| Basic Information | |
|---|---|
| Family ID | F011702 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 288 |
| Average Sequence Length | 43 residues |
| Representative Sequence | KLNKLTEAREVLTEAVKIQGPMQSMSQDLLTKVNAARAKGK |
| Number of Associated Samples | 236 |
| Number of Associated Scaffolds | 288 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.35 % |
| % of genes near scaffold ends (potentially truncated) | 97.57 % |
| % of genes from short scaffolds (< 2000 bps) | 91.32 % |
| Associated GOLD sequencing projects | 220 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.66 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.569 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.042 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.986 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.93% β-sheet: 0.00% Coil/Unstructured: 55.07% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.66 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 288 Family Scaffolds |
|---|---|---|
| PF02518 | HATPase_c | 19.79 |
| PF08448 | PAS_4 | 1.74 |
| PF13620 | CarboxypepD_reg | 0.69 |
| PF05426 | Alginate_lyase | 0.69 |
| PF02597 | ThiS | 0.35 |
| PF04014 | MazE_antitoxin | 0.35 |
| PF01548 | DEDD_Tnp_IS110 | 0.35 |
| PF00069 | Pkinase | 0.35 |
| PF13424 | TPR_12 | 0.35 |
| PF13358 | DDE_3 | 0.35 |
| PF12849 | PBP_like_2 | 0.35 |
| PF13517 | FG-GAP_3 | 0.35 |
| PF03176 | MMPL | 0.35 |
| PF00378 | ECH_1 | 0.35 |
| PF12779 | WXXGXW | 0.35 |
| PF02954 | HTH_8 | 0.35 |
| PF14060 | DUF4252 | 0.35 |
| PF13432 | TPR_16 | 0.35 |
| PF00873 | ACR_tran | 0.35 |
| PF00092 | VWA | 0.35 |
| COG ID | Name | Functional Category | % Frequency in 288 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.39 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.35 |
| COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 0.35 |
| COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 0.35 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.35 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.35 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.92 % |
| Unclassified | root | N/A | 27.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17377621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1161 | Open in IMG/M |
| 2140918007|ConsensusfromContig8742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 732 | Open in IMG/M |
| 2170459023|GZGNO2B02JL0AR | Not Available | 511 | Open in IMG/M |
| 3300000567|JGI12270J11330_10104179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1224 | Open in IMG/M |
| 3300001159|JGI12650J13346_1002144 | Not Available | 880 | Open in IMG/M |
| 3300001166|JGI12694J13545_1012196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 903 | Open in IMG/M |
| 3300001305|C688J14111_10302548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 507 | Open in IMG/M |
| 3300004092|Ga0062389_100601257 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300004139|Ga0058897_10642191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 1071 | Open in IMG/M |
| 3300004153|Ga0063455_100421793 | Not Available | 796 | Open in IMG/M |
| 3300004476|Ga0068966_1378275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1397 | Open in IMG/M |
| 3300004633|Ga0066395_10993869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 511 | Open in IMG/M |
| 3300005176|Ga0066679_10733838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300005340|Ga0070689_101664727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300005363|Ga0008090_14137391 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300005365|Ga0070688_100590631 | Not Available | 849 | Open in IMG/M |
| 3300005436|Ga0070713_101149051 | Not Available | 751 | Open in IMG/M |
| 3300005439|Ga0070711_101075205 | Not Available | 692 | Open in IMG/M |
| 3300005454|Ga0066687_10581538 | Not Available | 665 | Open in IMG/M |
| 3300005457|Ga0070662_101116777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
| 3300005529|Ga0070741_10509976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1086 | Open in IMG/M |
| 3300005530|Ga0070679_100911143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
| 3300005534|Ga0070735_10820633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 547 | Open in IMG/M |
| 3300005538|Ga0070731_10904918 | Not Available | 585 | Open in IMG/M |
| 3300005538|Ga0070731_11042476 | Not Available | 541 | Open in IMG/M |
| 3300005540|Ga0066697_10111699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1598 | Open in IMG/M |
| 3300005541|Ga0070733_10221499 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300005557|Ga0066704_10180597 | All Organisms → cellular organisms → Bacteria | 1423 | Open in IMG/M |
| 3300005591|Ga0070761_10003534 | All Organisms → cellular organisms → Bacteria | 9358 | Open in IMG/M |
| 3300005610|Ga0070763_10756163 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300005764|Ga0066903_103332648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 868 | Open in IMG/M |
| 3300005902|Ga0075273_10132406 | Not Available | 514 | Open in IMG/M |
| 3300006050|Ga0075028_100128388 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300006052|Ga0075029_100745213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 663 | Open in IMG/M |
| 3300006052|Ga0075029_100750262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 661 | Open in IMG/M |
| 3300006086|Ga0075019_10844517 | Not Available | 585 | Open in IMG/M |
| 3300006172|Ga0075018_10481101 | Not Available | 644 | Open in IMG/M |
| 3300006173|Ga0070716_100012059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4369 | Open in IMG/M |
| 3300006173|Ga0070716_100487141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 907 | Open in IMG/M |
| 3300006174|Ga0075014_100700652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 589 | Open in IMG/M |
| 3300006175|Ga0070712_101431718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300006176|Ga0070765_101394538 | Not Available | 660 | Open in IMG/M |
| 3300006354|Ga0075021_10344854 | Not Available | 928 | Open in IMG/M |
| 3300006881|Ga0068865_100231275 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
| 3300006914|Ga0075436_100903261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 661 | Open in IMG/M |
| 3300007258|Ga0099793_10710191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300009088|Ga0099830_10840695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
| 3300009089|Ga0099828_10154621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 2028 | Open in IMG/M |
| 3300009137|Ga0066709_100317513 | All Organisms → cellular organisms → Bacteria | 2125 | Open in IMG/M |
| 3300009174|Ga0105241_10271939 | Not Available | 1444 | Open in IMG/M |
| 3300009524|Ga0116225_1308839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 706 | Open in IMG/M |
| 3300009525|Ga0116220_10070560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1466 | Open in IMG/M |
| 3300009551|Ga0105238_12441624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 558 | Open in IMG/M |
| 3300009623|Ga0116133_1234194 | Not Available | 500 | Open in IMG/M |
| 3300009636|Ga0116112_1110402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
| 3300009683|Ga0116224_10583896 | Not Available | 534 | Open in IMG/M |
| 3300009759|Ga0116101_1003804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2402 | Open in IMG/M |
| 3300009792|Ga0126374_10913260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 681 | Open in IMG/M |
| 3300010048|Ga0126373_10674418 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300010048|Ga0126373_11808359 | Not Available | 674 | Open in IMG/M |
| 3300010336|Ga0134071_10517127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300010339|Ga0074046_10227380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1165 | Open in IMG/M |
| 3300010341|Ga0074045_10042676 | All Organisms → cellular organisms → Bacteria | 3328 | Open in IMG/M |
| 3300010343|Ga0074044_10324992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1010 | Open in IMG/M |
| 3300010358|Ga0126370_10483089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 1042 | Open in IMG/M |
| 3300010359|Ga0126376_10135988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1944 | Open in IMG/M |
| 3300010361|Ga0126378_12074928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300010361|Ga0126378_12861069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 551 | Open in IMG/M |
| 3300010376|Ga0126381_100716193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1432 | Open in IMG/M |
| 3300010376|Ga0126381_104995608 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300010379|Ga0136449_101995716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 857 | Open in IMG/M |
| 3300010396|Ga0134126_12760717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300010403|Ga0134123_13401974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 514 | Open in IMG/M |
| 3300011081|Ga0138575_1008328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1338 | Open in IMG/M |
| 3300011120|Ga0150983_10236689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
| 3300011269|Ga0137392_10675463 | Not Available | 856 | Open in IMG/M |
| 3300011270|Ga0137391_10007794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 8407 | Open in IMG/M |
| 3300012207|Ga0137381_10283403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1442 | Open in IMG/M |
| 3300012207|Ga0137381_11218652 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300012209|Ga0137379_10590994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 1017 | Open in IMG/M |
| 3300012350|Ga0137372_10817457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 668 | Open in IMG/M |
| 3300012354|Ga0137366_10221934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1407 | Open in IMG/M |
| 3300012362|Ga0137361_10212946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1751 | Open in IMG/M |
| 3300012363|Ga0137390_10932096 | Not Available | 822 | Open in IMG/M |
| 3300012469|Ga0150984_115685659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1189 | Open in IMG/M |
| 3300012917|Ga0137395_10372818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1019 | Open in IMG/M |
| 3300012917|Ga0137395_11265523 | Not Available | 512 | Open in IMG/M |
| 3300012924|Ga0137413_10843202 | Not Available | 707 | Open in IMG/M |
| 3300012955|Ga0164298_11160441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300012976|Ga0134076_10556493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300013100|Ga0157373_10391210 | Not Available | 995 | Open in IMG/M |
| 3300014154|Ga0134075_10165252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 948 | Open in IMG/M |
| 3300014165|Ga0181523_10196356 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300014168|Ga0181534_10830969 | Not Available | 548 | Open in IMG/M |
| 3300014495|Ga0182015_10917973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300014502|Ga0182021_10089806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3568 | Open in IMG/M |
| 3300015242|Ga0137412_10386917 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 1084 | Open in IMG/M |
| 3300015245|Ga0137409_11098275 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300016270|Ga0182036_11019442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 683 | Open in IMG/M |
| 3300017924|Ga0187820_1094399 | Not Available | 855 | Open in IMG/M |
| 3300017924|Ga0187820_1289879 | Not Available | 536 | Open in IMG/M |
| 3300017940|Ga0187853_10115842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1307 | Open in IMG/M |
| 3300017942|Ga0187808_10597750 | Not Available | 512 | Open in IMG/M |
| 3300017943|Ga0187819_10459851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300017955|Ga0187817_10657422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 669 | Open in IMG/M |
| 3300017955|Ga0187817_11106702 | Not Available | 508 | Open in IMG/M |
| 3300017959|Ga0187779_11090694 | Not Available | 557 | Open in IMG/M |
| 3300017970|Ga0187783_10908131 | Not Available | 635 | Open in IMG/M |
| 3300017972|Ga0187781_10429268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 945 | Open in IMG/M |
| 3300017975|Ga0187782_11401390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 549 | Open in IMG/M |
| 3300017995|Ga0187816_10073315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1453 | Open in IMG/M |
| 3300017995|Ga0187816_10264382 | Not Available | 752 | Open in IMG/M |
| 3300017995|Ga0187816_10310592 | Not Available | 693 | Open in IMG/M |
| 3300017999|Ga0187767_10168825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 669 | Open in IMG/M |
| 3300018006|Ga0187804_10244331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300018007|Ga0187805_10142140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 1091 | Open in IMG/M |
| 3300018030|Ga0187869_10497780 | Not Available | 579 | Open in IMG/M |
| 3300018037|Ga0187883_10455444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 658 | Open in IMG/M |
| 3300018047|Ga0187859_10727018 | Not Available | 566 | Open in IMG/M |
| 3300018060|Ga0187765_10055613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2050 | Open in IMG/M |
| 3300018062|Ga0187784_10361352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1176 | Open in IMG/M |
| 3300018062|Ga0187784_10848361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 728 | Open in IMG/M |
| 3300018062|Ga0187784_11022627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 656 | Open in IMG/M |
| 3300018090|Ga0187770_11037202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 660 | Open in IMG/M |
| 3300018431|Ga0066655_10363743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 951 | Open in IMG/M |
| 3300018433|Ga0066667_10418184 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300018482|Ga0066669_12313169 | Not Available | 513 | Open in IMG/M |
| 3300020170|Ga0179594_10100718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1039 | Open in IMG/M |
| 3300020579|Ga0210407_10020965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4854 | Open in IMG/M |
| 3300020579|Ga0210407_10512759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 937 | Open in IMG/M |
| 3300020579|Ga0210407_10618828 | Not Available | 843 | Open in IMG/M |
| 3300020580|Ga0210403_10628650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 865 | Open in IMG/M |
| 3300020580|Ga0210403_11178942 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300020582|Ga0210395_10436292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 985 | Open in IMG/M |
| 3300020582|Ga0210395_10786400 | Not Available | 710 | Open in IMG/M |
| 3300020582|Ga0210395_10989411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. S156 | 623 | Open in IMG/M |
| 3300020583|Ga0210401_10319829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1413 | Open in IMG/M |
| 3300020583|Ga0210401_10845748 | Not Available | 774 | Open in IMG/M |
| 3300021046|Ga0215015_10207213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300021168|Ga0210406_10289325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1335 | Open in IMG/M |
| 3300021168|Ga0210406_11249927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 537 | Open in IMG/M |
| 3300021171|Ga0210405_10824167 | Not Available | 709 | Open in IMG/M |
| 3300021178|Ga0210408_10907739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300021401|Ga0210393_11428074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 552 | Open in IMG/M |
| 3300021401|Ga0210393_11571423 | Not Available | 522 | Open in IMG/M |
| 3300021404|Ga0210389_11514135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300021405|Ga0210387_10043353 | All Organisms → cellular organisms → Bacteria | 3598 | Open in IMG/M |
| 3300021405|Ga0210387_10902548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
| 3300021406|Ga0210386_10022981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4864 | Open in IMG/M |
| 3300021406|Ga0210386_10158116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1899 | Open in IMG/M |
| 3300021407|Ga0210383_10124377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2182 | Open in IMG/M |
| 3300021407|Ga0210383_10149964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1981 | Open in IMG/M |
| 3300021407|Ga0210383_10288168 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
| 3300021420|Ga0210394_10034572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4509 | Open in IMG/M |
| 3300021432|Ga0210384_10773605 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300021432|Ga0210384_10932065 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300021433|Ga0210391_10029199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4434 | Open in IMG/M |
| 3300021474|Ga0210390_10657867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 875 | Open in IMG/M |
| 3300021475|Ga0210392_10918360 | Not Available | 655 | Open in IMG/M |
| 3300021477|Ga0210398_10637462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 864 | Open in IMG/M |
| 3300021477|Ga0210398_11359023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 556 | Open in IMG/M |
| 3300021478|Ga0210402_10967634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 778 | Open in IMG/M |
| 3300021479|Ga0210410_11369816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 600 | Open in IMG/M |
| 3300021479|Ga0210410_11530194 | Not Available | 560 | Open in IMG/M |
| 3300021559|Ga0210409_10458472 | Not Available | 1136 | Open in IMG/M |
| 3300021560|Ga0126371_11161203 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300021560|Ga0126371_12319711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300021860|Ga0213851_1123786 | Not Available | 987 | Open in IMG/M |
| 3300022527|Ga0242664_1061986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
| 3300022531|Ga0242660_1052775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 892 | Open in IMG/M |
| 3300022557|Ga0212123_10919387 | Not Available | 513 | Open in IMG/M |
| 3300022717|Ga0242661_1009196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1386 | Open in IMG/M |
| 3300022717|Ga0242661_1055113 | Not Available | 751 | Open in IMG/M |
| 3300022722|Ga0242657_1019041 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300022726|Ga0242654_10252194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 633 | Open in IMG/M |
| 3300022726|Ga0242654_10290950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300024331|Ga0247668_1072958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 693 | Open in IMG/M |
| 3300025404|Ga0208936_1000437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5770 | Open in IMG/M |
| 3300025412|Ga0208194_1000412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8692 | Open in IMG/M |
| 3300025906|Ga0207699_10342792 | Not Available | 1053 | Open in IMG/M |
| 3300025907|Ga0207645_10462497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 857 | Open in IMG/M |
| 3300025944|Ga0207661_10399759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1246 | Open in IMG/M |
| 3300026025|Ga0208778_1015033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 742 | Open in IMG/M |
| 3300026035|Ga0207703_10577913 | Not Available | 1061 | Open in IMG/M |
| 3300026118|Ga0207675_101593542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300026291|Ga0209890_10215991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 609 | Open in IMG/M |
| 3300026313|Ga0209761_1063211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2004 | Open in IMG/M |
| 3300026316|Ga0209155_1234512 | Not Available | 569 | Open in IMG/M |
| 3300026317|Ga0209154_1155741 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300026318|Ga0209471_1287338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300026328|Ga0209802_1064109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1758 | Open in IMG/M |
| 3300026355|Ga0257149_1039328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300026537|Ga0209157_1053581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2124 | Open in IMG/M |
| 3300026551|Ga0209648_10837458 | Not Available | 503 | Open in IMG/M |
| 3300026552|Ga0209577_10799036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300026557|Ga0179587_10090973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1832 | Open in IMG/M |
| 3300026557|Ga0179587_10799725 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300026823|Ga0207759_115496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300027035|Ga0207776_1012207 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300027516|Ga0207761_1033715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1007 | Open in IMG/M |
| 3300027634|Ga0209905_1050409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300027641|Ga0208827_1151198 | Not Available | 645 | Open in IMG/M |
| 3300027648|Ga0209420_1186972 | Not Available | 555 | Open in IMG/M |
| 3300027652|Ga0209007_1031943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 1351 | Open in IMG/M |
| 3300027676|Ga0209333_1163587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300027681|Ga0208991_1251576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300027842|Ga0209580_10269397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 847 | Open in IMG/M |
| 3300027842|Ga0209580_10336725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 751 | Open in IMG/M |
| 3300027853|Ga0209274_10110267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1363 | Open in IMG/M |
| 3300027854|Ga0209517_10118944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1743 | Open in IMG/M |
| 3300027855|Ga0209693_10403327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 660 | Open in IMG/M |
| 3300027857|Ga0209166_10540260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300027862|Ga0209701_10107452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1739 | Open in IMG/M |
| 3300027867|Ga0209167_10136452 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
| 3300027867|Ga0209167_10185761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1103 | Open in IMG/M |
| 3300027884|Ga0209275_10074675 | All Organisms → cellular organisms → Bacteria | 1686 | Open in IMG/M |
| 3300027884|Ga0209275_10718921 | Not Available | 575 | Open in IMG/M |
| 3300027898|Ga0209067_10915007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 516 | Open in IMG/M |
| 3300027905|Ga0209415_10681976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 741 | Open in IMG/M |
| 3300027908|Ga0209006_10044138 | All Organisms → cellular organisms → Bacteria | 4015 | Open in IMG/M |
| 3300027908|Ga0209006_10126763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2251 | Open in IMG/M |
| 3300027908|Ga0209006_10804617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 762 | Open in IMG/M |
| 3300027908|Ga0209006_10885882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 718 | Open in IMG/M |
| 3300027911|Ga0209698_10286623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1307 | Open in IMG/M |
| 3300027986|Ga0209168_10138682 | Not Available | 1237 | Open in IMG/M |
| 3300028017|Ga0265356_1009366 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300028731|Ga0302301_1043823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1240 | Open in IMG/M |
| 3300028828|Ga0307312_10779039 | Not Available | 634 | Open in IMG/M |
| 3300028828|Ga0307312_11117683 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300028863|Ga0302218_10079442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1028 | Open in IMG/M |
| 3300028881|Ga0307277_10182024 | Not Available | 918 | Open in IMG/M |
| 3300028906|Ga0308309_10176415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1742 | Open in IMG/M |
| 3300028906|Ga0308309_11158524 | Not Available | 667 | Open in IMG/M |
| 3300029882|Ga0311368_10117342 | Not Available | 2237 | Open in IMG/M |
| 3300029908|Ga0311341_10205007 | Not Available | 1224 | Open in IMG/M |
| 3300029943|Ga0311340_10605269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 957 | Open in IMG/M |
| 3300029953|Ga0311343_10444133 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300030007|Ga0311338_11002951 | Not Available | 810 | Open in IMG/M |
| 3300030007|Ga0311338_11487270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 625 | Open in IMG/M |
| 3300030020|Ga0311344_11122258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300030057|Ga0302176_10265349 | Not Available | 688 | Open in IMG/M |
| 3300030503|Ga0311370_11609344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300030509|Ga0302183_10293612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 628 | Open in IMG/M |
| 3300030520|Ga0311372_11951940 | Not Available | 690 | Open in IMG/M |
| 3300030524|Ga0311357_10535429 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300030545|Ga0210271_10453514 | Not Available | 637 | Open in IMG/M |
| 3300030618|Ga0311354_11562170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 581 | Open in IMG/M |
| 3300030836|Ga0265767_120412 | Not Available | 500 | Open in IMG/M |
| 3300031090|Ga0265760_10036027 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
| 3300031231|Ga0170824_103922895 | Not Available | 940 | Open in IMG/M |
| 3300031234|Ga0302325_11031784 | Not Available | 1119 | Open in IMG/M |
| 3300031234|Ga0302325_11489816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 872 | Open in IMG/M |
| 3300031680|Ga0318574_10484057 | Not Available | 725 | Open in IMG/M |
| 3300031708|Ga0310686_107628608 | Not Available | 709 | Open in IMG/M |
| 3300031708|Ga0310686_116828923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300031715|Ga0307476_10535699 | Not Available | 868 | Open in IMG/M |
| 3300031715|Ga0307476_10595829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 819 | Open in IMG/M |
| 3300031720|Ga0307469_10717635 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300031720|Ga0307469_11546795 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300031754|Ga0307475_10830275 | Not Available | 732 | Open in IMG/M |
| 3300031823|Ga0307478_10109976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2146 | Open in IMG/M |
| 3300031823|Ga0307478_10556891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 958 | Open in IMG/M |
| 3300031879|Ga0306919_10725734 | Not Available | 765 | Open in IMG/M |
| 3300031879|Ga0306919_11341822 | Not Available | 541 | Open in IMG/M |
| 3300031910|Ga0306923_10335889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1724 | Open in IMG/M |
| 3300031912|Ga0306921_11921945 | Not Available | 633 | Open in IMG/M |
| 3300031938|Ga0308175_100898351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 974 | Open in IMG/M |
| 3300031938|Ga0308175_102775756 | Not Available | 547 | Open in IMG/M |
| 3300031938|Ga0308175_103031669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 522 | Open in IMG/M |
| 3300031945|Ga0310913_11160854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 538 | Open in IMG/M |
| 3300032160|Ga0311301_10477927 | All Organisms → cellular organisms → Bacteria | 1860 | Open in IMG/M |
| 3300032174|Ga0307470_10107198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1616 | Open in IMG/M |
| 3300032174|Ga0307470_10136989 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300032205|Ga0307472_100775888 | Not Available | 872 | Open in IMG/M |
| 3300032421|Ga0310812_10347276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300032783|Ga0335079_10592074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1171 | Open in IMG/M |
| 3300032783|Ga0335079_10761275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 1006 | Open in IMG/M |
| 3300032828|Ga0335080_10647892 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300032892|Ga0335081_10515532 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
| 3300032895|Ga0335074_10873300 | Not Available | 822 | Open in IMG/M |
| 3300032896|Ga0335075_10284022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1868 | Open in IMG/M |
| 3300032898|Ga0335072_11397887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis | 605 | Open in IMG/M |
| 3300032955|Ga0335076_11652966 | Not Available | 529 | Open in IMG/M |
| 3300033158|Ga0335077_10151246 | All Organisms → cellular organisms → Bacteria | 2662 | Open in IMG/M |
| 3300033808|Ga0314867_013688 | All Organisms → cellular organisms → Bacteria | 1910 | Open in IMG/M |
| 3300033818|Ga0334804_144101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300033829|Ga0334854_104603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.67% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.29% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.86% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.17% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.82% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.82% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.47% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.47% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.47% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.12% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.08% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.08% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.74% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.39% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.04% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.04% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.04% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.04% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.69% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.69% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.69% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.69% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.35% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.35% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.35% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.35% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.35% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.35% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.35% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.35% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.35% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.35% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.35% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.35% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.35% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.35% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.35% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.35% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
| 2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001159 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 | Environmental | Open in IMG/M |
| 3300001166 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004476 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005902 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011081 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 60 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025404 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026025 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026823 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 19 (SPAdes) | Environmental | Open in IMG/M |
| 3300027035 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
| 3300027634 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812S1M | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
| 3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029908 | II_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030545 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO033SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
| 3300033818 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-M | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_00194730 | 2088090014 | Soil | FAYGKLNKLTEARDVLTEAVKIQGPMQSMSQDLLAKVNAARAKGK |
| A_all_C_02527640 | 2140918007 | Soil | NKLTEAREVLTEAVKIPGPLQAMSQDLLTKVNNARAKGK |
| FA3_00626910 | 2170459023 | Grass Soil | EAREVLMEAVKIPGPVQPLSQDLLAKVNAARAKGR |
| JGI12270J11330_101041791 | 3300000567 | Peatlands Soil | NRVNEARDILVEVVKVPGPVQPLAQDLLAKVNAARAKGH* |
| JGI12650J13346_10021442 | 3300001159 | Forest Soil | FAYAKLNRVNEARDVLAEAVKIPGPVQNMSQDLLAKVNAARAKAK* |
| JGI12694J13545_10121962 | 3300001166 | Forest Soil | KLTEAREVLTEAVKIPGPLQPMSQDLLAKVNSARAKGK* |
| C688J14111_103025482 | 3300001305 | Soil | NKLTEAREVLTEAVKIPGPLQAMSQDLLTKVNSARAKGK* |
| Ga0062389_1006012572 | 3300004092 | Bog Forest Soil | ALYGLGYVYGKLNKLTEARDVLTEAAKIQSPWQAVSQDLLTKVNAARAKGK* |
| Ga0058897_106421911 | 3300004139 | Forest Soil | GLGYSYGKLNKLTEARDVLTEAVKIQSPWQKISEDLLGKVNAARAKGK* |
| Ga0063455_1004217932 | 3300004153 | Soil | YAKLNKVPDAKEVLNEAVKISGPVQQPAQDLLLKVNAAKVKAK* |
| Ga0068966_13782751 | 3300004476 | Peatlands Soil | LGFAYAKLSKISEARETLQEAVKISGPVQQPAQDLLQKVNAARAKGK* |
| Ga0066395_109938692 | 3300004633 | Tropical Forest Soil | FAYGKLNKLTEAREVLTEAVKIPGPLQSMSQDLLAKVNSARAKGK* |
| Ga0066679_107338382 | 3300005176 | Soil | YRLGFAYAKLSRTTEAREVLIEAVKIPGPLQSMSQELLTKVNAARAKGK* |
| Ga0070689_1016647272 | 3300005340 | Switchgrass Rhizosphere | KTNKVSDARDVLEQAVKIEGPVQQPAQELLTKVNAARAKAK* |
| Ga0008090_141373912 | 3300005363 | Tropical Rainforest Soil | LNRVTDARLVLTEAVKIPGPLQQPSRELLGKVNAARAKGK* |
| Ga0070688_1005906312 | 3300005365 | Switchgrass Rhizosphere | FAYAKISRVNEAREVLMEAVKIPGPVQPLSQDLLAKVNAARAKGR* |
| Ga0070713_1011490511 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | KLNRVSEARDALTEAAKIPGPVQPLSQDLLAKVNAARAKGK* |
| Ga0070711_1010752051 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | RLGYAYAKLNKVDDARTVLTEVAKMDTPLQQPSKDLLAKVNSARAKGK* |
| Ga0066687_105815382 | 3300005454 | Soil | LGFAYAKLHRNTEAQEVLRQAVTVPGPFQAASRELLAKVNTLAKTK* |
| Ga0070662_1011167772 | 3300005457 | Corn Rhizosphere | NKVSDARDVLEQAVKIEGPVQQPAQELLTKVNAARAKAK* |
| Ga0070741_105099761 | 3300005529 | Surface Soil | NRVADAKEVLNEAVKISGPVQKPAQDLLTRVNAPRAKAK* |
| Ga0070679_1009111432 | 3300005530 | Corn Rhizosphere | GFAYGKLNKLTEAREVLTEAVKIPGPLQAMSQDLLTKVNSARAKGK* |
| Ga0070735_108206331 | 3300005534 | Surface Soil | LGFAYGKLNKLTEAREVLTEAVKIPGPLQGMSQDLLTKVNSARAKGK* |
| Ga0070731_109049182 | 3300005538 | Surface Soil | LNKVSEAREVLQEAVKISGPVQQPAQDLLAKVNAARAKGR* |
| Ga0070731_110424762 | 3300005538 | Surface Soil | RLGYAYAKLNKVTEAREVLTEVTKIQGPVQQPAQELLAKVNAARAKGK* |
| Ga0066697_101116993 | 3300005540 | Soil | TEARDALTEAVKIPGPVQQPSQDLLAKVNAARAKGR* |
| Ga0070733_102214991 | 3300005541 | Surface Soil | LSRNSEARDVLTEAVKIPGPVQSMSQDLLNKVNAARAKGK* |
| Ga0066704_101805971 | 3300005557 | Soil | LGFAYGKLNKLTEAREVLTEAVKIPGPLQAMSQDLLTKVNSARSKGK* |
| Ga0070761_100035348 | 3300005591 | Soil | RVNEARDVLMEAVKISGPVQAMSQDLLNKVNAARAKGK* |
| Ga0070763_107561632 | 3300005610 | Soil | KLNRVSEARDVLMEAVKISGPVQAMSQDLLTKVNAARAKGK* |
| Ga0066903_1033326483 | 3300005764 | Tropical Forest Soil | NKVDEARTVLTEVSKMDTPLQQPSKDLLAKVNSARAKAK* |
| Ga0075273_101324062 | 3300005902 | Rice Paddy Soil | KLNKIAEAKEILTEAVKLQGPVQQPAQELLEKVNAAKPRRPRK* |
| Ga0075028_1001283881 | 3300006050 | Watersheds | GFAYAKLNKVTEAREVLMEGVKISGPVQAMSQDLLTKVNAARAKGK* |
| Ga0075029_1007452131 | 3300006052 | Watersheds | IGFAYGKLSKLTEAREVLTEAVKISGPWQAMSQDLLTKVNSARAKGK* |
| Ga0075029_1007502621 | 3300006052 | Watersheds | LYGLGSAYAKLNKLTEARDVLTEVSKMPGPLQAMSQDLLTKVNLARAKGK* |
| Ga0075019_108445172 | 3300006086 | Watersheds | ARTVLEEAVKIPGPLQAPSRDLLNKVNAARPKGK* |
| Ga0075018_104811012 | 3300006172 | Watersheds | RLGYAYAKLSRVSEARDALTEAAKIPGPVQPLSQDLLSKVNAARAKGK* |
| Ga0070716_1000120594 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GYAYAKLNKLSEAREVLTEASNTPGPAQQLSRDLLLKVNTARSKGK* |
| Ga0070716_1004871411 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | ARDVLEQAVKIEGPVQQPAQELLTKVNAARAKAK* |
| Ga0075014_1007006522 | 3300006174 | Watersheds | ALYGLGFAYAKLNKLTEAREVLTEAVKIQGPMQSMSQDLLSKVNAARAKGK* |
| Ga0070712_1014317181 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ALYGLGFAYGKLNKLTEAREVLNEAVKIPGPLQAMSKELLTKVNSARATAK* |
| Ga0070765_1013945382 | 3300006176 | Soil | LGFAYAKLNKVSEAREVLTEVVKIAGPVQEPAKDLLLKVNAARSKGN* |
| Ga0075021_103448543 | 3300006354 | Watersheds | KLNKIDDARNVLNEVVKMEGPMQQPAKDLLLKVNTARSKAK* |
| Ga0068865_1002312751 | 3300006881 | Miscanthus Rhizosphere | VTEAREVLLEAVKIPGPVQPLSQDLLAKVNAARAKGR* |
| Ga0075436_1009032611 | 3300006914 | Populus Rhizosphere | RALYGLGFAYGKLNKLTEAREVLTEAVKIQGPMQSMSQDLLAKVNQARAKGK* |
| Ga0099793_107101912 | 3300007258 | Vadose Zone Soil | RLGFAYAKLNRVTEARDILNEASRIPGPMQAMSQVLLAKVNAARAKGNTGR* |
| Ga0099830_108406951 | 3300009088 | Vadose Zone Soil | KLNRFTEAREVLNEAVKIPGPVQPLAQDLLTKVNAARAKGK* |
| Ga0099828_101546211 | 3300009089 | Vadose Zone Soil | LGFAYAKLSRTTEAREVLIEAVKIPGPLQAMSQDLLTKVNAARAKGK* |
| Ga0066709_1003175131 | 3300009137 | Grasslands Soil | VTEARDVLTEASRISGPAQQLAKDLLVKVNAARAKGR* |
| Ga0105241_102719391 | 3300009174 | Corn Rhizosphere | NEAREVLMEAVKIPGPVQPLSQDLLAKVNAARAKGR* |
| Ga0116225_13088392 | 3300009524 | Peatlands Soil | EAREVLTEAVKIPGPLQAMTQDLLTKVNNARAKGQ* |
| Ga0116220_100705601 | 3300009525 | Peatlands Soil | KLSRMTEAREVLTEAAKIQGPAQGMVQELLTKVNAARSKGN* |
| Ga0105238_124416242 | 3300009551 | Corn Rhizosphere | NKLTDAREVLTEAVKIPGPLQAMSQDLLTKVNSARAKGK* |
| Ga0116133_12341941 | 3300009623 | Peatland | YRLGFAYAKLSRVSEARDVLQEAVKISGPVQQPAQDLLAKVNAARAKGK* |
| Ga0116112_11104022 | 3300009636 | Peatland | LGFAYAKLNKASEAHDVLTEAVKIPGPMQAMSQDLLTKVNAARPKGK* |
| Ga0116224_105838961 | 3300009683 | Peatlands Soil | KVSEARDVLQEAVKISGPVQQPAQDLLAKVNAARAKGK* |
| Ga0116101_10038041 | 3300009759 | Peatland | KLTEARDVLTEAVKISSPWQKVSQDLLAKVNAARAKGK* |
| Ga0126374_109132601 | 3300009792 | Tropical Forest Soil | FAYGKLNKLTDAREVLTEAVKIQGPMQSMSQDLLAKVNQARAKGK* |
| Ga0126373_106744183 | 3300010048 | Tropical Forest Soil | YAKLNRVTDARLVLTEAVKIPGPLQQPSQELLGKVNAARAKGK* |
| Ga0126373_118083593 | 3300010048 | Tropical Forest Soil | AYAKLSKLTEAREALTEASKIPGSVQSLSQDLLAKVNAARAKGK* |
| Ga0134071_105171272 | 3300010336 | Grasslands Soil | YRLGYAYAKLSKATEARDALNEAVKIPGPVQQPSQDLLAKVNAARAKGR* |
| Ga0074046_102273802 | 3300010339 | Bog Forest Soil | LGFAYGKLNKLTEAREVLSEAVKIQSPWQPMSQELLAKVNGARAKGK* |
| Ga0074045_100426761 | 3300010341 | Bog Forest Soil | GFAYGKLNKLTEARDVLSEGAKIQSPWQPMSQQLLAKVNDARAKGK* |
| Ga0074044_103249921 | 3300010343 | Bog Forest Soil | KLSRVNEARDVLMEAVKISGPVQAMSQDLLNKVNAARAKGK* |
| Ga0126370_104830894 | 3300010358 | Tropical Forest Soil | ARALYGLGFAYGKLNKLTEAREVLSEAVKIPGPLQAMSQELLTKVNSARAKAR* |
| Ga0126376_101359881 | 3300010359 | Tropical Forest Soil | LGFAYGKLNKLTEAREVLSEAVKIPGPLQAMSQELLTKVNSARAKAR* |
| Ga0126378_120749281 | 3300010361 | Tropical Forest Soil | LYGLGFAYGKLNKLTVAREVLTEAVKIQGPMQTMSQDLLAKVNQARAKGK* |
| Ga0126378_128610692 | 3300010361 | Tropical Forest Soil | AYGKLNRLTEAREVLTEAVKIPGPFQSLSQDLLTKVNSARAKGK* |
| Ga0126381_1007161931 | 3300010376 | Tropical Forest Soil | EAREVLSEAVKIPGPLQAMSQELLTKVNSARAKAR* |
| Ga0126381_1049956081 | 3300010376 | Tropical Forest Soil | FAYAKLNRVGDARLVLTEAVKIPGPLQQPSQELLGKVNAARAKGK* |
| Ga0136449_1019957162 | 3300010379 | Peatlands Soil | KLSRVNEAREVLMEAVKISGPVQAMSQDLLTKVNAARAKGK* |
| Ga0134126_127607171 | 3300010396 | Terrestrial Soil | KVSDARDVLEQAVKIEGPVQQPAQELLTKVNAARAKAK* |
| Ga0134123_134019741 | 3300010403 | Terrestrial Soil | KLNKVNEARDTLTEAVKIAGPVQKPAQELLTKVNAARSKGTVAQAR* |
| Ga0138575_10083282 | 3300011081 | Peatlands Soil | MTEAREVLTEAAKIQGPAQGMVQELLTKVNAARSKGN* |
| Ga0150983_102366892 | 3300011120 | Forest Soil | LYRLGYAYAKLNRTTDARETLTEAVKIQGPLQQPSRELLEKVNLARAKGK* |
| Ga0137392_106754632 | 3300011269 | Vadose Zone Soil | YAKLSRVSEARDVLTEAAKIPGPVQPLSQDLLSKVNAARAKGK* |
| Ga0137391_100077946 | 3300011270 | Vadose Zone Soil | LSKTTEAREVLTEAVKIQGPLQPMTQELLTKVNAARAKGK* |
| Ga0137381_102834031 | 3300012207 | Vadose Zone Soil | RLGYAYAKLNHVDEARNVLNEAVQIPVPVQQPSRDLLAKVNSARARAK* |
| Ga0137381_112186522 | 3300012207 | Vadose Zone Soil | YAKLNRVTEARDVLTEASRISGPAQQPAKDLLVKVNAARAKGR* |
| Ga0137379_105909943 | 3300012209 | Vadose Zone Soil | KLTEAREVLTEAAKISGPLQAMSQDLLTKVNSARAKGK* |
| Ga0137372_108174571 | 3300012350 | Vadose Zone Soil | AREVLTEAVKIPGPMQAMSQDLLTKVNSARAKGK* |
| Ga0137366_102219343 | 3300012354 | Vadose Zone Soil | GLGFAYGKLNKLTEAREVLTEAVKIPGPLQAMSQDLLTKVNSARAKGK* |
| Ga0137361_102129461 | 3300012362 | Vadose Zone Soil | AYAKLNRINEARDVLSEAAKISGPVQQPSQELLAKVNAARAKGK* |
| Ga0137390_109320961 | 3300012363 | Vadose Zone Soil | EAREALVEAVKIPGPVQPLSQDLLAKVNAARAKGK* |
| Ga0150984_1156856593 | 3300012469 | Avena Fatua Rhizosphere | GKLNKLTEAREVLTEAVKIPGPLQAMSQDLLTKVNSARAKGK* |
| Ga0137395_103728181 | 3300012917 | Vadose Zone Soil | YAYAKLNRIEEARNVLNEAVQIAGPVQQPSRDLLGKVNTARAKGK* |
| Ga0137395_112655232 | 3300012917 | Vadose Zone Soil | YAKLSHNSEAREVLLEAAKIPGPVQPLSQDLLAKVNAARAKGK* |
| Ga0137413_108432022 | 3300012924 | Vadose Zone Soil | EARDVLTEAVKIQSPWQKISEDLLGKVNAARAKGK* |
| Ga0164298_111604412 | 3300012955 | Soil | TEAREVLTEAVKIPGPLQTMSQDLLAKVNSARAKGK* |
| Ga0134076_105564932 | 3300012976 | Grasslands Soil | SKVTEARDALTEAVKIPGPVQQPSQDLLAKVNAARAKGR* |
| Ga0157373_103912102 | 3300013100 | Corn Rhizosphere | YRLGFAYAKISRVNEAREVLMEAVKIPGPVQPLSQDLLAKVNAARAKGR* |
| Ga0134075_101652522 | 3300014154 | Grasslands Soil | LGYAYAKLSKVTEARDALNEAVKIPGPVQQPSQDLLAKVNAARAKGR* |
| Ga0181523_101963563 | 3300014165 | Bog | YGLGFAYAKLNRVSEALEVLTEAAKIQGPVQAMSQELLAKVNVARAKGK* |
| Ga0181534_108309692 | 3300014168 | Bog | LSRNTEARDVLMEGVKIAGPVQSMSQDLRNKVNAARATGK* |
| Ga0182015_109179732 | 3300014495 | Palsa | LYRLGFAYAKLSRVNEARDVLLEAVKISGPVQAMSQDLLAKVNAARAKGK* |
| Ga0182021_100898061 | 3300014502 | Fen | RLGYAYAKLNKVVEAREVLTEALKIAGPVQGPAQDLLKRVNAARSK* |
| Ga0137412_103869172 | 3300015242 | Vadose Zone Soil | LNKLTEARDVLTEAVKIPGPLQAMSQDLLTKVNTARAKGK* |
| Ga0137409_110982751 | 3300015245 | Vadose Zone Soil | NKVTDAREVLNEAVKISGPVQQPARDLLAKVNAARAGAK* |
| Ga0182036_110194422 | 3300016270 | Soil | AYGKLNKLTEAREVLTEAVKIQGPMQSMSQDLLAKVNQARAKGK |
| Ga0187820_10943991 | 3300017924 | Freshwater Sediment | NKVSEAREVLQEAVKISGPVQQPAQDLLAKVNAARAKGR |
| Ga0187820_12898792 | 3300017924 | Freshwater Sediment | YAYAKLNKVTEARAILTDVANVAGPVQQPSKSLLLKVNAARAKGN |
| Ga0187824_101400831 | 3300017927 | Freshwater Sediment | YAYAKINRTTDARETLSEAVKIQGPLQGPSQQLLEKVNAARAKGK |
| Ga0187853_101158421 | 3300017940 | Peatland | SEAREVLTEAVKIQGPVQAMSQDLLTKVNAVRAKGK |
| Ga0187808_105977502 | 3300017942 | Freshwater Sediment | SKTTEAREVLQEAVKISGPMQQPSQDLLAKVNAARAKGK |
| Ga0187819_104598511 | 3300017943 | Freshwater Sediment | EAREVLTEAVKIQGPMQSMTQELLTKVNAARAKGK |
| Ga0187817_106574222 | 3300017955 | Freshwater Sediment | YAKLSRLNEARDVLTEAVKIPGPVQAMSQDLLTKVNAARAKGK |
| Ga0187817_111067022 | 3300017955 | Freshwater Sediment | YRLGFAYAKLSKTTEAREVLQEAVKISGPMQQPSQDLLAKVNAARAKGK |
| Ga0187779_110906942 | 3300017959 | Tropical Peatland | SRTTEAREVLTEAVKYPGQMQPLCQDLLTKVNAARAKGK |
| Ga0187783_109081312 | 3300017970 | Tropical Peatland | NKVTEAREVLSEIVKMPGPVQQPAQDLLTKVNAARAKGK |
| Ga0187781_104292682 | 3300017972 | Tropical Peatland | LYGLGLVYGKQNKLTEAREVLTEAAKIPGPLQAMAQDLLSKVNSARAKGK |
| Ga0187782_114013902 | 3300017975 | Tropical Peatland | KLTEAREVLSEAVKIPGPLQAMSQDLLTKVNSARAKGR |
| Ga0187816_100733151 | 3300017995 | Freshwater Sediment | KVSEAREVLQEAVKISGPVQQPAQDLLAKVNAARAKGK |
| Ga0187816_102643822 | 3300017995 | Freshwater Sediment | LGFAYAKLNKVSEAREVLQEAVKISGPVQQPAQDLLTKVNAARAKGK |
| Ga0187816_103105921 | 3300017995 | Freshwater Sediment | YAKLNKLAEAREVLTEIVTMSGPVQQPAQDLLTKVNAARAKGK |
| Ga0187767_101688252 | 3300017999 | Tropical Peatland | NKLTEAREVLTEAVKIPGPLQAMSQELLTKVNSARAKGN |
| Ga0187804_102443311 | 3300018006 | Freshwater Sediment | GFAYAKLNKVSEAREVLTEAVKIAGPVQAMSQDLLTKVNAARAKGK |
| Ga0187805_101421401 | 3300018007 | Freshwater Sediment | KLNKLTEAREVLTEVAKMQGPFQAMSQDLLTKVNSARAKGK |
| Ga0187869_104977801 | 3300018030 | Peatland | EAREVLTEAVKIQGPVQAMSQDLLTKVNAVRAKGK |
| Ga0187883_104554442 | 3300018037 | Peatland | GFAYGKLNKLTEAREVLTEAVKIPGPLQSMSQDLLTKVNNARAKGQ |
| Ga0187859_107270181 | 3300018047 | Peatland | RLGFAYAKLSRVSEARDVLQEAVKISGPVQQPAQELLVKVNAARAKGR |
| Ga0187765_100556133 | 3300018060 | Tropical Peatland | YAKLNKLTEARETLTEIANKSGPVQQPAQDLLSKVNAARAKGK |
| Ga0187784_103613521 | 3300018062 | Tropical Peatland | LGFAYAKLNKTTEAREVLSEAVKIPGAMLPLSQDLLTKVNAARAKGK |
| Ga0187784_108483613 | 3300018062 | Tropical Peatland | EAREVLGEAVRIPGPLQAMSQDLLNKVSGGRAKGQ |
| Ga0187784_110226273 | 3300018062 | Tropical Peatland | YGLGFAYAKLNKLTEAREALTEAVKIPGPLQAMSQDLLNKVGGTHTTKAK |
| Ga0187770_110372022 | 3300018090 | Tropical Peatland | AYGKLNKLTEAREVLSEAAKIPGPLQAMSQDLLAKVNSARAKGR |
| Ga0066655_103637432 | 3300018431 | Grasslands Soil | YGKLNKLTEAREVLTEAAKIQGPLQPMSQDLLMKVNSARAKGK |
| Ga0066667_104181841 | 3300018433 | Grasslands Soil | LNRVTEARDVLTEASRISGPAQQPAKDLLVKVNAARAKGR |
| Ga0066669_123131692 | 3300018482 | Grasslands Soil | KLNRVSEARDALTEAAKIPGPVQPLSQDLLAKVNAARAKGK |
| Ga0179594_101007181 | 3300020170 | Vadose Zone Soil | MYRLGFAYAKLNRINEARDVLSEAARISGPVQQPSQDLLAKVNAARAKGK |
| Ga0210407_100209654 | 3300020579 | Soil | YAYAKLSHNTEAREALVEAVKIPGPVQPLSQDLLARVNAARAKGK |
| Ga0210407_105127591 | 3300020579 | Soil | GLGFAYAKLNKLTEAREVLTEVVKMPGPLQAMSQDLLAKVNSARAKGN |
| Ga0210407_106188282 | 3300020579 | Soil | NKLTEAREVLTEAVKMQSPWQAMSQDLLTKVNAARAKGK |
| Ga0210403_106286501 | 3300020580 | Soil | RALYGLGFAYGKLPKLTEARDVLTEAVKIQSPWQAMSQALLTKVNEARAKGK |
| Ga0210403_111789422 | 3300020580 | Soil | KLNRVSEARDVLQEAVKISGPVQAMSQDLLNKVNAARAKGK |
| Ga0210395_104362922 | 3300020582 | Soil | RALYGLGFAYGKLNKLTEAREVLTEAVKIQGPMQSMSQELLTKVNAARAKGK |
| Ga0210395_107864002 | 3300020582 | Soil | YRLGFAYAKLNKVSEAHDVLAEAVKIPGPLQAMSQDLLTKVNAARAKGK |
| Ga0210395_109894111 | 3300020582 | Soil | LYGLGYAYGKLNKLTEARDVLAEAVKISSPWQKISQDLLAKVNAARAKGK |
| Ga0210401_103198291 | 3300020583 | Soil | AYAKLNKVGEAREVLTEAVKIPGPLQAMSQDLLNKVNAARAKGK |
| Ga0210401_108457481 | 3300020583 | Soil | YADAKLSRVNEARDTLMEAAKIPSPVQPLSQDLLAKVNAARAKGK |
| Ga0215015_102072131 | 3300021046 | Soil | ETELTEAREVLTEAVKIQSPWQKISEDLLGKVNAARAKGK |
| Ga0210406_102893253 | 3300021168 | Soil | NRVTEARDALNEAVRISGPAQQPAQDLLAKVNAARAKGK |
| Ga0210406_112499272 | 3300021168 | Soil | TEAREVLSEAVKIPGPLQAMSQDLLTKVNAARAKGK |
| Ga0210405_108241671 | 3300021171 | Soil | LPRLNEARDTLMEAAKIPSPVQPLSQDLLAKVNAARAKGK |
| Ga0210408_109077391 | 3300021178 | Soil | YRLGYAYAKLSRTSEAREVLTEAVKIPGPLQAMSQDLLTKVNAARAKGK |
| Ga0210393_114280742 | 3300021401 | Soil | GLGFAYGKLNKLTEAREVLTEAVKIPGPLQSMSQDLLTKVNAARAKGR |
| Ga0210393_115714232 | 3300021401 | Soil | LSKVSEAREVLTEVVKIPGPVQQLAKDLLLKVNAARAKGN |
| Ga0210389_115141352 | 3300021404 | Soil | KLSRVNEAREVLLEAVKISGPVQGMSQDLLNKVNAARAKGK |
| Ga0210387_100433534 | 3300021405 | Soil | TEARDVLTEAVKLPGPMQAMSQDLLTKVNAARAKGK |
| Ga0210387_109025481 | 3300021405 | Soil | VNEAREVLLEAVKISGPVQGMSQDLLNKVNAARAKGK |
| Ga0210386_100229815 | 3300021406 | Soil | AYAKLSRTTEARDVLNEAVKIQGPLQQPSRELLEKVNSARAKGK |
| Ga0210386_101581161 | 3300021406 | Soil | KVSEAREVLQEAVKISGPVQQPAQDLLAKVNAARAKGR |
| Ga0210383_101243773 | 3300021407 | Soil | TEARDVLSEAVKIQSPWQKISEDLLGKGNAARAKGK |
| Ga0210383_101499641 | 3300021407 | Soil | LGFAYGKLNKLTEAREVLTEAVKIQGPLQAMSQDLLAKVNSARAKGK |
| Ga0210383_102881681 | 3300021407 | Soil | AKLMRNTEARDVLMEAVKIPGPVQSMSQDLLNKVNAARAKGK |
| Ga0210394_100345725 | 3300021420 | Soil | GYAYAKLNKVSEAREVLTEVVKIAGPVQQPAKDLLLKVNAARAKGN |
| Ga0210384_107736052 | 3300021432 | Soil | GYAYGKLSRLTEARDVLTEAVKIQSPWQKISEDLLTKVNAARAKGK |
| Ga0210384_109320651 | 3300021432 | Soil | SRTTEARDALTEAARTPGPVQALSQDLLTKVNAARAKGK |
| Ga0210391_100291994 | 3300021433 | Soil | MGFAYGKLNKLTDAREVLTEAVKIPGPLQAMSQDLLTKVNGARAKGQ |
| Ga0210390_106578671 | 3300021474 | Soil | EAREVLTEAVKIQGPMQSMSQELLTKVNAARAKGK |
| Ga0210392_109183601 | 3300021475 | Soil | FAYAKLNRTTEAREVLQEAVRISGPVQQPAQDLLAKVNAARAKGK |
| Ga0210398_106374621 | 3300021477 | Soil | NKLTEAREVLTEAVKIPGPMQAMTQELLTKVNSARAKGQ |
| Ga0210398_113590231 | 3300021477 | Soil | YAKLNQVTEARDVLTEAVRIPGPVQAMSQDLLTKVNAARAKGR |
| Ga0210402_109676341 | 3300021478 | Soil | GLGFAYGKLNKLTEAREVLTEAVKMQSPWQAMSQDLLTKVNAARAKGK |
| Ga0210410_113698161 | 3300021479 | Soil | YRLGFVYAKLSKVSEARDVLAEAVKIQGPVQAMSQDLLTKVNAARAKGK |
| Ga0210410_115301941 | 3300021479 | Soil | AYAKLSKTTEAREVLQEAVKISGPMQQPSQDLLAKVNAARAKGK |
| Ga0210409_104584721 | 3300021559 | Soil | AKLSRTSEAREVLTEAVKIQGPMQAMSQELLTKVNAARAKGK |
| Ga0126371_111612032 | 3300021560 | Tropical Forest Soil | ALYRLGFAYAKLNRVTDARLVLTEAVKIPGPLQQPSQELLGKVNAARAKGR |
| Ga0126371_123197111 | 3300021560 | Tropical Forest Soil | NTEAREVLTEAAKIPGPMQAVSQDLLTKVNAARAQGK |
| Ga0213851_11237861 | 3300021860 | Watersheds | TTEAREVLTEAVKIQGPMQSMTQELLTKVNAARAKGK |
| Ga0242664_10619862 | 3300022527 | Soil | RAMYGLGFAYAKLNKLTEARDVLTDVSKMPGPLQAMSQDLLTKVNTARAKGQ |
| Ga0242660_10527751 | 3300022531 | Soil | KLNKLTEAREVLTEAVKIQGPMQSMSQDLLTKVNAARAKGK |
| Ga0212123_109193871 | 3300022557 | Iron-Sulfur Acid Spring | LMRNTEARDVLMEAVKIPGPVQSMSQDLLNKVNAARAKGK |
| Ga0242661_10091961 | 3300022717 | Soil | FAYGKLNKLTEAREVLTEAVKIQGPMQSMSQELLTKVNAARAKGK |
| Ga0242661_10551132 | 3300022717 | Soil | GKLNKLTEAREVLTEVVKMQSPWQAMSQDLLTKVNAARAKGK |
| Ga0242657_10190414 | 3300022722 | Soil | LGFAYGKLNKLTEAREVLTEAVKMQSPWQAMSQDLLAKVNAARAKGK |
| Ga0242654_102521942 | 3300022726 | Soil | YAKLNKLTEAREVLTEVVKMPGPLQAMSQDLLTKVNAARAKGK |
| Ga0242654_102909502 | 3300022726 | Soil | LGFAYGKLNKLTEAREVLTEAVKIQGPMQSMSQDLLTKVNAARAKGK |
| Ga0247668_10729582 | 3300024331 | Soil | EAREVLTEAVKIQGPLQSMSQDLLAKVNSARAKGR |
| Ga0208936_10004375 | 3300025404 | Peatland | AYGKLNKLTEARDVLTEAVKISSPWQKVSQDLLAKVNAARAKGK |
| Ga0208194_10004126 | 3300025412 | Peatland | GFAYAKLNKASEAHDVLTEAVKIPGPMQAMSQDLLTKVNAARPKGK |
| Ga0207699_103427922 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | AYAKLNRVSEARDALTEAAKIPGPVQPLSQDLLAKVNAARAKGK |
| Ga0207645_104624971 | 3300025907 | Miscanthus Rhizosphere | KVSDARDVLEQAVKIEGPVQQPAQELLTKVNAARAKAK |
| Ga0207661_103997594 | 3300025944 | Corn Rhizosphere | TNKVSDARDVLEQAVKIEGPVQQPAQELLTKVNAARAKAK |
| Ga0208778_10150331 | 3300026025 | Rice Paddy Soil | FAYGKLNKLTEAREVLTEAVKIPGPLQAMSQDLLTKVNSARAKGK |
| Ga0207703_105779131 | 3300026035 | Switchgrass Rhizosphere | LGYAYAKLSHNTEARDALMAAAKIPGPVQPLSQDLLAKVNAARAKGK |
| Ga0207675_1015935421 | 3300026118 | Switchgrass Rhizosphere | YAKTNKVSDARDVLEQAVKIEGPVQQPAQELLTKVNAARAKAK |
| Ga0209890_102159912 | 3300026291 | Soil | LNKLTEAREVLTEVEKIQGPFQAMSQDLLTKVNTARAKGK |
| Ga0209761_10632111 | 3300026313 | Grasslands Soil | RLGYAYAKLNHVDEARNVLNEAVQIPGPVQQPSRDLLAKVNSARARGK |
| Ga0209155_12345122 | 3300026316 | Soil | EARDALTEAAKIPGSVQPLSQDLLTKVNAARAKAK |
| Ga0209154_11557412 | 3300026317 | Soil | SKVTEARDVLNEASRISGPAQQPAKELLVKVNAARAKGR |
| Ga0209471_12873382 | 3300026318 | Soil | STALYRLGYAYAKLNKLSEAREVLTEASNTPGPAQQLSRDLLLKVNTARSKGK |
| Ga0209802_10641091 | 3300026328 | Soil | KVTEARDVLNEASRISGPAQQPAKELLVKVNAARAKGR |
| Ga0257149_10393281 | 3300026355 | Soil | YRLGFAYAKLNRVTEARDILNEASRIPGPMQAMSQDLLAKVNAARAKGNTGR |
| Ga0209157_10535813 | 3300026537 | Soil | KVTEARDALTEAVKIPGPVQQPSQDLLAKVNAARAKGR |
| Ga0209648_108374581 | 3300026551 | Grasslands Soil | YGKLNKLTEARDVLTEAVKIQSPWQKISEDLLGKVNAARAKGK |
| Ga0209577_107990361 | 3300026552 | Soil | MNKVSEAREVLTEAAKIQGPVQKPVQDLLAKVNAARAKGK |
| Ga0179587_100909734 | 3300026557 | Vadose Zone Soil | NRVNDAREVLTEAVKISGPVQGMSQDLLAKVNAARAKGK |
| Ga0179587_107997251 | 3300026557 | Vadose Zone Soil | LNRVNDAREVLTEAVKISGPVQGMSQDLLAKVNAARAKGK |
| Ga0207759_1154962 | 3300026823 | Tropical Forest Soil | ALYGLGFAYGKLNKLTEAREVLTEAVKIQGPMQGMSQDLLAKVNQARAKGK |
| Ga0207776_10122073 | 3300027035 | Tropical Forest Soil | YGLGFAYGKLNKLTEAREVLTEAVKIQSPWQAMTQDLLTKVNSARAKGK |
| Ga0207761_10337151 | 3300027516 | Tropical Forest Soil | EAREVLTEAVKIQGPMQGMSQDLLAKVNQARAKGK |
| Ga0209905_10504091 | 3300027634 | Thawing Permafrost | MYRLGFAYAKLNKVPEAREVLQEAVKISGPVQQPAQDLLTKVNAARAKGK |
| Ga0208827_11511982 | 3300027641 | Peatlands Soil | MYRLGFAYAKLNKVSEAREVLQEAVKISGPVQQPAQDLLAKVNAARAKGK |
| Ga0209420_11869721 | 3300027648 | Forest Soil | VLYRLGFAYAKLAKTTEARDVLTEAVKIQGPMQSMSQELLAKVNAARAKGK |
| Ga0209007_10319431 | 3300027652 | Forest Soil | LGFAYGKLNKLTEAREVLTEAVKIPGPLQPMSQDLLAKVNSARAKGK |
| Ga0209333_11635872 | 3300027676 | Forest Soil | RLGFAYAKLSRVNEARDVLTEAVKIPGPVQAMSQDLLSKVNAARAKAK |
| Ga0208991_12515761 | 3300027681 | Forest Soil | GFAYAKLNKTTEARDVLNEATKIPGPMQALSQDLLAKVNAARAKGNTGR |
| Ga0209580_102693972 | 3300027842 | Surface Soil | GLGFAYGKLNKLTEAREVLTEAVKIPGPLQAMSQDLLTKVNSARAKGK |
| Ga0209580_103367251 | 3300027842 | Surface Soil | TEAREVLTEAVKIPGPLQAMSQELLTKVNSARAKGK |
| Ga0209274_101102673 | 3300027853 | Soil | RVNEARDVLMEAVKISGPVQAMSQDLLNKVNAARAKGK |
| Ga0209517_101189441 | 3300027854 | Peatlands Soil | FAYAKLNKVSEAREVLQEAVKISGPVQQPAQDLLAKVNAARAKGK |
| Ga0209693_104033271 | 3300027855 | Soil | YGKLNKLTEAREVLTEAVKIPGPLQAMTQELLTKVNSARAKGQ |
| Ga0209166_105402601 | 3300027857 | Surface Soil | ALYGLGFAYGKLNKLTEAREVLTEAVKIQGPLQAMSQDLLTKVNTARAKGK |
| Ga0209701_101074523 | 3300027862 | Vadose Zone Soil | LGYAYAKLNRVEEARNVLNEAVQIAGPVQQPSRDLLGKVNTARAKGK |
| Ga0209167_101364523 | 3300027867 | Surface Soil | LSRNSEARDVLTEAVKIPGPVQSMSQDLLNKVNAARAKGK |
| Ga0209167_101857611 | 3300027867 | Surface Soil | YRLGFAYAKLNKVSDAREVLIEAVKIPGPLQVMSQDLLTKVNAARAKGK |
| Ga0209275_100746753 | 3300027884 | Soil | EAREVLTEAVKIPGPLQAMTQELLTKVNSARAKGQ |
| Ga0209275_107189212 | 3300027884 | Soil | AKVSKTTEAREVLQEAVKISGPMQQPSQDLLAKVNAARAKGK |
| Ga0209067_109150071 | 3300027898 | Watersheds | LNKLTEARDVLTEVSKMPGPLQAMSQDLLTKVNLARAKGK |
| Ga0209415_106819762 | 3300027905 | Peatlands Soil | NKLTEAREVLTEAVKIPGPLQAMSQELLTKVNAARAKGN |
| Ga0209006_100441384 | 3300027908 | Forest Soil | LYGLGFAYGKLNKLTEARDVLTEAVKIPGPLQPMSQDLLAKVNSARAKGK |
| Ga0209006_101267633 | 3300027908 | Forest Soil | EARDTLMEAAKIPSPVQPLSQDLLAKVNAARAKGK |
| Ga0209006_108046171 | 3300027908 | Forest Soil | YGLGFAYAKLGKLTEAREVLTEAVRIPGPLQSMSQDLLAKVNVARAKGK |
| Ga0209006_108858821 | 3300027908 | Forest Soil | AYGKLNKLTEAREVVTEAVKIPGPLQPMSQDLLAKVNSARAKGK |
| Ga0209698_102866233 | 3300027911 | Watersheds | AMYRLGFAYAKLSRTTEAREVLTEAVKIQGPMQSMTQELLTKVNAARAKGK |
| Ga0209168_101386822 | 3300027986 | Surface Soil | LGFAYAKLNKVSEAREVLQEVVKISGPVQQPAQDLLAKVNAARAKGK |
| Ga0265356_10093663 | 3300028017 | Rhizosphere | VYAKLNRVSESRDVLTEAVKISGPVQSMSQDLLTKVNAARAKGK |
| Ga0302301_10438231 | 3300028731 | Palsa | KIGEAREVLTEAVKIAGPVQAMSQDLLTKVNAARAKGK |
| Ga0307312_107790392 | 3300028828 | Soil | TLIEAVKIAGPVQKPAQDLLTKVNAARSKGTVAQAR |
| Ga0307312_111176831 | 3300028828 | Soil | YAKLNRVTEARDVLTEASRISGPAQQPAKDLLVKVNAARSKGR |
| Ga0302218_100794423 | 3300028863 | Palsa | NKLTEARDVLTEAVKISSPWQKVSQDLLAKVNAARAKGK |
| Ga0307277_101820241 | 3300028881 | Soil | EARDVLTEAVKIAGPVQKPAQELLTKVNAARAKGTVAQAR |
| Ga0308309_101764151 | 3300028906 | Soil | RLGYAYAKLSRTTEAREVLLEVVKISGPVQQPAQDLLAKVNAARSKGK |
| Ga0308309_111585241 | 3300028906 | Soil | LGFAYAKLNKVSEAREVLTEVVKIAGPVQEPAKDLLLKVNAARSKGN |
| Ga0311368_101173421 | 3300029882 | Palsa | LSKENEAREVLTEAVKISGPVQAMSQDLLAKVNAARAKGK |
| Ga0311341_102050071 | 3300029908 | Bog | SKLTEARDVLGEGAGIKSPWQQISQDLLVKVNAARAKGK |
| Ga0311340_106052691 | 3300029943 | Palsa | YAKLNKLTEAREVLSEAVKIPGPLQGMSQDLLTKVNVARAKGK |
| Ga0311343_104441333 | 3300029953 | Bog | AYAKLNKATEAHDVLTEAVKIPGPMQAMSQDLLTKVNAARPKGK |
| Ga0311338_110029512 | 3300030007 | Palsa | YAKLSKTTEAREVLTEAVKIQGPMQAMSQDLLAKVNAARAKGK |
| Ga0311338_114872701 | 3300030007 | Palsa | KLTEAREVLTEAVKIPGPLQPMSKDLLTKVNTARASGK |
| Ga0311344_111222581 | 3300030020 | Bog | NKASEAHDVLTEAVKIPGPMQAMSQDLLTKVNAARPKGK |
| Ga0302176_102653491 | 3300030057 | Palsa | IRNTEARDVLMEAVKIPGPVQSMSQDLLNKVNAARAKGK |
| Ga0311370_116093441 | 3300030503 | Palsa | YAKLSRVSEAREVLTEAVKIPGPVQAMSQDLLSKVNAARAKAK |
| Ga0302183_102936122 | 3300030509 | Palsa | GKLNKLTEAREVLTEAVKIPGPLQAMSQELLKKVNSARASGK |
| Ga0311372_119519401 | 3300030520 | Palsa | KVNEAREVLTEAVKISGPVQAMSQDLLAKVNAARAKGK |
| Ga0311357_105354293 | 3300030524 | Palsa | SEAREVLVEAVKIPGPVQAMSQDLLTKVNAARAKGK |
| Ga0210271_104535141 | 3300030545 | Soil | KLMRNTEARDVLMEAVKIPGPVQSMSQDLLNKVNAARAKGK |
| Ga0311354_115621701 | 3300030618 | Palsa | SEARDVLTEAVKIPGPVQAMSQDLLAKVNAARAKGK |
| Ga0265767_1204121 | 3300030836 | Soil | AKLSRNTEARDVLMEGVKIAGPVQSMSQDLLNKVNAARARGK |
| Ga0265760_100360274 | 3300031090 | Soil | ALYRLGYAYAKLMRNTEARDVLMEAVKIPGPVQSMSQDLLNKVNAARAKGK |
| Ga0170824_1039228952 | 3300031231 | Forest Soil | GKLGKLTEAREALSEGVKIQSPWQAMTQDTLTKVNAARAKGK |
| Ga0302325_110317841 | 3300031234 | Palsa | KLRRINEARDILMEAVKIQGPVQPLSQDLLTKVNAARASGK |
| Ga0302325_114898161 | 3300031234 | Palsa | LGFAYAKLSRVNEARDVLTEAVKIPGPVQAMSQDLLSKVNAARAKAK |
| Ga0318574_104840573 | 3300031680 | Soil | LNKVTEAREVLSEVVKMPGPVQQPAQDLLAKVNAARAKEK |
| Ga0310686_1076286082 | 3300031708 | Soil | FAYAKLNKVGEAREVLTEAVKIPGPLQAMSQDLLTKVNAARAKGK |
| Ga0310686_1168289233 | 3300031708 | Soil | TEARDVLTEAVKIPGPVQAMSQDLLMKVNAARAKGK |
| Ga0307476_105356992 | 3300031715 | Hardwood Forest Soil | YAYAKLNKVTEAREVLNEIVKTPGPVQQPAQDLLAKVNAARAKGK |
| Ga0307476_105958291 | 3300031715 | Hardwood Forest Soil | NKTAEARDVLTEAVKIQGPLQSMSQDLLTKVNAARAKGK |
| Ga0307469_107176351 | 3300031720 | Hardwood Forest Soil | ALAAFRLGFAYGKLNKLAEAREVLNEAVKIPGPVQQPAQELLSKVNSAKPKAR |
| Ga0307469_115467952 | 3300031720 | Hardwood Forest Soil | LYRLGYAYAKLNRVSEARDVLMEAAKIPGSVQAPSQDLLSKVNAARAKGK |
| Ga0307475_108302752 | 3300031754 | Hardwood Forest Soil | LNRVNEARDVLTEAAKIPGPVQPMSQDLLAKVNAARAKGK |
| Ga0307478_101099763 | 3300031823 | Hardwood Forest Soil | RLGFAYAKLNKVSEARDVLQEAVKISGPVQQPAQDLLAKVNAARAKGR |
| Ga0307478_105568911 | 3300031823 | Hardwood Forest Soil | KLNKVTEARDVLMEATKIPGPMQALSQDLLIKVNAARAKGNAGR |
| Ga0306919_107257341 | 3300031879 | Soil | GFAYAKLNKVDDARTVLMEVVKMDTPLQQPSKDLLAKVNTARAKGK |
| Ga0306919_113418222 | 3300031879 | Soil | AKLNRTAEAKEVLAEAVKIPGPLQQPSQDLLQKVAAARPRK |
| Ga0306923_103358893 | 3300031910 | Soil | GFAYAKLNKLTDARDVLTEAVKISGPLQSMSQELLTKVNTARAKAK |
| Ga0306921_119219451 | 3300031912 | Soil | KLNKLTEAREVLTEAAKIQGPMQSMSQELLAKVNQARAKGK |
| Ga0308175_1008983511 | 3300031938 | Soil | LYGLGFAYGKLNKLTEAREVLTEAVKIPGPLQAMTQDLLTKVNSARAKGK |
| Ga0308175_1027757561 | 3300031938 | Soil | MTEAREVLAEAVKISGPVQEPAQELLVKVNAIKTKKK |
| Ga0308175_1030316691 | 3300031938 | Soil | GLGFAYGKLNKLTEAREVLTEAVKIPGPFQVMSQDLLTKVNSARAKGR |
| Ga0310913_111608542 | 3300031945 | Soil | LYGLGFAYGKLNKLTEAREVLTEAAKIQGPMQSMSQELLAKVNQARAKGK |
| Ga0311301_104779273 | 3300032160 | Peatlands Soil | LGFAYAKLNKVSEAREVLQEAVKISGPVQQPAQDLLAKVNAARAKGK |
| Ga0307470_101071983 | 3300032174 | Hardwood Forest Soil | NKLTEAREVLTEAVKIQGPMQSMSQDLLTKVNAARAKGK |
| Ga0307470_101369893 | 3300032174 | Hardwood Forest Soil | YAYAKVNKTTDAREVLSEAVKLQGPLQQPSRELLEKVNSARAKGK |
| Ga0307472_1007758882 | 3300032205 | Hardwood Forest Soil | ISRVNEAREVLMEAVKIPGPVQPLSQDLLAKVNAARAKGR |
| Ga0310812_103472761 | 3300032421 | Soil | LGYAYAKTNKVSDARDVLEQAVKIEGPVQQPAQELLTKVNAARAKAK |
| Ga0335079_105920743 | 3300032783 | Soil | AKISKVSEARDVLNEAVKISGPVQGPARELLTKVNAARAQGK |
| Ga0335079_107612751 | 3300032783 | Soil | YGIGFAYAKDNKLSEAREVLTTGSKIPGPMQAMTQDLLLKVNRARAGVK |
| Ga0335080_106478923 | 3300032828 | Soil | AEAKEILNDAVKIQGPAQQPTQDLLTKVNAARARK |
| Ga0335081_105155321 | 3300032892 | Soil | GKLNKLTEAREVLTEAVKIQGPMQAMSQDLLAKVNQARAKGR |
| Ga0335074_108733001 | 3300032895 | Soil | KLTEAREVLTEAVKIQGPVQSMSQQLLAKVNAARAKGK |
| Ga0335075_102840221 | 3300032896 | Soil | ALYRLGFAYAKLSKTTEAREVLTEAVKIQGPVQAMSRDLLAKVNAARAKGK |
| Ga0335072_113978872 | 3300032898 | Soil | DKLTDAREVLTEAVKIPGPLQSMSQDLLAKVNSARAKGR |
| Ga0335076_116529662 | 3300032955 | Soil | KVTEAREVLMEVVKVPGPVQPLAQDLLTKVNAARAKGK |
| Ga0335077_101512463 | 3300033158 | Soil | ARALYGLGFAYGKLNKLSEARDVLTEAVKIPGPMQAMSQDLLTKVNGARAKGK |
| Ga0314867_013688_968_1126 | 3300033808 | Peatland | VAGYRLGFAYAKLNRVSEARDVLTEVVKIQGPVQQPAQDLLTKVNAARAKGK |
| Ga0334804_144101_2_130 | 3300033818 | Soil | AKLNKATEAHDVLTEAVKIPGPMQAMSQDLLTKVNAARPKGK |
| Ga0334854_104603_2_142 | 3300033829 | Soil | GFAYAKLSRVNEARDVLLEAVKISGPVQAMSQDLLAKVNAARAKGK |
| ⦗Top⦘ |