NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F011707

Metagenome / Metatranscriptome Family F011707

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F011707
Family Type Metagenome / Metatranscriptome
Number of Sequences 288
Average Sequence Length 41 residues
Representative Sequence MAKPIPIGARGEAEETVEFQHTLTAHHPELPPVYSTPDMIR
Number of Associated Samples 235
Number of Associated Scaffolds 288

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 67.01 %
% of genes near scaffold ends (potentially truncated) 98.96 %
% of genes from short scaffolds (< 2000 bps) 91.32 %
Associated GOLD sequencing projects 223
AlphaFold2 3D model prediction Yes
3D model pTM-score0.21

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.222 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(9.722 % of family members)
Environment Ontology (ENVO) Unclassified
(20.486 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.694 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 10.14%    β-sheet: 0.00%    Coil/Unstructured: 89.86%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.21
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 288 Family Scaffolds
PF14518Haem_oxygenas_2 47.92
PF02517Rce1-like 9.03
PF01134GIDA 7.64
PF08238Sel1 7.29
PF01833TIG 3.12
PF03070TENA_THI-4 2.78
PF13932GIDA_C 2.08
PF14534DUF4440 0.69
PF12850Metallophos_2 0.69
PF04909Amidohydro_2 0.69
PF00248Aldo_ket_red 0.69
PF00749tRNA-synt_1c 0.69
PF02870Methyltransf_1N 0.69
PF12833HTH_18 0.35
PF12867DinB_2 0.35
PF14684Tricorn_C1 0.35
PF00291PALP 0.35
PF13676TIR_2 0.35
PF00484Pro_CA 0.35
PF01171ATP_bind_3 0.35
PF00313CSD 0.35
PF03331LpxC 0.35
PF05974DUF892 0.35
PF13714PEP_mutase 0.35
PF03544TonB_C 0.35
PF04223CitF 0.35
PF16881LIAS_N 0.35
PF00034Cytochrom_C 0.35
PF027373HCDH_N 0.35
PF14257DUF4349 0.35
PF14691Fer4_20 0.35
PF13432TPR_16 0.35
PF00989PAS 0.35
PF14520HHH_5 0.35

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 288 Family Scaffolds
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 9.03
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 9.03
COG0350DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase)Replication, recombination and repair [L] 0.69
COG0008Glutamyl- or glutaminyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.69
COG0774UDP-3-O-acyl-N-acetylglucosamine deacetylaseCell wall/membrane/envelope biogenesis [M] 0.35
COG3685Ferritin-like metal-binding protein YciEInorganic ion transport and metabolism [P] 0.35
COG3051Citrate lyase, alpha subunitEnergy production and conversion [C] 0.35
COG20843-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenaseLipid transport and metabolism [I] 0.35
COG1748Saccharopine dehydrogenase, NADP-dependentAmino acid transport and metabolism [E] 0.35
COG1606ATP-utilizing enzyme, PP-loop superfamilyGeneral function prediction only [R] 0.35
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 0.35
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.35
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.35
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.35
COG06037-cyano-7-deazaguanine synthase (queuosine biosynthesis)Translation, ribosomal structure and biogenesis [J] 0.35
COG0519GMP synthase, PP-ATPase domain/subunitNucleotide transport and metabolism [F] 0.35
COG0482tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domainTranslation, ribosomal structure and biogenesis [J] 0.35
COG0301Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis)Translation, ribosomal structure and biogenesis [J] 0.35
COG0288Carbonic anhydraseInorganic ion transport and metabolism [P] 0.35
COG0287Prephenate dehydrogenaseAmino acid transport and metabolism [E] 0.35
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.35
COG0037tRNA(Ile)-lysidine synthase TilS/MesJTranslation, ribosomal structure and biogenesis [J] 0.35


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.57 %
UnclassifiedrootN/A2.43 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001305|C688J14111_10207045All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium610Open in IMG/M
3300002155|JGI24033J26618_1061353Not Available553Open in IMG/M
3300002245|JGIcombinedJ26739_100281401All Organisms → cellular organisms → Bacteria1549Open in IMG/M
3300002245|JGIcombinedJ26739_101184720All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis653Open in IMG/M
3300002245|JGIcombinedJ26739_101594844All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae550Open in IMG/M
3300002914|JGI25617J43924_10244724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes605Open in IMG/M
3300003219|JGI26341J46601_10135195All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae696Open in IMG/M
3300003505|JGIcombinedJ51221_10269102All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300004082|Ga0062384_100084417All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin0631655Open in IMG/M
3300004082|Ga0062384_100606831All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium742Open in IMG/M
3300004152|Ga0062386_100634352All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae874Open in IMG/M
3300004157|Ga0062590_101033941All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300004479|Ga0062595_101801617All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Prosorrhyncha → Heteroptera → Euheteroptera → Neoheteroptera → Panheteroptera → Cimicomorpha → Cimicoidea → Miridae → Mirinae → Mirini581Open in IMG/M
3300004635|Ga0062388_102923411All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300005167|Ga0066672_10718903All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300005171|Ga0066677_10255185All Organisms → cellular organisms → Bacteria996Open in IMG/M
3300005175|Ga0066673_10885200All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300005176|Ga0066679_10324490All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1004Open in IMG/M
3300005179|Ga0066684_11016627All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans534Open in IMG/M
3300005187|Ga0066675_10482494All Organisms → cellular organisms → Bacteria925Open in IMG/M
3300005332|Ga0066388_100407216All Organisms → cellular organisms → Bacteria2005Open in IMG/M
3300005332|Ga0066388_100420104All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1981Open in IMG/M
3300005339|Ga0070660_100015936All Organisms → cellular organisms → Bacteria5443Open in IMG/M
3300005367|Ga0070667_100017411All Organisms → cellular organisms → Bacteria5956Open in IMG/M
3300005458|Ga0070681_10630460All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300005458|Ga0070681_11084424All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300005458|Ga0070681_11342387All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300005471|Ga0070698_100606505All Organisms → cellular organisms → Bacteria1035Open in IMG/M
3300005530|Ga0070679_100242819All Organisms → cellular organisms → Bacteria1758Open in IMG/M
3300005533|Ga0070734_10612292All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300005534|Ga0070735_10113530All Organisms → cellular organisms → Bacteria1697Open in IMG/M
3300005536|Ga0070697_101007370All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium740Open in IMG/M
3300005537|Ga0070730_10006212All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae10236Open in IMG/M
3300005537|Ga0070730_10585789All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300005538|Ga0070731_10211742All Organisms → cellular organisms → Bacteria1286Open in IMG/M
3300005538|Ga0070731_10258654All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1155Open in IMG/M
3300005540|Ga0066697_10828597All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300005541|Ga0070733_10121052All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1682Open in IMG/M
3300005547|Ga0070693_100312883All Organisms → cellular organisms → Bacteria1062Open in IMG/M
3300005554|Ga0066661_10937219Not Available506Open in IMG/M
3300005561|Ga0066699_10390702All Organisms → cellular organisms → Bacteria → Proteobacteria995Open in IMG/M
3300005568|Ga0066703_10556644All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300005602|Ga0070762_10157611All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1363Open in IMG/M
3300005610|Ga0070763_10170651All Organisms → cellular organisms → Bacteria1147Open in IMG/M
3300005764|Ga0066903_100001389All Organisms → cellular organisms → Bacteria17635Open in IMG/M
3300005764|Ga0066903_105510966All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300005764|Ga0066903_105906168All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300005764|Ga0066903_107000783All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium585Open in IMG/M
3300005843|Ga0068860_101763506All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300005921|Ga0070766_10346478All Organisms → cellular organisms → Bacteria963Open in IMG/M
3300005938|Ga0066795_10150570All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300005995|Ga0066790_10208508All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae835Open in IMG/M
3300006050|Ga0075028_100304520All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300006059|Ga0075017_100543870All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300006059|Ga0075017_101084479All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae625Open in IMG/M
3300006086|Ga0075019_10715029All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300006162|Ga0075030_100212251All Organisms → cellular organisms → Bacteria1557Open in IMG/M
3300006162|Ga0075030_101039038Not Available645Open in IMG/M
3300006163|Ga0070715_11069694All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300006176|Ga0070765_100450973All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1205Open in IMG/M
3300006176|Ga0070765_101642480All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300006354|Ga0075021_11116937All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae516Open in IMG/M
3300006755|Ga0079222_10311590All Organisms → cellular organisms → Bacteria1036Open in IMG/M
3300006794|Ga0066658_10173540All Organisms → cellular organisms → Bacteria1118Open in IMG/M
3300006903|Ga0075426_10201937All Organisms → cellular organisms → Bacteria1441Open in IMG/M
3300009029|Ga0066793_10722384All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300009089|Ga0099828_11355370All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300009148|Ga0105243_11064261All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300009523|Ga0116221_1209998All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium843Open in IMG/M
3300009524|Ga0116225_1326046All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae685Open in IMG/M
3300009545|Ga0105237_11818004All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300009623|Ga0116133_1064069All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300009623|Ga0116133_1191972All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300009672|Ga0116215_1008786All Organisms → cellular organisms → Bacteria5043Open in IMG/M
3300009698|Ga0116216_10020856All Organisms → cellular organisms → Bacteria4105Open in IMG/M
3300009764|Ga0116134_1285793Not Available567Open in IMG/M
3300010339|Ga0074046_10615149All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae642Open in IMG/M
3300010343|Ga0074044_10726937All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae648Open in IMG/M
3300010376|Ga0126381_102369494All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300010379|Ga0136449_101726691All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae941Open in IMG/M
3300010379|Ga0136449_103554416All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300011078|Ga0138565_1083618All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae569Open in IMG/M
3300011269|Ga0137392_10660365All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300011269|Ga0137392_10954560All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae705Open in IMG/M
3300011270|Ga0137391_11578886All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae500Open in IMG/M
3300011271|Ga0137393_11392665All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae590Open in IMG/M
3300011271|Ga0137393_11785686All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300012096|Ga0137389_10096690All Organisms → cellular organisms → Bacteria2339Open in IMG/M
3300012096|Ga0137389_11694193All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300012200|Ga0137382_11137841All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae556Open in IMG/M
3300012202|Ga0137363_11287379All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae619Open in IMG/M
3300012206|Ga0137380_10175169All Organisms → cellular organisms → Bacteria → Acidobacteria1952Open in IMG/M
3300012207|Ga0137381_10189199All Organisms → cellular organisms → Bacteria1782Open in IMG/M
3300012207|Ga0137381_11643105All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300012209|Ga0137379_11260982All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae646Open in IMG/M
3300012210|Ga0137378_11116484All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300012211|Ga0137377_10449733All Organisms → cellular organisms → Bacteria1226Open in IMG/M
3300012349|Ga0137387_11264081All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117518Open in IMG/M
3300012351|Ga0137386_10120956All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1863Open in IMG/M
3300012362|Ga0137361_11477785All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300012363|Ga0137390_10482596All Organisms → cellular organisms → Bacteria1214Open in IMG/M
3300012922|Ga0137394_11034886All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae681Open in IMG/M
3300012929|Ga0137404_10658473All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300012930|Ga0137407_11128952All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300012975|Ga0134110_10137377All Organisms → cellular organisms → Bacteria1005Open in IMG/M
3300014158|Ga0181521_10230047All Organisms → cellular organisms → Bacteria992Open in IMG/M
3300014168|Ga0181534_10670504All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300014168|Ga0181534_10779852All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae564Open in IMG/M
3300014169|Ga0181531_11029688All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300014200|Ga0181526_10115546All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1717Open in IMG/M
3300014201|Ga0181537_11222653All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300014638|Ga0181536_10153194All Organisms → cellular organisms → Bacteria1209Open in IMG/M
3300014638|Ga0181536_10438617All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae577Open in IMG/M
3300015371|Ga0132258_13818533Not Available1026Open in IMG/M
3300016294|Ga0182041_10507049All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1047Open in IMG/M
3300016357|Ga0182032_11763401All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300017822|Ga0187802_10428146All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae525Open in IMG/M
3300017823|Ga0187818_10526696All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae531Open in IMG/M
3300017930|Ga0187825_10206781All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300017931|Ga0187877_1104648All Organisms → cellular organisms → Bacteria1178Open in IMG/M
3300017933|Ga0187801_10068453All Organisms → cellular organisms → Bacteria1311Open in IMG/M
3300017933|Ga0187801_10098083All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1110Open in IMG/M
3300017934|Ga0187803_10107386All Organisms → cellular organisms → Bacteria1096Open in IMG/M
3300017934|Ga0187803_10131121All Organisms → cellular organisms → Bacteria985Open in IMG/M
3300017934|Ga0187803_10186179All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300017935|Ga0187848_10350256All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae612Open in IMG/M
3300017940|Ga0187853_10196510All Organisms → cellular organisms → Bacteria946Open in IMG/M
3300017940|Ga0187853_10321226All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300017943|Ga0187819_10099949All Organisms → cellular organisms → Bacteria1733Open in IMG/M
3300017946|Ga0187879_10788465All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300017966|Ga0187776_11094737All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300017972|Ga0187781_10007645All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis7891Open in IMG/M
3300017973|Ga0187780_10240254All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1267Open in IMG/M
3300017973|Ga0187780_10930812All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae632Open in IMG/M
3300017974|Ga0187777_11068279All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300017975|Ga0187782_10206577All Organisms → cellular organisms → Bacteria1470Open in IMG/M
3300017975|Ga0187782_11568947All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300017994|Ga0187822_10154182All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae740Open in IMG/M
3300017995|Ga0187816_10071598All Organisms → cellular organisms → Bacteria1470Open in IMG/M
3300017999|Ga0187767_10155030All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300018007|Ga0187805_10575841All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae531Open in IMG/M
3300018020|Ga0187861_10235539All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae804Open in IMG/M
3300018022|Ga0187864_10301872All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae715Open in IMG/M
3300018026|Ga0187857_10026743All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3144Open in IMG/M
3300018034|Ga0187863_10822650All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300018038|Ga0187855_10771319All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300018042|Ga0187871_10624370All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300018046|Ga0187851_10496018All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae693Open in IMG/M
3300018057|Ga0187858_10168865All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1446Open in IMG/M
3300018085|Ga0187772_10114833All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin0631749Open in IMG/M
3300018086|Ga0187769_10249975All Organisms → cellular organisms → Bacteria1319Open in IMG/M
3300018086|Ga0187769_10285167All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1233Open in IMG/M
3300018086|Ga0187769_11051260All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae616Open in IMG/M
3300018086|Ga0187769_11547035All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300018090|Ga0187770_10617004All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae863Open in IMG/M
3300018433|Ga0066667_11839790All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300018468|Ga0066662_10138907All Organisms → cellular organisms → Bacteria1814Open in IMG/M
3300018468|Ga0066662_11206384All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium766Open in IMG/M
3300018468|Ga0066662_12705199All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300019270|Ga0181512_1255347All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae749Open in IMG/M
3300019275|Ga0187798_1801028All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae571Open in IMG/M
3300019284|Ga0187797_1165923All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae967Open in IMG/M
3300019787|Ga0182031_1079123All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae519Open in IMG/M
3300019787|Ga0182031_1161556All Organisms → cellular organisms → Bacteria1521Open in IMG/M
3300019881|Ga0193707_1085873All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300020580|Ga0210403_11208450All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae582Open in IMG/M
3300020582|Ga0210395_10323536All Organisms → cellular organisms → Bacteria1160Open in IMG/M
3300020582|Ga0210395_11297088All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae533Open in IMG/M
3300020582|Ga0210395_11393951All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300021088|Ga0210404_10607778All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae622Open in IMG/M
3300021170|Ga0210400_10485293All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300021171|Ga0210405_11330344All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300021181|Ga0210388_10179778All Organisms → cellular organisms → Bacteria1846Open in IMG/M
3300021181|Ga0210388_10596267All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300021181|Ga0210388_11000733All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300021401|Ga0210393_10010436All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis7225Open in IMG/M
3300021401|Ga0210393_10887947All Organisms → cellular organisms → Bacteria → Acidobacteria724Open in IMG/M
3300021402|Ga0210385_10708850All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300021404|Ga0210389_11385555All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae537Open in IMG/M
3300021420|Ga0210394_10085177All Organisms → cellular organisms → Bacteria2729Open in IMG/M
3300021432|Ga0210384_10497064All Organisms → cellular organisms → Bacteria1098Open in IMG/M
3300021432|Ga0210384_10506933All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1086Open in IMG/M
3300021433|Ga0210391_10119134All Organisms → cellular organisms → Bacteria2078Open in IMG/M
3300021433|Ga0210391_11257868All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae572Open in IMG/M
3300021477|Ga0210398_10153451All Organisms → cellular organisms → Bacteria1874Open in IMG/M
3300021477|Ga0210398_10383144All Organisms → cellular organisms → Bacteria1147Open in IMG/M
3300021478|Ga0210402_10709093All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300021559|Ga0210409_10523957All Organisms → cellular organisms → Bacteria1050Open in IMG/M
3300021560|Ga0126371_12614268All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae611Open in IMG/M
3300021861|Ga0213853_10211056All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae718Open in IMG/M
3300021861|Ga0213853_11364129All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300022521|Ga0224541_1033115All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300023090|Ga0224558_1069468All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1336Open in IMG/M
3300025612|Ga0208691_1003943All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4530Open in IMG/M
3300025912|Ga0207707_11403482All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300025913|Ga0207695_11260353All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300025917|Ga0207660_10190417All Organisms → cellular organisms → Bacteria1597Open in IMG/M
3300025918|Ga0207662_11122539Not Available559Open in IMG/M
3300025921|Ga0207652_10220220All Organisms → cellular organisms → Bacteria1710Open in IMG/M
3300025923|Ga0207681_10947384All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300025939|Ga0207665_10719049Not Available786Open in IMG/M
3300026469|Ga0257169_1025296All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300026497|Ga0257164_1050185All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300026542|Ga0209805_1229061All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae765Open in IMG/M
3300027172|Ga0208098_1020213All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae659Open in IMG/M
3300027604|Ga0208324_1046932All Organisms → cellular organisms → Bacteria1265Open in IMG/M
3300027629|Ga0209422_1007289All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2721Open in IMG/M
3300027641|Ga0208827_1146403All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae660Open in IMG/M
3300027662|Ga0208565_1028380All Organisms → cellular organisms → Bacteria1926Open in IMG/M
3300027667|Ga0209009_1073102All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae864Open in IMG/M
3300027676|Ga0209333_1123752All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300027729|Ga0209248_10012462All Organisms → cellular organisms → Bacteria2681Open in IMG/M
3300027783|Ga0209448_10080319All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1093Open in IMG/M
3300027795|Ga0209139_10038776All Organisms → cellular organisms → Bacteria1686Open in IMG/M
3300027815|Ga0209726_10074316All Organisms → cellular organisms → Bacteria2184Open in IMG/M
3300027825|Ga0209039_10333055All Organisms → cellular organisms → Bacteria → Acidobacteria593Open in IMG/M
3300027842|Ga0209580_10008979All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4284Open in IMG/M
3300027869|Ga0209579_10317358All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae841Open in IMG/M
3300027875|Ga0209283_10707490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Deinococcales → Deinococcaceae → Deinococcus628Open in IMG/M
3300027879|Ga0209169_10627987All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300027884|Ga0209275_10358013All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae818Open in IMG/M
3300027895|Ga0209624_10648858All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae698Open in IMG/M
3300027903|Ga0209488_11233215All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300027905|Ga0209415_10712805All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae716Open in IMG/M
3300027905|Ga0209415_10794351All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300027911|Ga0209698_10433217All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1024Open in IMG/M
3300028380|Ga0268265_10042613All Organisms → cellular organisms → Bacteria3369Open in IMG/M
3300028731|Ga0302301_1127749All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae640Open in IMG/M
3300028734|Ga0302206_1085139All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300028746|Ga0302233_10322725All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae584Open in IMG/M
3300028762|Ga0302202_10446842All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae592Open in IMG/M
3300028874|Ga0302155_10221446All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae823Open in IMG/M
3300029882|Ga0311368_10936857All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae577Open in IMG/M
3300029903|Ga0247271_100763All Organisms → cellular organisms → Bacteria8638Open in IMG/M
3300029914|Ga0311359_10616565All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300029984|Ga0311332_10798740All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae752Open in IMG/M
3300029999|Ga0311339_10028636All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis8008Open in IMG/M
3300030506|Ga0302194_10305671All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300030580|Ga0311355_10918250All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae793Open in IMG/M
3300030706|Ga0310039_10049949All Organisms → cellular organisms → Bacteria1858Open in IMG/M
3300030741|Ga0265459_10645392All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae995Open in IMG/M
3300030760|Ga0265762_1060555All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae777Open in IMG/M
3300030813|Ga0265750_1040114All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae676Open in IMG/M
3300030815|Ga0265746_1008607All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1107Open in IMG/M
3300030838|Ga0311335_10613958All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium761Open in IMG/M
3300031027|Ga0302308_10433918All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae783Open in IMG/M
3300031247|Ga0265340_10484118All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae545Open in IMG/M
3300031525|Ga0302326_11413365All Organisms → cellular organisms → Bacteria939Open in IMG/M
3300031681|Ga0318572_10645120All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300031708|Ga0310686_117041430All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae540Open in IMG/M
3300031708|Ga0310686_118398637All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae641Open in IMG/M
3300031708|Ga0310686_119426420All Organisms → cellular organisms → Bacteria1300Open in IMG/M
3300031718|Ga0307474_10417801All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1045Open in IMG/M
3300031718|Ga0307474_11198136All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae600Open in IMG/M
3300031720|Ga0307469_11246492All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae704Open in IMG/M
3300031753|Ga0307477_10624203All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae725Open in IMG/M
3300031754|Ga0307475_10108739All Organisms → cellular organisms → Bacteria2172Open in IMG/M
3300031754|Ga0307475_10234295All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1470Open in IMG/M
3300031820|Ga0307473_10369122All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300031823|Ga0307478_10457927All Organisms → cellular organisms → Bacteria1061Open in IMG/M
3300031823|Ga0307478_11103370All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae662Open in IMG/M
3300031918|Ga0311367_12346618All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300031941|Ga0310912_10834873All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae711Open in IMG/M
3300031962|Ga0307479_11066676All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium775Open in IMG/M
3300031962|Ga0307479_11200088All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae722Open in IMG/M
3300031962|Ga0307479_11568218All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae614Open in IMG/M
3300032001|Ga0306922_11863108All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae590Open in IMG/M
3300032160|Ga0311301_10741506All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1367Open in IMG/M
3300032174|Ga0307470_11095071All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae640Open in IMG/M
3300032180|Ga0307471_100715445All Organisms → cellular organisms → Bacteria1166Open in IMG/M
3300032180|Ga0307471_103343150All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300032205|Ga0307472_100487601All Organisms → cellular organisms → Bacteria1059Open in IMG/M
3300032205|Ga0307472_102764067All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300032515|Ga0348332_14449293All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300032783|Ga0335079_12375891All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae502Open in IMG/M
3300032805|Ga0335078_11941092All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium633Open in IMG/M
3300032828|Ga0335080_10301551All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1739Open in IMG/M
3300032829|Ga0335070_10119770All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2722Open in IMG/M
3300032892|Ga0335081_12087821All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300032893|Ga0335069_12231951All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae572Open in IMG/M
3300032896|Ga0335075_11690814All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae515Open in IMG/M
3300032898|Ga0335072_11388748All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae608Open in IMG/M
3300032955|Ga0335076_10002343All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae18790Open in IMG/M
3300033004|Ga0335084_10789793All Organisms → cellular organisms → Bacteria964Open in IMG/M
3300033233|Ga0334722_10074247All Organisms → cellular organisms → Bacteria2621Open in IMG/M
3300033475|Ga0310811_11013435All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300033561|Ga0371490_1138479All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae611Open in IMG/M
3300034163|Ga0370515_0323666All Organisms → cellular organisms → Bacteria652Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.72%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.68%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.90%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland4.86%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.86%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.86%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.47%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.47%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil3.12%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.12%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.12%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.78%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.43%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.43%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.43%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.08%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.74%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.39%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.39%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.04%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.04%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.69%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.69%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.69%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.69%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.69%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.69%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.69%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.69%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.35%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.35%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.35%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.35%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.35%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.35%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.35%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.35%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.35%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.35%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.35%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.35%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.35%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.35%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.35%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002155Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7Host-AssociatedOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002914Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cmEnvironmentalOpen in IMG/M
3300003219Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005938Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011078Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019270Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019275Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019284Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022521Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24EnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300025612Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026469Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-BEnvironmentalOpen in IMG/M
3300026497Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-BEnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300027172Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF038 (SPAdes)EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027629Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027662Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027795Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027815Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028731Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028734Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_1EnvironmentalOpen in IMG/M
3300028746Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1EnvironmentalOpen in IMG/M
3300028762Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3EnvironmentalOpen in IMG/M
3300028874Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029903Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703EnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030506Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030760Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030813Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030815Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030838I_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300031027Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3EnvironmentalOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033561Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fractionEnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
C688J14111_1020704513300001305SoilMAKPVPIGSKGEARQTVEFKHTLSAHHEQLPPVYS
JGI24033J26618_106135323300002155Corn, Switchgrass And Miscanthus RhizosphereMAKPMTIGARGEAQETVTFQQTLTAHHPSLPPVYS
JGIcombinedJ26739_10028140123300002245Forest SoilLANNIPLGARGEAEETVEFKHTLTSHHPELPPVYSTPDMIRLMETAAF
JGIcombinedJ26739_10118472013300002245Forest SoilMPKEVPIGVRGDTQQTVEFKHTLTAHRPELPPVYST
JGIcombinedJ26739_10159484413300002245Forest SoilMAKEIPIGANGEARETVEFKHTLAAHHPELPPVYSTPDMIRL
JGI25617J43924_1024472423300002914Grasslands SoilMAKPIPIGACGDARETVEFKHTLTAHHAKLPPVYSTPDMIRLMETAA
JGI26341J46601_1013519523300003219Bog Forest SoilLAKEIPIGARGEAQETVEFKHTLTAHHPQLPPVYSTPDMI
JGIcombinedJ51221_1026910223300003505Forest SoilMARDIPIGVRGEAVETVELKHTLAAHNPQLPPVYSTPDMIRLMETA
Ga0062384_10008441723300004082Bog Forest SoilMAKEIPIGAGGEAQQTVEFKHTLTAHRPELPPVYSTPHMI
Ga0062384_10060683113300004082Bog Forest SoilMAKEVPLGARGEAKETVEFKHTLTAHRPELPPVYSTPHMIGLM
Ga0062386_10063435213300004152Bog Forest SoilVTRLIPIGARGEAQETVEFKHTLTAQHPELPPVYSTPDMIRL
Ga0062590_10103394113300004157SoilMAKAMPLGARGEVEQTVELKHTLAAHNPNLPPVYSTPDMIR
Ga0062595_10180161713300004479SoilVKQVPLGSRGEAREPVAFNHTLTAHHPELPPVYSTPDMIRLME
Ga0062388_10292341113300004635Bog Forest SoilMAHHIPIGVAGEAEETVELKHTLAAHHAELPPVYSTPDMIRLMETA
Ga0066672_1071890323300005167SoilMAQPVPIGVRGESEQTVEFEHTLTYHNKALPPVYSTPHMIAL
Ga0066677_1025518513300005171SoilMPKAMPIGARATAEQTVEFKHTLTAHHSELPPVYSTPDMIRLM
Ga0066673_1088520023300005175SoilMARPVPIGTRGDAEETVDFKHTLTAHHDSLPPVYSTPDMIRLM
Ga0066679_1032449023300005176SoilLARAIPIGARGEAEETVTFEHTLTAQHPELPPVYSTPDMI
Ga0066684_1101662723300005179SoilMVQPVPPGVRGESEQTVEFEHTLTYHNKALPPVYSTPHMIALM
Ga0066675_1048249413300005187SoilMPIGAHATAEETVEFKHTLTAHHPELPPVYSTPDMIRLMETAAFL
Ga0066388_10040721633300005332Tropical Forest SoilMAKPVPMGAQGKAAETVEFQHTLTAHHPKLPPVYSTPDMIRL
Ga0066388_10042010433300005332Tropical Forest SoilVKDVPIGVRGQAAETVEFRHTLTAHHASLPPAYSTPDMIRLMETAA
Ga0070660_10001593613300005339Corn RhizosphereMAKAMPLGVRGEVQQTVELKHTLAAHNPNLPPVYSTPDMIRLMEI
Ga0070667_10001741113300005367Switchgrass RhizosphereMAKAMPLGARGEVEQTVELKHTLAAHNPNLPPVYSTPDMI
Ga0070681_1063046023300005458Corn RhizosphereMAKAMPIGARGEVEQTVELKHTLAAHNPNLPPVYSTPDMIRLME
Ga0070681_1108442423300005458Corn RhizosphereMAKAMPIGARGEVEQTVELKHTLAAHNPNLPPVYSTPDMIRLM
Ga0070681_1134238713300005458Corn RhizosphereMAKPVPIGARGEARQTVEFKHTLSAHHEQLPPVYSTPDMIRL
Ga0070698_10060650523300005471Corn, Switchgrass And Miscanthus RhizosphereMPRPIPIGACGEAAETVELKHTLSAHHPELPPVYSTPDMIR
Ga0070679_10024281913300005530Corn RhizosphereMAKAMPLGARGEVEQTVELKHTLAAHNPNLPPVYSTPDMIRLMEIACFQ
Ga0070734_1061229213300005533Surface SoilMAKAMPVGTRGTAEETVEFKHTLSAHHPELPPVYSTPDMIRLMETAA
Ga0070735_1011353013300005534Surface SoilMAKPIPIGARGEASETVEFKHTLTAHHPELPPVYSTPDMIRLMEIAAF
Ga0070697_10100737023300005536Corn, Switchgrass And Miscanthus RhizosphereMKMPRPIPIGARGEAEETVEFKHTLTAHHSSLPPVYSTPDM
Ga0070730_1000621213300005537Surface SoilMAKPIPIGARGEARETVEFKHTLTSHHETLPPIYSTPDMIRLME
Ga0070730_1058578913300005537Surface SoilMAKPVPIGARGEARETVEFKHTLTSHHETLPPIYSTPDMIRLME
Ga0070731_1021174213300005538Surface SoilMAKKIPLGVRGEAEETVEFEHTLTSHHPELPPVYSTPDMIRLMET
Ga0070731_1025865413300005538Surface SoilVAKEIPLGVRGEAEETVEFEHTLTSHHPELPPVYSTPDMIRLMET
Ga0066697_1082859713300005540SoilMAKPVPIGSRGEAEETVEFRHTLTAHHQELPPVYSTPDMI
Ga0070733_1012105213300005541Surface SoilMDIPIGARGAAEETVEFKHTLTAHHPELPPVYSTPDMIRLMETAAFR
Ga0070693_10031288313300005547Corn, Switchgrass And Miscanthus RhizosphereVKKVPIGARGEANETVEFEHTLTSHHPELPAVYSTPDMIRLMETA
Ga0066661_1093721923300005554SoilMAKPVPIGVRGESEQKVEFEHTLTYHNKALPPVYSTPHMIA
Ga0066699_1039070233300005561SoilMVKPIPIGARAEAEETVEFQHTLTAHHPELPPVYSTPDMIRLMETA
Ga0066703_1055664423300005568SoilMAKLVPIGARGTAEQTVKFKHTLTAHHPELPQVYSTPDMVRL
Ga0070762_1015761113300005602SoilMAKQIPIGVSGKEQQTVEFKHTLTAHGAELPPVYSTPHMIG
Ga0070763_1017065113300005610SoilMAKAMPLGARGEVEQTVELKHTLAAHNPNLPPVYSTPDMIRLMEFAAF
Ga0066903_10000138913300005764Tropical Forest SoilMPRFIPIGARGEAEETVEFKHTLTAHHESLPPVYSTPDMIRLMET
Ga0066903_10551096623300005764Tropical Forest SoilMAREIPIGAKATAEETVEFKHTLTAHHPELPPVYST
Ga0066903_10590616813300005764Tropical Forest SoilMAKQVPIGTRAEASETVAFEHTLTSHHQQLPPVYSTPDMIRLMET
Ga0066903_10700078323300005764Tropical Forest SoilLSVPKRIPIGVRGDAEETVEFKHTLTSHDPSLPPVYSTPD
Ga0068860_10176350623300005843Switchgrass RhizosphereVKKAPIGARGEAHETVEFEHTLTSHHPELPAVYST
Ga0070766_1034647823300005921SoilMAKAIPIGVRGEAEETVEFKDTLTAHHPELPPVYSTPDMIRLMETAA
Ga0066795_1015057013300005938SoilMARPIPIGTRGEAAETVEVKHTLSAHHPELPPVYSTPDMIRLMETAC
Ga0066790_1020850813300005995SoilMAREVPIGTRAQVELTVELKHTLAAHNPNLPPVYSTPDMIRLMEIAAFAA
Ga0075028_10030452023300006050WatershedsMARPIPIGVRGEAAETVESKHTLSAHHPELPPVYSTPDMI
Ga0075017_10054387013300006059WatershedsMARPIPLGVRGEAEETVELKHTLAGHHPELPPVYSTPDMIRLM
Ga0075017_10108447923300006059WatershedsLAKEIPIGVRGEAEETVQFEHTLTSHHPELPPVYS
Ga0075019_1071502923300006086WatershedsMAKPMPIGARGEAEETVEFKHTLTSHHPELPPVYSTPDMIRLMETAC
Ga0075030_10021225113300006162WatershedsMAKAMPIGARGTAEETVEFQHTLTAHHPELPPVYSTPDMIRLMET
Ga0075030_10103903823300006162WatershedsMARPIPLGTRGEAEQTVELKHTLAGHRAELPPVYS
Ga0070715_1106969423300006163Corn, Switchgrass And Miscanthus RhizosphereMARLIPLGASAEAEETVEFKHTLTAHHGSLPPVYSTPDM
Ga0070765_10045097313300006176SoilMAKQIPLGARGEARETVEFKHTLTAHHPELPPVYSTPDMIRLME
Ga0070765_10164248023300006176SoilMQIPIGARGEAQQTVEFKHTLTAHRSELPPIYSTPHMIGLMETA
Ga0075021_1111693713300006354WatershedsMVRPIPIGVRGEAAETVEFKHTLSAHHPELPPVYS
Ga0079222_1031159013300006755Agricultural SoilMARLIPLGASAEAEETVEFKHTLTAHHGSLPPVYSTPDMIRLMETAA
Ga0066658_1017354023300006794SoilMDMPKPMPIGAHATAEETVEFKHTLTAHHPELPPVYSTPDMIRL
Ga0075426_1020193733300006903Populus RhizosphereMPREIAIGARGEAEETVAFEHTLTSHHPELPPVYSTPDMIRLME
Ga0066793_1072238413300009029Prmafrost SoilMARPIPIGTRGEAAETVEVKHTLSAHHPELPPVYSTPDMI
Ga0099828_1135537013300009089Vadose Zone SoilMNHPSMAKTIPIGAHGEAEETVEFEHTLTAHHPTLPPVYSTPDMIRL
Ga0105243_1106426123300009148Miscanthus RhizosphereMAKPMTIGARGEAQETVTFQQTLTAHHPSLPPVYSTPD
Ga0116221_120999823300009523Peatlands SoilMAKAMPIGARGAAEETVEFEHTLTAHHPELPPVYST
Ga0116225_132604613300009524Peatlands SoilMAKAMPIGPRGKAEETVEFKHTLTAHHPELPPVYSTPDMIRLMETA
Ga0105237_1181800413300009545Corn RhizosphereMAKAMPLGVRGEVEQTVELKHTLAAHNPNLPPVYSTPDMIRLMEIA
Ga0116133_106406923300009623PeatlandMVRPIPIGVRGEAEETVELKHTLAAQHPELPPVYSTPDMIRLMETAGF
Ga0116133_119197223300009623PeatlandVARHIPIGVCAEVQEVVERRHTLAAHHPELPPVYSTPDMIR
Ga0116215_100878643300009672Peatlands SoilMAKPIPLGARGTAEETVEFKHTLTAHHPELPPVYSTPDMIRLM*
Ga0116216_1002085643300009698Peatlands SoilMAKAMPIGARATVEETVEFKHTLTSHHPELPPVYS
Ga0116134_128579313300009764PeatlandMAKAVPIGARGEAEKRTKFQHTLTAWGGELPPVRS
Ga0074046_1061514913300010339Bog Forest SoilLEDEFLAKDIPIGARGEAEETVEFKHTLTSHHAQLPPVYSTPDM
Ga0074044_1072693723300010343Bog Forest SoilMARPIPIGVRGEAVETVELKHTLSAHHPELPPVYSTPDMIRLME
Ga0126381_10236949413300010376Tropical Forest SoilMAKAMPIGARGSAAETVEFKHTLTAHHPELPPVYSTPDMIR
Ga0136449_10172669113300010379Peatlands SoilMAKQIPIGARGEARETVEFKHTLTAHHAELPPVYSTPDMIRLME
Ga0136449_10355441613300010379Peatlands SoilMAKQILIGARGEARETVEFKHTLTAHHAELPPVYSTPDMIRLMEI
Ga0138565_108361823300011078Peatlands SoilLAKDIPIGTRGEAEETVAFEHTLTSRHPELPPVYSTPHMIGLME
Ga0137392_1066036523300011269Vadose Zone SoilMARPIPIGTRGEASETVELKHTLSAHHAELPPVYSTPDMIR
Ga0137392_1095456023300011269Vadose Zone SoilMPKQIPIGVRGEAQETVEFKHTLTAHHAELPPVYSTP
Ga0137391_1157888623300011270Vadose Zone SoilMARPIPIGTRGEASETVELKHTLSAHHAELPPVYSTPDMIRLME
Ga0137393_1139266513300011271Vadose Zone SoilVAVARDIPFGARGQAEETVAFEHTLTSHHPDLPPVYSTPDMIRLMET
Ga0137393_1178568623300011271Vadose Zone SoilMSKPVPVGTRGEAEETVEFRHTLSSHHAELPPVYSTPDMI
Ga0137389_1009669013300012096Vadose Zone SoilMAKETPIGARGDAEETVEFKHTLTAYHPELPPVYST
Ga0137389_1169419323300012096Vadose Zone SoilMPKPIPIGTRGEARETVEFKHTLTSHHEMLPPVYSTPDMVRLM
Ga0137382_1113784123300012200Vadose Zone SoilMPKPVPIGARATAEETVEFKHTLTAHHSELPPVYS
Ga0137363_1128737923300012202Vadose Zone SoilMALPIPIGVRGEAHETVELKHTLAAHHPELPPVYSTPDMIRL
Ga0137380_1017516913300012206Vadose Zone SoilMAKTIPLGARGEAEQIVEFQHTLTAHHPTLPPVYSTPDMIRLM
Ga0137381_1018919933300012207Vadose Zone SoilMPKAMPIGARASAEQTVEFKHTLTAHHSELPPVYSTP
Ga0137381_1164310523300012207Vadose Zone SoilLAKELAFVKDVPIGARGEAAETVEFQHTLTAHHASLPPVYSTPDMIRLME
Ga0137379_1126098223300012209Vadose Zone SoilVARDIPVGARGQAEETVAFEHTLTSHHPDLPPVYSTPDMIRLME
Ga0137378_1111648413300012210Vadose Zone SoilMAKHVPIGARGTAEQTVEFKHTLTAHHPELPQVYS
Ga0137377_1044973313300012211Vadose Zone SoilMARPIPIGARGEACETVELKHTLAAHHAELPPVYSTPDMIR
Ga0137387_1126408123300012349Vadose Zone SoilMAKPVPKGARGEAREIVDFKHTLSAHHEQLPPVYSTPDMI
Ga0137386_1012095613300012351Vadose Zone SoilMKPVPIGARGEAQETVEFKHTLTSHHEFLPPIYSTPDMVRLME
Ga0137361_1147778513300012362Vadose Zone SoilMTLPIPIGVRGEAHETVELKHTLAAHHPELPPVYSTPDMIRLMETASFK
Ga0137390_1048259623300012363Vadose Zone SoilMAKAMPLGARGEVEQTVELKHTLAAHNPNLPPVYSTPDMIRLME
Ga0137394_1103488623300012922Vadose Zone SoilMALPIPIGVRGETQETVELKHTLAAHHPELPTVYS
Ga0137404_1065847313300012929Vadose Zone SoilMALPIPIGVRGEAQETVELKHTLAAHHPELPPVYS
Ga0137407_1112895213300012930Vadose Zone SoilMAIPVPIGVRGEARETVELKHTLAAHHPELPPVYSTPDMIRLMETACF
Ga0134110_1013737713300012975Grasslands SoilMSKSVPIGARGEAEETVEFRHTLTAHHFSLPPVYSTPDMI
Ga0181521_1023004713300014158BogVRGEAAETVELKHTIAADHPELPPVYSTPDMIRLMETACFH
Ga0181534_1067050423300014168BogLAKDVPIGARGEAQETVEFKHTLTAQHPELPPVYSTPDMIRLMET
Ga0181534_1077985223300014168BogMAREIPIGARGEAQETVEFKHTLTAHHPELPPVYSTPDMIRLM
Ga0181531_1102968823300014169BogMARPIPIGARGEATETVELKHTLSAHHPELPPVYSTPDMIRLM
Ga0181526_1011554633300014200BogMAQPIPIGVRGEAAETVELKHTLAAHDPQLPPVYSTPDMIRLME
Ga0181537_1122265323300014201BogMARPIPIGARGEATETVELKHTLSAHHPELPPVYSTPDMIRLMET
Ga0181536_1015319433300014638BogMPRPIPIGVRGEAAETVELKHTIAAHHPELPPVYSTPDMIRLMETA
Ga0181536_1043861713300014638BogMARPIPIGVRGEAAETVELKHTLAAHDPELPPVYS
Ga0132258_1381853313300015371Arabidopsis RhizosphereMAKQVPIGTRGEAAETVAFEHTLTSHHPQLPPVYSTPDMIRLM
Ga0182041_1050704913300016294SoilVAKQVSLGARGEAAETVEFKHTLTSHHSELPPVYSTP
Ga0182032_1176340113300016357SoilMPKLIPIGARGEASETVEFKHTLTSHHDSLPPIYSTPDMIRL
Ga0187802_1042814623300017822Freshwater SedimentVARQVPLGTRGEAEETVEFRHTLTAHHPELPPVYSTPDMIRLMETAG
Ga0187818_1052669623300017823Freshwater SedimentMARHIPIGVRGEAAETVELRHTLSAHHPELPPVYSTPDMIRLMET
Ga0187825_1020678113300017930Freshwater SedimentMKAVPQGARGETEQVVEFKHTLTFHHPELPPVYSTPDMIR
Ga0187877_110464833300017931PeatlandMPRPIPIGVRGEAAETVELKHTIAADHPELPPVYSTPDM
Ga0187801_1006845313300017933Freshwater SedimentMARPIPIGVRGEAAETVELKHTIAAHHPELPPVYSTP
Ga0187801_1009808313300017933Freshwater SedimentVAKEVPIGARGEASETVEFEHTLTSHHAELPPVYS
Ga0187803_1010738633300017934Freshwater SedimentMARPIPLGVRGEAEETVELKHTLASHHPELPPVYATPAMIRLMETACF
Ga0187803_1013112113300017934Freshwater SedimentMARPIPLGTRGEAEETVELKHTLARHHPELPPVYSTPSMI
Ga0187803_1018617923300017934Freshwater SedimentMPRPIPIGVRGEAAETVELKHTIAAHHPELPPVYS
Ga0187848_1035025613300017935PeatlandMAKEIPIGARGEARETVEFKHTLTAHHPELPPIYS
Ga0187853_1019651023300017940PeatlandMPRPIPIGVRGEAAETVELKHTIAAHHPELPPVYSTPDMIRLMETACFH
Ga0187853_1032122613300017940PeatlandMARHIPIGVMGEAEEIVDRQHTLAAHHPELPPVYSTPDMI
Ga0187819_1009994913300017943Freshwater SedimentMAKAMPIGARGTAEETVEFEHTLTAHHPELPPVYSTPDMIRLMETAA
Ga0187879_1078846523300017946PeatlandMAKEIPIGARGEAHETVEFKHTLTAHHPELPPVYSTPDM
Ga0187776_1109473723300017966Tropical PeatlandMALPIPIGVRGEAHETVELRHTLATHHPELPPVYSTPDMIRLME
Ga0187781_1000764513300017972Tropical PeatlandLAKPIPIGARGEAEETVEFRHTLAAHHSELPPVYSTPDMIRLMETA
Ga0187780_1024025423300017973Tropical PeatlandVARAIPIGARGEAEETIEFKHTLTVHHPELPPVYSTPDMIRLMETA
Ga0187780_1093081223300017973Tropical PeatlandMKSVPIGARGEAAETVAFEHTLTAHHPELPPVYSTPDMIRLME
Ga0187777_1106827913300017974Tropical PeatlandMAREIPIGAKATAEETVEFKHTLTAQHPQLPPVYSTPDMIRLME
Ga0187782_1020657713300017975Tropical PeatlandMAKPIPIGARGEAEETVEFQHTLTAHHPELPPVYSTPDMIR
Ga0187782_1156894713300017975Tropical PeatlandMPQPIPIGASGEAEETVEEKHTLAAHHSELPPVYSTPDMIRLM
Ga0187822_1015418223300017994Freshwater SedimentMPKPVPMGTWGEAEETVEFQHTLTAHHPQLPPVYSTPDMI
Ga0187816_1007159833300017995Freshwater SedimentMAKEIPIGARATAEETVEFKHTLTAHHPQLPPVYSTPDMIRLME
Ga0187767_1015503013300017999Tropical PeatlandVKEVPIGARAEAEETVEFKHTLTSHHAELPPVYSTPDMIR
Ga0187805_1057584113300018007Freshwater SedimentMAKAMPIGARATAEETVELEHTLTSHHPELPPVYSTPDMIRLMET
Ga0187861_1023553923300018020PeatlandMPRPIPIGVRGEAAETVELNHTIAAHHPELPPVYSTPDMIRLMET
Ga0187864_1030187213300018022PeatlandMAKAMPIGARSTAEETVEFKHTLAAHHPELPPVYSTPDMIR
Ga0187857_1002674313300018026PeatlandMVKEIPIGARGEASETVEFKHTLTAHHPELPLVYSTPDMIRLMETA
Ga0187863_1082265013300018034PeatlandMARPIPIGVRGEADETVELKHTLAAQHPELPPVYSTPDMIRLMETA
Ga0187855_1077131923300018038PeatlandMAKQIPIGARGEAQETVGFKHTLTAYRAELPPVYS
Ga0187871_1062437023300018042PeatlandMAHHIPIGVRGEAAETVELKHTLAAHDPRLPPVYSTPDMIRLM
Ga0187851_1049601823300018046PeatlandMSRPIPIGVHGEAEETVERKHTLSAHHPELPPVYSTPDMIRLME
Ga0187858_1016886533300018057PeatlandVARAIPIGARAEAEETVEFEHTLTSHHPELPPVYSTPD
Ga0187772_1011483323300018085Tropical PeatlandLAKDIPIGVRGEAEETVAFEHTLTAHHPQLPPVYSTPDMIRLMETA
Ga0187769_1024997513300018086Tropical PeatlandMAKAVPIGARATVEETVEFEHTLTSHRPELPPVYSTPDMIR
Ga0187769_1028516713300018086Tropical PeatlandVARAIPIGARGEAEETVEFKHTLTAHHPELPPVYSTPDMIR
Ga0187769_1105126013300018086Tropical PeatlandLAKEIPIGARGEAEETVEFKHTLTAHHPELPPVYSTPD
Ga0187769_1154703513300018086Tropical PeatlandMALPIPICVRGEAAETVELKHTLTAEHPVLPPVCSSPD
Ga0187770_1061700413300018090Tropical PeatlandMAKKIPIGARGTAEETVEFKHTLTAHHPELPPVYSTPDMIRLMET
Ga0066667_1183979013300018433Grasslands SoilMKPVPIGVRGQAEETVEFRHTLTANNPQLPPVYSTPDMIR
Ga0066662_1013890713300018468Grasslands SoilMKPVPIGVRAAANQVVAFEHTLAAHHPQLPPVYSTPDMIRLMDLAIL
Ga0066662_1120638413300018468Grasslands SoilMAKTIPLGARGEAEQIVEFQHTLTAHHPTLPPVYSTPDMVR
Ga0066662_1270519923300018468Grasslands SoilMAKPVPIGSRGEAEETVEFRHTLTAHHQELPPVYSTPDMIRLMET
Ga0181512_125534713300019270PeatlandMAKEIPLGARGEAQEKVEFKHTLTAHHPHLPPVYSTPDMIRLME
Ga0187798_180102813300019275PeatlandMAKRIPIGARGEAHETVEFSHTLTAHHAELPPVYSTPDMI
Ga0187797_116592323300019284PeatlandMAKEVPIGARGEAEETVEFKHTLTAHHPELPPVYSTPDMI
Ga0182031_107912323300019787BogMARTIPIGARGEAAGTVELKHTLSAHHSELPPVYSTPDMIRL
Ga0182031_116155633300019787BogMARTIPIGARGEAAETVELKHTLSAHHSELPPVYSTPDMIRLM
Ga0193707_108587313300019881SoilMQKPIPIGARATAEETVEFKHTLTAHHPELPPVYSTPDMIR
Ga0210403_1120845013300020580SoilMAKEVPIGARGDAQETVEFKHTLTAHRAELPPVYSTPD
Ga0210395_1032353633300020582SoilMAKAMPIGARATVEETVEFKHTLTSHHPELPPVYSTPDMIRL
Ga0210395_1129708823300020582SoilVAKPIPIGARGEAQETVEFKHTLTAHRAELPPVYSTPDMIRLMEIAA
Ga0210395_1139395123300020582SoilLAKPIPIRTRGEVEETVAFEHTLTSHHPDLPPVYSTPDMIRLM
Ga0210404_1060777813300021088SoilMAKAMPIGARATAEETVEFKHTLTAHHPELPPVYSTPDM
Ga0210400_1048529333300021170SoilMKTVPVGARGEAEEVVEFEHTLTAHHPQLPPVYSTPDMIR
Ga0210405_1133034413300021171SoilMAKAMPIGARATVEETVAFKHTLTSHHPELPPVYSTPDMI
Ga0210388_1017977843300021181SoilMPKPIPIGTRGTAEETIAFEHTLSSRHPNLPPVYSTPDMIRL
Ga0210388_1059626713300021181SoilMAKAMPIGARATVEETVEFKHTLTSHHPELPPVYSTPDMIRLM
Ga0210388_1100073323300021181SoilVAKPIPIGALGEAEETVEFKHTLTSHHAELPPVYSTQDM
Ga0210393_1001043613300021401SoilMAKQIPIGARSEAHQTVEFKHTLTAHGAELPPVYSTPH
Ga0210393_1088794723300021401SoilMAKEIPIGARGEARETVEFKHTLTSHHAELPPIYSTPDMIRLM
Ga0210385_1070885013300021402SoilMAQPIPIGVRGEAAETVDLKHTLAAHHPELPPVYSTPDMI
Ga0210389_1138555513300021404SoilMAKAMPIGVRATVEETVEFKHTLTSHHPELPPVYSTPDMSR
Ga0210394_1008517713300021420SoilMANAMPIGARGTAEETVEFKHTLSVHHPELPPVYSTPDMI
Ga0210384_1049706433300021432SoilMAKAMPIGARATVEETVEFKHTLTSHHPELPPVYSTPDMIRLME
Ga0210384_1050693323300021432SoilVKEIPIGARGEASETVEFTHTLTSHHPELPPVYSTPDMIRLMETAAF
Ga0210391_1011913413300021433SoilMARPIPIGEAAETVDLKHTLAAHHPELPPVYSTPDMIRLMETA
Ga0210391_1125786823300021433SoilVAKPIPIGARGEAQETVEFKHTLTAHRAELPPVYLNPDMNR
Ga0210398_1015345133300021477SoilLARPIPIGVRGEAAETVDLKHTLAAHHPELPPVYSTPDMI
Ga0210398_1038314423300021477SoilVAKTIPIGARGEAQETVEFKHTLTAHRAELPPVYST
Ga0210402_1070909323300021478SoilMTKAMPIGARATVEETVAFKHTLTSHHPELPPVYS
Ga0210409_1052395733300021559SoilMAKAMPIGARGTAEETVEFKHTLTSHHPELPPVYSTP
Ga0126371_1261426833300021560Tropical Forest SoilMARAMPIGARGSAEETVEFKHTLTAHHPELPPVYSTPDMIRLM
Ga0213853_1021105623300021861WatershedsMAKPVPIGARGEAEETVEFQHTLTAHHPSLPPVYSTPDMIRLM
Ga0213853_1136412933300021861WatershedsMARPIPIGTRGEAEETVKLKHTLADHHPELPPVYSTPDMIRL
Ga0224541_103311523300022521SoilMAQPIPIGVRGEAAETVELKHTLAAHHSELPPVYSTPDMIRL
Ga0224558_106946813300023090SoilMARPIPIGTRGEAAETVELKHTLAAHHPELPPVYSTPDMIRL
Ga0208691_100394353300025612PeatlandMVKEIPIGARGEASETVEFKHTLTAHHPELPLVYSTPDMI
Ga0207707_1140348223300025912Corn RhizosphereMAKAMPIGARGEVEQTVELKHTLAAHNPNLPPVYSTPDMIRLMEVAC
Ga0207695_1126035323300025913Corn RhizosphereVPIGARGEAHETVEFEHTLTSHHPELPAVYSTPDMIRLMET
Ga0207660_1019041733300025917Corn RhizosphereMAKAMPLGARGEVEQTVELKHTLAAHNPNLPPVYSTP
Ga0207662_1112253923300025918Switchgrass RhizosphereMAKAMPLGVRGEVEQTVELKHTLAAHNPNLPPVYST
Ga0207652_1022022033300025921Corn RhizosphereMAKAMPLGARGEVEQTVELKHTLAAHNPNLPPVYST
Ga0207681_1094738413300025923Switchgrass RhizosphereVPIGARGEAHETVEFEHTLTSHHPELPAVYSTPDMI
Ga0207665_1071904923300025939Corn, Switchgrass And Miscanthus RhizosphereMRRTVPIGARGEASEIVAFEHTLTAHHPELPPVYS
Ga0257169_102529623300026469SoilMARPIPIGVRGEAAEIVELKQTLSAHHAELPPVYSTPDMIRLM
Ga0257164_105018513300026497SoilMALPIPIGVRGEAHETVELKHTLAAHHPELPPVYSTPDMIRLME
Ga0209805_122906123300026542SoilMAKPVPIGTRAEMEEVVQLEHTLTARRPELPPVYSTPDMIR
Ga0208098_102021313300027172Forest SoilMAKAMPIGARATVEETVGFKHTLTSHHPELPPVYSTPDMIRLM
Ga0208324_104693213300027604Peatlands SoilMAKAMPIGARGTAEETVEFKHTLTAHHPELPPVYSTPDMIR
Ga0209422_100728933300027629Forest SoilLAKDIPLGTRSEAEETVAFEHTLASHHPELPPVYSTPDMIRLME
Ga0208827_114640323300027641Peatlands SoilLAKDIPIGARGEAEETVEFKHTLTSHHPELPPVYSTPEM
Ga0208565_102838013300027662Peatlands SoilDPMAKPIPLGARGTAEETVEFKHTLTAHHPELPPVYSTPDMIRLM
Ga0209009_107310223300027667Forest SoilMLFWKGAWHLAKDIPLGTRSEAEETVAFEHTLASHHPELPPVYSTPDMIRL
Ga0209333_112375223300027676Forest SoilMPKEVPIGVRGDTQQTVEFKHTLTAHRPELPPVYSTPH
Ga0209248_1001246233300027729Bog Forest SoilMAKQIPIGMRGDAQQTVEFKHTLTAHRPELPPVYSTPHMI
Ga0209448_1008031923300027783Bog Forest SoilMAKQVPIGARGEAHETVEFKHTLTAHHAELPPVYSTPDMIRLMET
Ga0209139_1003877633300027795Bog Forest SoilMAKAMPVGARGAAEETVEFKHTLTSRHPELPPVYSTPDM
Ga0209726_1007431643300027815GroundwaterMAKPVPIGARGEAEERVEFQHTLTSHHEMLPPVYSTPDMIRLMETA
Ga0209039_1033305523300027825Bog Forest SoilLAKDIPIGARGEAEETVEFKHTLTSHHAQLPPVYSTP
Ga0209580_1000897913300027842Surface SoilVAKPVPIGTRAQAEEIVEFKHTLTSQHPQLPPVYS
Ga0209579_1031735813300027869Surface SoilLAKDIPIGARGEASETVEFKHTLTSYHPELPPVYSTPDMIRLMET
Ga0209283_1070749023300027875Vadose Zone SoilMAKTIPIGAHGEAEETVEFEHTLTAHHPTLPPVYSTPDMIRL
Ga0209169_1062798713300027879SoilMAKAMPIGARATVEETVAFKHTLTSHHPELPPVYSTPDMIRLMETA
Ga0209275_1035801323300027884SoilMASEIPMGARGEAEETVEFKHTLTAHHPELPPVYSTPDMIR
Ga0209624_1064885823300027895Forest SoilMAKEIPIGANGEARETVEFKHTLAAHHPELPPVYSTPDMIRLM
Ga0209488_1123321513300027903Vadose Zone SoilMAKPVPVGARGEARERVEFKHTLSAHHEQLPPVYSTP
Ga0209415_1071280513300027905Peatlands SoilMAKAMPIGARGTAEETVEFEHTLTAHHPELPPVYSTPDM
Ga0209415_1079435123300027905Peatlands SoilLARQIPIGARGGAEETVEFEHTLTSHHPELPPVYSTPDM
Ga0209698_1043321713300027911WatershedsMAKAMPIGARGTAEETVEFEHTLTAHHPELPAVYSTPDMIRLM
Ga0268265_1004261313300028380Switchgrass RhizosphereMPLGVRGEVEQTVELKHTLAAHNPNLPPVYSTPDMIRLMEIACFQA
Ga0302301_112774913300028731PalsaMAKEIPIGARGKARETVELKHTLAAHDAKLPPVYS
Ga0302206_108513913300028734FenMPRPIPIRAHGAAEETVEFKHTLSAHHPELPPVYSTPDMIRLMETAC
Ga0302233_1032272513300028746PalsaMAKRIPIGARGEAQEIVQFKHTLTAHHAELPPVYSTPD
Ga0302202_1044684213300028762BogVAKEIPIGARGEAHETVEFKHTLTAHHEQLPPVYST
Ga0302155_1022144623300028874BogMAKEIPIGARGEASETVEFKHTLTAHHPELPPVYSTPDMIR
Ga0311368_1093685723300029882PalsaLAKPIPVGARGEAEETVEFRHTLTAHHSELPPVYSTPDMIRLME
Ga0247271_10076353300029903SoilMARPIPIGVRGEAAETVELKHTLSAHHPELPPVYSTPXXXAAVL
Ga0311359_1061656523300029914BogMAKPIPIGARGEAQETVEFKHTLTSHHAELPPVYSTPDMIRLMETA
Ga0311332_1079874013300029984FenMALPVPIGASGEAEETVKLRHTLSVHHPELPPVYSTPDMI
Ga0311339_1002863683300029999PalsaLAKPIPVGARGEAEETVEFRHTLTAHHSELPPVYST
Ga0302194_1030567123300030506BogMARPIPIRAQGEASETVELKHTLSAHHPELPPVYS
Ga0311355_1091825023300030580PalsaLAKPIPVGARGEAEETVEFRHTLTAHHSELPPVYSTPDMIR
Ga0310039_1004994953300030706Peatlands SoilMARPIPIGVRGEAAETVELKHTLSAHHPELPPVYSTP
Ga0265459_1064539223300030741SoilMAKEIPIGAKGEARETVEFKHTLAAHHPELPPVYSTP
Ga0265762_106055523300030760SoilMAREIPIGVRGEAEETVEFEHTLTAHHPQLPPVYSTPDMI
Ga0265750_104011423300030813SoilMAKPIPIGARGEAQETVEFKHTLTSHHPELPPVYSTPDMIR
Ga0265746_100860733300030815SoilMAKEIPIGARGEARETVEFKHTLTAHHPELPAVYSTPDMIR
Ga0311335_1061395813300030838FenMAKPIPIRAHGEAEETVELKHTLAAHHPELPPVYSTPDMIR
Ga0302308_1043391823300031027PalsaMAKEIPIGVRAEAQETVEFKHTLAAHHSELPPVYSTPDM
Ga0265340_1048411823300031247RhizosphereLAKDVPIGARGEAEETVLFEHTLTAHHPELPPVYSTPDMIRLMETA
Ga0302326_1141336513300031525PalsaMAKEIPIGARGEAQETVEFKHTLTAHHPELPPVYSTPDMIRLM
Ga0318572_1064512013300031681SoilMAKAVPMGARGEAGETVEFRHTLTAHHPMLPPVYSTPDMIRLMETAA
Ga0310686_11704143013300031708SoilMPKPIPIGARGEARETVEFKHTLTAYHPQLPPVYSTPDM
Ga0310686_11839863723300031708SoilMAKAMPIGTRGTAEETVEFKHTLSAHHPELPPVYSTPDMIRLMETA
Ga0310686_11942642013300031708SoilMAREIPIGARGEARETVEFKHTLAAHDARLPPVYSTPDMIR
Ga0307474_1041780113300031718Hardwood Forest SoilVAKQIPIGARAEAEETVEFEHTLTSHHPELPPVYS
Ga0307474_1119813623300031718Hardwood Forest SoilMAKPVPMGARGEAEETVEFEHTLKAHHQSLPPVYSTPDMIRLMETA
Ga0307469_1124649213300031720Hardwood Forest SoilMQKPIPIGARATAEETVEFKHTLTAHHPELPPVYSTPDMIRL
Ga0307477_1062420323300031753Hardwood Forest SoilMARAIPIGTRGEARETVEFQRTLTAHNARLPPIYSTPDMIRLMETA
Ga0307475_1010873943300031754Hardwood Forest SoilMAKLIPIGVHGETRETVEFKHTLTAHHPELPPVYSTPDMIPLQT
Ga0307475_1023429513300031754Hardwood Forest SoilLAKEIPLGVRGEAAETVAFENTLTSRYPELPPVYSTPDM
Ga0307473_1036912213300031820Hardwood Forest SoilMARPIPIGVRGEASETVELKHTLSEHHAELPPVYSTPDMIRLME
Ga0307478_1045792723300031823Hardwood Forest SoilMAKAMPIGARGTAEETVEFKHTLTSHDPELPPVYSTPDMIRLMETA
Ga0307478_1110337023300031823Hardwood Forest SoilMAKEIPIGASGEARETVEFKHTLAAHHPELPPVYS
Ga0311367_1234661813300031918FenMPRPIPIRAHGAAEETVEFKHTLSAHHPELPPVYSTP
Ga0310912_1083487313300031941SoilVAKEISIGARGEAEETVEFEHTLTSHHPELPPVYSTPDMI
Ga0307479_1106667613300031962Hardwood Forest SoilMAKPIGIGARGEVEETVEFKHTLTLNHPQLPPVYSTPAMIRFME
Ga0307479_1120008813300031962Hardwood Forest SoilLAKDVPLGAREEVTETVEFRHTLTSHHPELPPVYSTPDMIRL
Ga0307479_1156821823300031962Hardwood Forest SoilMARPIPIGVRGEASETVELKHTLAAHHAELPPVYSTPDMIRLM
Ga0306922_1186310813300032001SoilMTLPIPIGAYGDAEETVGLQHTLAAHHPELPPVYSTPDMIRLMETAC
Ga0311301_1074150613300032160Peatlands SoilMARQIPIGVRGEAAETVELKHTLSAHHAELPPVYSTPDMIRLMETVAE
Ga0307470_1109507123300032174Hardwood Forest SoilLAREIPIGARSDAEETVAFEHTLTSHHPELPPVYST
Ga0307471_10071544523300032180Hardwood Forest SoilMAKPVPMGARGEAEQTVEFEHTLKAHHPSLPPVYSTPDMIRLM
Ga0307471_10334315023300032180Hardwood Forest SoilMVKPIPIGARGEAQETVEFQHTLTAHNPKLPPVYSTPDMIRLM
Ga0307472_10048760123300032205Hardwood Forest SoilMAKAIPIGVRGEAEETVEFKHTLTAHHPELPPVYSTPDMI
Ga0307472_10276406723300032205Hardwood Forest SoilMAKETPIGARGEAEETVEFKHTLTAYHPELPPVYSTPDMIR
Ga0348332_1444929313300032515Plant LitterMAKAMPIGARATVEETVEFKHTLTSRHPELPPVYSTPDMIRLMETA
Ga0335079_1237589113300032783SoilMVIGRNLAKDIPIGARGEASETVAFQHTLTSHHPELPPVYSTPDMIR
Ga0335078_1194109213300032805SoilLAKPIPIGARGDAEETVTFEHTLTSHHPQLPPVYSTPDMIRLMET
Ga0335080_1030155133300032828SoilMVIGRNLAKDIPIGARGEASETVAFQHTLTSHHPELPPVYSTPD
Ga0335070_1011977013300032829SoilMPRLIPIGVRGEAEETVEFRHTLTSHHEALPPVYSTP
Ga0335081_1208782123300032892SoilMAKPVPLGTHGTASEAVAFENTLTFHHPELPPVYSTPDMIRLM
Ga0335069_1223195113300032893SoilMSKSVPIGARGEVSEIVEHKHTLTHFDPKLPPVYST
Ga0335075_1169081413300032896SoilVPKEIPIGARGEAEETVEFQHTLTSRHAELPPIYST
Ga0335072_1138874813300032898SoilMAKPFPIGARGEAQETVEFKHTLTAQHPELPPVYSTPDMI
Ga0335076_1000234313300032955SoilMAKEIPIGVRGEAQETVEFKHTLTAHHPQLPPVYS
Ga0335084_1078979323300033004SoilMAISIPIGVRGEAAETVELKHTLATHHPDLPPVYSTPDMIRLMETACFH
Ga0334722_1007424713300033233SedimentMKEGPLGARATAEEAVEFQHTLTSHHPELPPVYSTPDMIRLMETA
Ga0310811_1101343523300033475SoilMKQVPIGARAERSEVVERKHTLTHHHDQLPPVYSTPDMIR
Ga0371490_113847923300033561Peat SoilMPPPSTEFMPRPIPIGTRGEAEETIELRHTLAGHRPELPPVYATPAMILLMEIA
Ga0370515_0323666_3_1103300034163Untreated Peat SoilMARPIPIGVRGEAAETVELKHTLSAHHPELPPVYST


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.