0315289_113318862 | 3300032046 | Sediment | MATDVKVAENRLSREMQSRATQERPKKWQQAELLPEPDKQPGYAYRW |
Ga0315903_104828841 | 3300032116 | Freshwater | MSENRLTREMQNRAQQERPKQWAPAELLPEPDKQA |
Ga0315295_119442901 | 3300032156 | Sediment | MSENKIPRDMQTRELTERPKQWTPAELLPEPDKQAGF |
Ga0315276_120898412 | 3300032177 | Sediment | MEQNRKSRSIETRVQEERPKQWSQPELLPEPDKQAGFSYRWVR |
Ga0316230_10446215 | 3300032668 | Freshwater | MAENRIPRDVQTRQQAERPKAWTPPELLPEPDKQAGY |
Ga0316621_102488552 | 3300033488 | Soil | MAENRLARELESRTQTERPKQWQRPETLPQPDKQPGYA |
Ga0316616_1031250751 | 3300033521 | Soil | MAENRIKRDTDTRELQARPTQWQQPELLPEPDKEA |
Ga0334978_0065882_1749_1862 | 3300033979 | Freshwater | MAENRLAREIQTRSEAERPKSWHRPETLPEPDKQPGYA |
Ga0334995_0213473_2_118 | 3300034062 | Freshwater | MAENRTPRNVETRVQAERPKQWKPAELLPEPDKLPGYAY |
Ga0334995_0764625_2_127 | 3300034062 | Freshwater | MTTNRLTRELESRKEVERPKQWAPAETLPEPDKQPGFAYRWI |
Ga0335020_0398340_3_122 | 3300034082 | Freshwater | MAESRLQREITNRTTQERPKQWQQAELLPEPDKTPGYAYR |
Ga0335027_0289134_999_1112 | 3300034101 | Freshwater | MAESRTPREIETRESKARPKQWQQPESLPEPDKMPGYS |
Ga0335029_0713866_2_124 | 3300034102 | Freshwater | MAESRLQREITNRTTQERPKQWQQAELLPEPDKAPGFAYRW |
Ga0335066_0297867_801_914 | 3300034112 | Freshwater | MAENRKPRELEDRLMAERPKQWQQAELLPEPDKHPDYK |
Ga0335066_0574594_472_585 | 3300034112 | Freshwater | MAENKTPRELETRAVQERPKQWTQPELLPEPDKQEGFA |
Ga0335068_0215923_1_105 | 3300034116 | Freshwater | MAENRTPRNVETRVQAERPKQWKPAELLPEPDKLP |
Ga0335056_0023025_4180_4299 | 3300034120 | Freshwater | MAENRLAREIQTRSEAERPKSWHRPETLPEPDKQPGYAYR |
Ga0335056_0270735_847_951 | 3300034120 | Freshwater | MAENRLVRELENRTQTERPKAWQPASTLPEPDKQP |
Ga0335016_0138351_3_122 | 3300034166 | Freshwater | MAENRKPREVETRQQDMRPQQWKPPELLPEPDKQAGFSYR |
Ga0335065_0627128_3_119 | 3300034200 | Freshwater | MAENRLSRELETRATQQRPKQWAPAELLPEPDKQAGFAY |
Ga0335007_0596402_1_105 | 3300034283 | Freshwater | MTTNKLARELDTRELVERPKQWQQPELLPEPDKQA |
Ga0335013_0794805_402_530 | 3300034284 | Freshwater | MADNTNARTTRELETRALVERPKQWMQPELLPEPDKEAGFAYR |
⦗Top⦘ |