| Basic Information | |
|---|---|
| Family ID | F011691 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 288 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MLELSDIQSSQEELQDYYAQLRAQHVTPAWIGGGISIEPQSK |
| Number of Associated Samples | 227 |
| Number of Associated Scaffolds | 288 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.65 % |
| % of genes near scaffold ends (potentially truncated) | 96.53 % |
| % of genes from short scaffolds (< 2000 bps) | 95.49 % |
| Associated GOLD sequencing projects | 219 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.319 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.125 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.875 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.181 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.57% β-sheet: 0.00% Coil/Unstructured: 81.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 288 Family Scaffolds |
|---|---|---|
| PF00296 | Bac_luciferase | 24.31 |
| PF00903 | Glyoxalase | 5.90 |
| PF01425 | Amidase | 3.12 |
| PF00496 | SBP_bac_5 | 2.78 |
| PF07883 | Cupin_2 | 2.08 |
| PF07690 | MFS_1 | 1.74 |
| PF00857 | Isochorismatase | 1.39 |
| PF14226 | DIOX_N | 1.04 |
| PF00848 | Ring_hydroxyl_A | 1.04 |
| PF03466 | LysR_substrate | 0.69 |
| PF03928 | HbpS-like | 0.69 |
| PF01266 | DAO | 0.69 |
| PF06983 | 3-dmu-9_3-mt | 0.69 |
| PF02653 | BPD_transp_2 | 0.35 |
| PF03972 | MmgE_PrpD | 0.35 |
| PF02738 | MoCoBD_1 | 0.35 |
| PF11794 | HpaB_N | 0.35 |
| PF00248 | Aldo_ket_red | 0.35 |
| PF00355 | Rieske | 0.35 |
| PF00589 | Phage_integrase | 0.35 |
| PF00890 | FAD_binding_2 | 0.35 |
| PF00012 | HSP70 | 0.35 |
| PF05088 | Bac_GDH | 0.35 |
| PF02371 | Transposase_20 | 0.35 |
| PF01494 | FAD_binding_3 | 0.35 |
| PF07992 | Pyr_redox_2 | 0.35 |
| PF01593 | Amino_oxidase | 0.35 |
| PF03824 | NicO | 0.35 |
| PF01223 | Endonuclease_NS | 0.35 |
| PF13474 | SnoaL_3 | 0.35 |
| PF01724 | DUF29 | 0.35 |
| PF13410 | GST_C_2 | 0.35 |
| PF04392 | ABC_sub_bind | 0.35 |
| PF00106 | adh_short | 0.35 |
| PF03401 | TctC | 0.35 |
| COG ID | Name | Functional Category | % Frequency in 288 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 24.31 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 3.12 |
| COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 2.08 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 1.39 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.39 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.69 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.69 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.69 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.35 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.35 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.35 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.35 |
| COG2902 | NAD-specific glutamate dehydrogenase | Amino acid transport and metabolism [E] | 0.35 |
| COG1864 | DNA/RNA endonuclease G, NUC1 | Nucleotide transport and metabolism [F] | 0.35 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.35 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.35 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.35 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.35 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.32 % |
| Unclassified | root | N/A | 33.68 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001545|JGI12630J15595_10073266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 674 | Open in IMG/M |
| 3300003993|Ga0055468_10145019 | Not Available | 703 | Open in IMG/M |
| 3300004633|Ga0066395_10406136 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300004643|Ga0062591_102097153 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300005167|Ga0066672_10310821 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300005167|Ga0066672_10702216 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300005179|Ga0066684_11085386 | Not Available | 513 | Open in IMG/M |
| 3300005184|Ga0066671_10160105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1321 | Open in IMG/M |
| 3300005184|Ga0066671_10677736 | Not Available | 668 | Open in IMG/M |
| 3300005184|Ga0066671_11052860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces griseolus | 510 | Open in IMG/M |
| 3300005186|Ga0066676_10571720 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300005364|Ga0070673_101593865 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005406|Ga0070703_10598399 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300005445|Ga0070708_100533478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1107 | Open in IMG/M |
| 3300005446|Ga0066686_10253548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1188 | Open in IMG/M |
| 3300005446|Ga0066686_10304836 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1082 | Open in IMG/M |
| 3300005540|Ga0066697_10299056 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300005541|Ga0070733_10517285 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300005542|Ga0070732_10293785 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300005549|Ga0070704_100485920 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1069 | Open in IMG/M |
| 3300005552|Ga0066701_10454822 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300005552|Ga0066701_10934952 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300005557|Ga0066704_10913257 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300005559|Ga0066700_10863862 | Not Available | 604 | Open in IMG/M |
| 3300005566|Ga0066693_10143310 | Not Available | 893 | Open in IMG/M |
| 3300005569|Ga0066705_10692923 | Not Available | 615 | Open in IMG/M |
| 3300005577|Ga0068857_101502021 | Not Available | 656 | Open in IMG/M |
| 3300005587|Ga0066654_10154460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1168 | Open in IMG/M |
| 3300005598|Ga0066706_11543115 | Not Available | 500 | Open in IMG/M |
| 3300005713|Ga0066905_101939141 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300005764|Ga0066903_101192225 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
| 3300005764|Ga0066903_107425001 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300005841|Ga0068863_100437674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1282 | Open in IMG/M |
| 3300005903|Ga0075279_10030564 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300005981|Ga0081538_10315200 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300006031|Ga0066651_10607542 | Not Available | 582 | Open in IMG/M |
| 3300006032|Ga0066696_10846200 | Not Available | 583 | Open in IMG/M |
| 3300006049|Ga0075417_10538579 | Not Available | 589 | Open in IMG/M |
| 3300006173|Ga0070716_101799580 | Not Available | 507 | Open in IMG/M |
| 3300006796|Ga0066665_11448900 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300006806|Ga0079220_12014916 | Not Available | 515 | Open in IMG/M |
| 3300006844|Ga0075428_100145359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2577 | Open in IMG/M |
| 3300006844|Ga0075428_100381786 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
| 3300006844|Ga0075428_100831632 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300006844|Ga0075428_100848296 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 970 | Open in IMG/M |
| 3300006845|Ga0075421_100922109 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300006846|Ga0075430_100186035 | All Organisms → cellular organisms → Bacteria | 1727 | Open in IMG/M |
| 3300006852|Ga0075433_11955965 | Not Available | 503 | Open in IMG/M |
| 3300006854|Ga0075425_102854669 | Not Available | 531 | Open in IMG/M |
| 3300006871|Ga0075434_102187250 | Not Available | 557 | Open in IMG/M |
| 3300006954|Ga0079219_11429696 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300006954|Ga0079219_12094896 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300007004|Ga0079218_10971047 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300007788|Ga0099795_10151469 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300007788|Ga0099795_10193495 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300009012|Ga0066710_104569710 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300009038|Ga0099829_11184952 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300009090|Ga0099827_10603539 | Not Available | 946 | Open in IMG/M |
| 3300009090|Ga0099827_10892809 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300009090|Ga0099827_11467135 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300009090|Ga0099827_11726298 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 545 | Open in IMG/M |
| 3300009101|Ga0105247_11591131 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300009137|Ga0066709_100477520 | All Organisms → cellular organisms → Bacteria | 1750 | Open in IMG/M |
| 3300009137|Ga0066709_101349817 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1041 | Open in IMG/M |
| 3300009143|Ga0099792_10957550 | Not Available | 569 | Open in IMG/M |
| 3300009147|Ga0114129_10090797 | All Organisms → cellular organisms → Bacteria | 4233 | Open in IMG/M |
| 3300009147|Ga0114129_11183187 | Not Available | 953 | Open in IMG/M |
| 3300009147|Ga0114129_11444518 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300009156|Ga0111538_11445956 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300009162|Ga0075423_11831153 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 655 | Open in IMG/M |
| 3300009162|Ga0075423_12045949 | Not Available | 620 | Open in IMG/M |
| 3300009777|Ga0105164_10333841 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300009822|Ga0105066_1160187 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300009837|Ga0105058_1057991 | Not Available | 874 | Open in IMG/M |
| 3300010043|Ga0126380_10875445 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300010044|Ga0126310_11501392 | Not Available | 553 | Open in IMG/M |
| 3300010047|Ga0126382_12150928 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300010047|Ga0126382_12207932 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 530 | Open in IMG/M |
| 3300010048|Ga0126373_10098687 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2697 | Open in IMG/M |
| 3300010048|Ga0126373_13208638 | Not Available | 509 | Open in IMG/M |
| 3300010152|Ga0126318_10173269 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300010159|Ga0099796_10277129 | Not Available | 704 | Open in IMG/M |
| 3300010304|Ga0134088_10058762 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1774 | Open in IMG/M |
| 3300010320|Ga0134109_10266791 | Not Available | 650 | Open in IMG/M |
| 3300010326|Ga0134065_10386083 | Not Available | 559 | Open in IMG/M |
| 3300010337|Ga0134062_10337029 | Not Available | 723 | Open in IMG/M |
| 3300010360|Ga0126372_10340058 | Not Available | 1341 | Open in IMG/M |
| 3300010360|Ga0126372_10889166 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300010361|Ga0126378_13296186 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300010362|Ga0126377_10232063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1786 | Open in IMG/M |
| 3300010366|Ga0126379_10504178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1282 | Open in IMG/M |
| 3300010366|Ga0126379_12825216 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300010376|Ga0126381_102709259 | Not Available | 708 | Open in IMG/M |
| 3300010376|Ga0126381_103138686 | Not Available | 654 | Open in IMG/M |
| 3300010376|Ga0126381_104862871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300010397|Ga0134124_13178933 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300010398|Ga0126383_10116204 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2427 | Open in IMG/M |
| 3300010398|Ga0126383_10613682 | Not Available | 1160 | Open in IMG/M |
| 3300010398|Ga0126383_11772161 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300010400|Ga0134122_10186823 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1710 | Open in IMG/M |
| 3300010937|Ga0137776_1755625 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
| 3300011269|Ga0137392_10145345 | All Organisms → cellular organisms → Bacteria | 1910 | Open in IMG/M |
| 3300012096|Ga0137389_10679159 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300012096|Ga0137389_11076301 | Not Available | 689 | Open in IMG/M |
| 3300012206|Ga0137380_10953811 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300012206|Ga0137380_11549377 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300012207|Ga0137381_10818916 | Not Available | 807 | Open in IMG/M |
| 3300012207|Ga0137381_11189942 | Not Available | 655 | Open in IMG/M |
| 3300012208|Ga0137376_11048869 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300012211|Ga0137377_11322179 | Not Available | 651 | Open in IMG/M |
| 3300012211|Ga0137377_11561491 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300012211|Ga0137377_11698806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 553 | Open in IMG/M |
| 3300012351|Ga0137386_10481096 | Not Available | 894 | Open in IMG/M |
| 3300012351|Ga0137386_10631722 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300012363|Ga0137390_11412496 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300012399|Ga0134061_1069589 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300012469|Ga0150984_115486787 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300012532|Ga0137373_10169048 | Not Available | 1828 | Open in IMG/M |
| 3300012582|Ga0137358_11078220 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300012683|Ga0137398_10372834 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300012924|Ga0137413_10417263 | Not Available | 969 | Open in IMG/M |
| 3300012925|Ga0137419_10577101 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300012930|Ga0137407_10893334 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300012948|Ga0126375_12081226 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300012971|Ga0126369_10193963 | All Organisms → cellular organisms → Bacteria | 1953 | Open in IMG/M |
| 3300012971|Ga0126369_13589799 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300012975|Ga0134110_10542794 | Not Available | 533 | Open in IMG/M |
| 3300012976|Ga0134076_10046734 | Not Available | 1624 | Open in IMG/M |
| 3300014157|Ga0134078_10433166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 597 | Open in IMG/M |
| 3300014968|Ga0157379_10781703 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300014969|Ga0157376_11475754 | Not Available | 713 | Open in IMG/M |
| 3300015356|Ga0134073_10032496 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
| 3300016270|Ga0182036_10561102 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300016294|Ga0182041_10373778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1205 | Open in IMG/M |
| 3300016319|Ga0182033_12218997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300016404|Ga0182037_10542752 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300017654|Ga0134069_1304614 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 565 | Open in IMG/M |
| 3300017942|Ga0187808_10608599 | Not Available | 507 | Open in IMG/M |
| 3300017972|Ga0187781_11104178 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300018001|Ga0187815_10374421 | Not Available | 605 | Open in IMG/M |
| 3300018053|Ga0184626_10122892 | Not Available | 1103 | Open in IMG/M |
| 3300018060|Ga0187765_11009549 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300018077|Ga0184633_10351329 | Not Available | 744 | Open in IMG/M |
| 3300018084|Ga0184629_10636183 | Not Available | 542 | Open in IMG/M |
| 3300018431|Ga0066655_10248564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1134 | Open in IMG/M |
| 3300018433|Ga0066667_10245370 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1353 | Open in IMG/M |
| 3300018433|Ga0066667_11153510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 672 | Open in IMG/M |
| 3300019233|Ga0184645_1277070 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300019249|Ga0184648_1066408 | Not Available | 794 | Open in IMG/M |
| 3300019259|Ga0184646_1451490 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300019888|Ga0193751_1180937 | Not Available | 726 | Open in IMG/M |
| 3300020067|Ga0180109_1422486 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300020581|Ga0210399_10224662 | All Organisms → cellular organisms → Bacteria | 1564 | Open in IMG/M |
| 3300020582|Ga0210395_11162607 | Not Available | 568 | Open in IMG/M |
| 3300020583|Ga0210401_11087506 | Not Available | 658 | Open in IMG/M |
| 3300021168|Ga0210406_10442140 | Not Available | 1036 | Open in IMG/M |
| 3300021168|Ga0210406_10491576 | Not Available | 971 | Open in IMG/M |
| 3300021171|Ga0210405_10353627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1159 | Open in IMG/M |
| 3300021171|Ga0210405_10437533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1028 | Open in IMG/M |
| 3300021178|Ga0210408_10709586 | Not Available | 792 | Open in IMG/M |
| 3300021178|Ga0210408_10935661 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300021307|Ga0179585_1196480 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300021402|Ga0210385_10031653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 3427 | Open in IMG/M |
| 3300021405|Ga0210387_10390618 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300021406|Ga0210386_11750129 | Not Available | 512 | Open in IMG/M |
| 3300021420|Ga0210394_11819694 | Not Available | 507 | Open in IMG/M |
| 3300021432|Ga0210384_10811680 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300021432|Ga0210384_11607559 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 555 | Open in IMG/M |
| 3300021433|Ga0210391_10804059 | Not Available | 735 | Open in IMG/M |
| 3300021474|Ga0210390_11064397 | Not Available | 658 | Open in IMG/M |
| 3300021479|Ga0210410_10974274 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300021559|Ga0210409_10166902 | All Organisms → cellular organisms → Bacteria | 2013 | Open in IMG/M |
| 3300021560|Ga0126371_10348242 | All Organisms → cellular organisms → Bacteria | 1616 | Open in IMG/M |
| 3300021560|Ga0126371_11624188 | Not Available | 772 | Open in IMG/M |
| 3300021560|Ga0126371_12548337 | Not Available | 619 | Open in IMG/M |
| 3300022195|Ga0222625_1092951 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300022525|Ga0242656_1007836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1356 | Open in IMG/M |
| 3300022527|Ga0242664_1016678 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300022533|Ga0242662_10230645 | Not Available | 594 | Open in IMG/M |
| 3300022726|Ga0242654_10128228 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300025900|Ga0207710_10740607 | Not Available | 516 | Open in IMG/M |
| 3300025928|Ga0207700_10763190 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300025938|Ga0207704_11956645 | Not Available | 504 | Open in IMG/M |
| 3300025944|Ga0207661_10908367 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300025961|Ga0207712_11878914 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300026296|Ga0209235_1143050 | Not Available | 966 | Open in IMG/M |
| 3300026312|Ga0209153_1136025 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 928 | Open in IMG/M |
| 3300026312|Ga0209153_1242823 | Not Available | 584 | Open in IMG/M |
| 3300026316|Ga0209155_1217245 | Not Available | 597 | Open in IMG/M |
| 3300026325|Ga0209152_10151008 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300026377|Ga0257171_1086212 | Not Available | 554 | Open in IMG/M |
| 3300026528|Ga0209378_1256258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| 3300026529|Ga0209806_1138876 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300026547|Ga0209156_10235678 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300026550|Ga0209474_10023524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4720 | Open in IMG/M |
| 3300026550|Ga0209474_10365480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 790 | Open in IMG/M |
| 3300027330|Ga0207777_1093297 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300027698|Ga0209446_1073367 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300027767|Ga0209655_10194124 | Not Available | 668 | Open in IMG/M |
| 3300027768|Ga0209772_10078875 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300027815|Ga0209726_10552023 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300027874|Ga0209465_10402998 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 685 | Open in IMG/M |
| 3300027889|Ga0209380_10260588 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300027909|Ga0209382_11733780 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300027909|Ga0209382_12005159 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300028047|Ga0209526_10173008 | All Organisms → cellular organisms → Bacteria | 1505 | Open in IMG/M |
| 3300028380|Ga0268265_10888526 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300028792|Ga0307504_10305000 | Not Available | 601 | Open in IMG/M |
| 3300029636|Ga0222749_10278599 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300029701|Ga0222748_1101855 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300031092|Ga0308204_10334052 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300031094|Ga0308199_1024906 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300031228|Ga0299914_10371833 | Not Available | 1251 | Open in IMG/M |
| 3300031231|Ga0170824_103929757 | Not Available | 532 | Open in IMG/M |
| 3300031543|Ga0318516_10575392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 644 | Open in IMG/M |
| 3300031545|Ga0318541_10167579 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300031545|Ga0318541_10312573 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300031546|Ga0318538_10048720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2061 | Open in IMG/M |
| 3300031549|Ga0318571_10392735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300031573|Ga0310915_10051550 | All Organisms → cellular organisms → Bacteria | 2657 | Open in IMG/M |
| 3300031668|Ga0318542_10620931 | Not Available | 564 | Open in IMG/M |
| 3300031679|Ga0318561_10798299 | Not Available | 519 | Open in IMG/M |
| 3300031682|Ga0318560_10551951 | Not Available | 624 | Open in IMG/M |
| 3300031682|Ga0318560_10659088 | Not Available | 566 | Open in IMG/M |
| 3300031708|Ga0310686_112250324 | Not Available | 1007 | Open in IMG/M |
| 3300031708|Ga0310686_116780481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1887 | Open in IMG/M |
| 3300031713|Ga0318496_10728474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 547 | Open in IMG/M |
| 3300031720|Ga0307469_11761863 | Not Available | 598 | Open in IMG/M |
| 3300031724|Ga0318500_10316824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 766 | Open in IMG/M |
| 3300031747|Ga0318502_10073922 | All Organisms → cellular organisms → Bacteria | 1845 | Open in IMG/M |
| 3300031747|Ga0318502_10130856 | Not Available | 1417 | Open in IMG/M |
| 3300031763|Ga0318537_10091036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1127 | Open in IMG/M |
| 3300031763|Ga0318537_10152966 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300031765|Ga0318554_10393179 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300031768|Ga0318509_10396451 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300031768|Ga0318509_10680740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 571 | Open in IMG/M |
| 3300031777|Ga0318543_10019410 | All Organisms → cellular organisms → Bacteria | 2521 | Open in IMG/M |
| 3300031777|Ga0318543_10189595 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300031778|Ga0318498_10524798 | Not Available | 520 | Open in IMG/M |
| 3300031782|Ga0318552_10223743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 954 | Open in IMG/M |
| 3300031792|Ga0318529_10043628 | All Organisms → cellular organisms → Bacteria | 1910 | Open in IMG/M |
| 3300031792|Ga0318529_10454096 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300031793|Ga0318548_10114228 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
| 3300031795|Ga0318557_10432933 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300031819|Ga0318568_10759008 | Not Available | 602 | Open in IMG/M |
| 3300031820|Ga0307473_10653043 | Not Available | 733 | Open in IMG/M |
| 3300031821|Ga0318567_10552660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 654 | Open in IMG/M |
| 3300031832|Ga0318499_10256612 | Not Available | 678 | Open in IMG/M |
| 3300031845|Ga0318511_10087669 | Not Available | 1309 | Open in IMG/M |
| 3300031845|Ga0318511_10537243 | Not Available | 542 | Open in IMG/M |
| 3300031880|Ga0318544_10353794 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 571 | Open in IMG/M |
| 3300031893|Ga0318536_10526278 | Not Available | 593 | Open in IMG/M |
| 3300031896|Ga0318551_10914268 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300031912|Ga0306921_10043095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5100 | Open in IMG/M |
| 3300031912|Ga0306921_12025546 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300031912|Ga0306921_12475192 | Not Available | 539 | Open in IMG/M |
| 3300031941|Ga0310912_10176232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1626 | Open in IMG/M |
| 3300031941|Ga0310912_10752875 | Not Available | 754 | Open in IMG/M |
| 3300031946|Ga0310910_10537699 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300031947|Ga0310909_11467481 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300031959|Ga0318530_10115567 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1075 | Open in IMG/M |
| 3300032001|Ga0306922_10512789 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300032039|Ga0318559_10003731 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4941 | Open in IMG/M |
| 3300032043|Ga0318556_10483042 | Not Available | 648 | Open in IMG/M |
| 3300032044|Ga0318558_10147601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1130 | Open in IMG/M |
| 3300032044|Ga0318558_10674112 | Not Available | 517 | Open in IMG/M |
| 3300032052|Ga0318506_10406230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Shewanellaceae → Shewanella → Shewanella yunxiaonensis | 604 | Open in IMG/M |
| 3300032054|Ga0318570_10304904 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300032055|Ga0318575_10373165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 723 | Open in IMG/M |
| 3300032055|Ga0318575_10479553 | Not Available | 631 | Open in IMG/M |
| 3300032064|Ga0318510_10166140 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 878 | Open in IMG/M |
| 3300032065|Ga0318513_10394164 | Not Available | 676 | Open in IMG/M |
| 3300032074|Ga0308173_10735076 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300032089|Ga0318525_10266527 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300032089|Ga0318525_10270301 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300032091|Ga0318577_10004617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5013 | Open in IMG/M |
| 3300032174|Ga0307470_10317055 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300032174|Ga0307470_11180350 | Not Available | 620 | Open in IMG/M |
| 3300032180|Ga0307471_103554320 | Not Available | 552 | Open in IMG/M |
| 3300032205|Ga0307472_101430773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 672 | Open in IMG/M |
| 3300033134|Ga0335073_11582629 | Not Available | 627 | Open in IMG/M |
| 3300033289|Ga0310914_10438678 | Not Available | 1182 | Open in IMG/M |
| 3300033289|Ga0310914_11442730 | Not Available | 591 | Open in IMG/M |
| 3300033513|Ga0316628_103513517 | Not Available | 566 | Open in IMG/M |
| 3300034165|Ga0364942_0215059 | Not Available | 628 | Open in IMG/M |
| 3300034165|Ga0364942_0271620 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300034664|Ga0314786_029410 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300034680|Ga0370541_062642 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.12% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.07% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.99% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.25% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.43% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.43% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.08% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.74% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.39% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.04% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.04% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.04% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.69% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.69% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.69% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.69% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.69% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.35% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.35% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.35% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.35% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.35% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.35% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.35% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.35% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.35% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.35% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.35% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.35% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.35% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.35% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.35% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.35% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005903 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303 | Environmental | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012399 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020067 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
| 3300034664 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034680 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12630J15595_100732662 | 3300001545 | Forest Soil | MLELSDIQSSQEELQDYYAQLGAQHVTPAWIGGGISIEPQSK |
| Ga0055468_101450192 | 3300003993 | Natural And Restored Wetlands | MLQRSSIQASEAELQDFYTQLQAQHVTPAWISGGISTEPVSQAIPYVWHWRDLRPQALRAAEL |
| Ga0066395_104061361 | 3300004633 | Tropical Forest Soil | MKLSDIKSSEAELQDYYALLRSQHITPAWIGGGITREPKSKALPWVWHWRDLR |
| Ga0062591_1020971531 | 3300004643 | Soil | MLQISDIQSSPEELQEYYDRLATQHVTPAWIGGGISTEPQS |
| Ga0066672_103108211 | 3300005167 | Soil | MKLSDIKSSEAELQDYYAQLRSQHITPAWIGGGITREPKSKAVPWVWHWRDLR |
| Ga0066672_107022162 | 3300005167 | Soil | MLQRSNIVSSEEELQKFYEQLQAQHITPAWISGGVSVEPRSLAVPA |
| Ga0066684_110853862 | 3300005179 | Soil | MLELSDIQSSPEELQQYYAELRAQHITPAWIGGGITTEPRSEAV |
| Ga0066671_101601051 | 3300005184 | Soil | MLELSDIQSSKEELEDYYAKLQAQHVTPAWIGGGISVEPR |
| Ga0066671_106777362 | 3300005184 | Soil | MLELSNIQASPEELENYYAELRAQHVTPSWIGGGISIEPRSEAVPFVWHW |
| Ga0066671_110528601 | 3300005184 | Soil | MLQVSDIQSSPEELHQYYAELRAQHITPAWIGGGITTEPRSEAVPFVWHWRDLR |
| Ga0066676_105717202 | 3300005186 | Soil | MLQRSNIVSSEEELQEFYAQLRSQHVTPAWIGGGVSVEPRSKAVPYVWHWRDLRPQA |
| Ga0070673_1015938652 | 3300005364 | Switchgrass Rhizosphere | MLQLSDIQSSQEELQEYYDQLAAQQVTPAWIGGGISVEPQSTAVPYVWHWRDLRP* |
| Ga0070703_105983992 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MLQRSNIVSSEEELQDFYAQLQAQHVTPAWISGGVSVEPRS |
| Ga0070708_1005334782 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MLKLSDIKSSEEDLQDYYAQLRSQHVAPAWIGGGISLEPKSKAVPHVWHWRDLRPQ |
| Ga0066686_102535484 | 3300005446 | Soil | MLKLSDIKSSDEELRDYYAQLRTQHVTPAWIGGGISVEPR |
| Ga0066686_103048362 | 3300005446 | Soil | MKLSDIKPSEAELQDYYAQLRSQRISPAWIGGGITREPKSK |
| Ga0066697_102990562 | 3300005540 | Soil | MLQLSDIQSSPEELQDYYEQLRAQHVTPAWLGGGISLEPQSQAVPYV |
| Ga0070733_105172852 | 3300005541 | Surface Soil | MLQVSDIQSSPEELEDYYAQLEAQHVTPAWIGGGISVEPK |
| Ga0070732_102937852 | 3300005542 | Surface Soil | MLELSDIQSSQEELQDYYAQLRAQHVMPAWIGGGISVEPK |
| Ga0070704_1004859201 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MLKLSDIKSSEEELEAYYTELREQHVSPAWISGGITFEPRSKAVPHVWH |
| Ga0066701_104548221 | 3300005552 | Soil | MLQRSNIVSSEEELQKFYAQLQAQHITPAWISGGVSVEPRSMAVPAVWHWRDLRPQA |
| Ga0066701_109349521 | 3300005552 | Soil | MLKLSSIESSQQELTDYYEQLRSQHVTPAWIAGGTSTEPRSKAVPHVWHW |
| Ga0066704_109132572 | 3300005557 | Soil | MLQVSDIQSSQEELQEYYAQLEAQHVTPAWIGGGISVEPQSQAS |
| Ga0066700_108638622 | 3300005559 | Soil | MLQLSDIQSSQEELEGYYEQLRAQHITPAWIGGGIGVEPQSQAVPYVW |
| Ga0066693_101433102 | 3300005566 | Soil | MLELSDIQSSPEELEEYYAQLRAQHVTPAWIGGGVSVEPQSK |
| Ga0066705_106929231 | 3300005569 | Soil | MLQVSDIQSSPEELQDYYEQLRAQHVTPAWIGGGISVEPQSQAVPYVWHWRDL |
| Ga0068857_1015020212 | 3300005577 | Corn Rhizosphere | MQLSDIQASPDELRDYYAQLREQHVAPAWIGGGISIEPRSEAVPYLW |
| Ga0066654_101544601 | 3300005587 | Soil | MLELSDIQSSKEELEDYYAKLQAQHVTPAWIGGGIS |
| Ga0066706_115431152 | 3300005598 | Soil | MLELSDIQSSQEELQDYYAQLQAQHVTPAWIGGGISIEPRSEAVPYL* |
| Ga0066905_1019391411 | 3300005713 | Tropical Forest Soil | MMKLSDIKSSEAELQDYYAQLQSQHITPAWIGGGITREPKSKAVP |
| Ga0066903_1011922253 | 3300005764 | Tropical Forest Soil | MLELSDIQSSQEELEDYYAQLRAQHVTPAWIGGGISIEPRSE |
| Ga0066903_1074250011 | 3300005764 | Tropical Forest Soil | MLELSDIQSSEEELLEYYEQLRAQHVTPAWIGGGISIEPRSEALPHLWRWRDL |
| Ga0068863_1004376743 | 3300005841 | Switchgrass Rhizosphere | VLELSDIQSSPEELEDYYAQLRQSHVTPAWIGGGISVEPQTRAVPYV |
| Ga0075279_100305641 | 3300005903 | Rice Paddy Soil | MLELSDIQSSPEALESYYAGLAAQHVTPAWIGGGITVEPQSTAVPYLWHWRD |
| Ga0081538_103152002 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MLQRSNIVSPEEELQDFYEELRAQHVTPAWISGGVGVEPKSKAVPYVWHWRD |
| Ga0066651_106075421 | 3300006031 | Soil | MLQVSDIQSSPEELQDYYEQLRAQHVTPAWIGGGISVEPQSQ |
| Ga0066696_108462002 | 3300006032 | Soil | MLQLSDIQSSPEALQEYYAQLRAQHVTPAWLGGGISLEPQSQA |
| Ga0075417_105385791 | 3300006049 | Populus Rhizosphere | MMKLSDIKSSEAELQDYYAQLQSQHITPAWIGGGITREPKSKAVPWVW |
| Ga0070716_1017995802 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VLELSDIQSSQEVLQDYYAQLRAQNVTPAWIGGGIS |
| Ga0066665_114489001 | 3300006796 | Soil | MLKLSDIKSSEEELREYYEQLRSQHVSPLWLGGGISLEPKSKAIPYVW |
| Ga0079220_120149162 | 3300006806 | Agricultural Soil | MQLSDIQASPDELRDYYAQLREQHVAPAWIGGGISIEP |
| Ga0075428_1001453595 | 3300006844 | Populus Rhizosphere | MMKLSDIKSSEAELQDYYAQLQSQHITPAWIGGGITREPKSKAVPWVWHWRDLRPQ |
| Ga0075428_1003817861 | 3300006844 | Populus Rhizosphere | MKLSDIKSPEAELQDYYAQLQSQHITPAWIGGGITREPKSKAVPWVWHWRDLRPQ |
| Ga0075428_1008316322 | 3300006844 | Populus Rhizosphere | MLQRSNIVSSEEELQKFYEQLQAQHITPAWISGGVSVEPRSKAVPAVWHWRDLRPQAIRA |
| Ga0075428_1008482961 | 3300006844 | Populus Rhizosphere | MLQRSSIQTPEAELQDFYAQLQAQHITPAWISGGISTEPASK |
| Ga0075421_1009221091 | 3300006845 | Populus Rhizosphere | MLKRSRIESREDELEAFYAQLRSQHVTPAWTAEGTGVEPQSRAV |
| Ga0075430_1001860353 | 3300006846 | Populus Rhizosphere | MLQRSHIVSPPEELQDFYDELRAQHVTPAWISGGISVEPKSQAVP |
| Ga0075433_119559652 | 3300006852 | Populus Rhizosphere | MKLSDIKSSEAELQDYYAQLQSQHITPAWIGGGITREP |
| Ga0075425_1028546692 | 3300006854 | Populus Rhizosphere | MLELSDIKSSPEELQDYYAQLRAQHVTPAWIGGGIS |
| Ga0075434_1021872501 | 3300006871 | Populus Rhizosphere | MLQLSDIQSSQEELQDYYAQLRAQNVTPAWIGGGIS |
| Ga0079219_114296961 | 3300006954 | Agricultural Soil | MLQLSDIQSSPEELQDYYAQLRARHVTPAWIGPGISV |
| Ga0079219_120948961 | 3300006954 | Agricultural Soil | MLELSDIQSSPEELDGYYAQLRAQHVTPAWIGGGISVEPQSKAVPYLWH |
| Ga0079218_109710472 | 3300007004 | Agricultural Soil | MLQRSNIVSPEEELQDFYEQLRAQHVTPAWISGGVSVEPKSKAVPY |
| Ga0099795_101514691 | 3300007788 | Vadose Zone Soil | MLELSDIQSSQEEVQDYYAQLQAQHVTPAWIGGGISTEPRSDAVPCLWHWRDLRPQA |
| Ga0099795_101934952 | 3300007788 | Vadose Zone Soil | MLQLSDIQSSPEELQDYYEQLRAQHVTPAWLGGGISLE |
| Ga0066710_1045697102 | 3300009012 | Grasslands Soil | MLQRSNIVSSEEELQEFYAQLRSQHVTPAWIGGGVSVEPRSKAVPYVWHWR |
| Ga0099829_111849522 | 3300009038 | Vadose Zone Soil | MLAVSDIQSSPEELEHYYAQLSAQHVTPAWIGGGISVEPQSAA |
| Ga0099827_106035391 | 3300009090 | Vadose Zone Soil | MLAVSDIQSSPEELEHYYAQLAAQHVTPARIGGGISVEPQSQAVPY |
| Ga0099827_108928092 | 3300009090 | Vadose Zone Soil | MLQRSNIVSSEEELQEFYEQLQAQHVTPAWISGGVSVEPRSTAVPAVWHWCD |
| Ga0099827_114671352 | 3300009090 | Vadose Zone Soil | MLQRSNIVSSEEELQEFYAQLQSQHITPAWISGGVSVEPRSTAVPAVWHWCD |
| Ga0099827_117262981 | 3300009090 | Vadose Zone Soil | MLKLSDIKSSEEDLQDYYAQLRSQHVAPAWIGGGISLEPKSKAVPHVW |
| Ga0105247_115911311 | 3300009101 | Switchgrass Rhizosphere | MLQLSDIQSSQEELQEYYDQLAAQQVTPAWIGGGISVEPQSTAVP |
| Ga0066709_1004775203 | 3300009137 | Grasslands Soil | MLQVSDIQSSQEELQEYYAQLAAQHVTPAWIGGGIRVEPRRDAM |
| Ga0066709_1013498172 | 3300009137 | Grasslands Soil | MKLSDIKSSEAELQDYYAQLRSQHITPAWIGGGITREPKSKAV |
| Ga0099792_109575502 | 3300009143 | Vadose Zone Soil | MLELSDIQSSQEELQDYYAQLGAQHVAPAWIGGGISIEPQS |
| Ga0114129_100907971 | 3300009147 | Populus Rhizosphere | MMKLSDIKSSETELQDYYAQLQSQHITPAWIGGGITREPKSKAV |
| Ga0114129_111831872 | 3300009147 | Populus Rhizosphere | MMKLSDIKSPEAELQDYYAQLQSQHITPAWIGGGITREPKSKAVPWVWHWRDLRPQA |
| Ga0114129_114445182 | 3300009147 | Populus Rhizosphere | MMKLSDIKSSEAELQDYYAQLQSQHITPAWIGGGITREPKS |
| Ga0111538_114459562 | 3300009156 | Populus Rhizosphere | MLQVSDIQSSPEVLEDYYAQLRAQHVTPAWIAGGI |
| Ga0075423_118311531 | 3300009162 | Populus Rhizosphere | MMKLSDIKSSEAELQDYYAQLQSQHITPAWIGGGITREPK |
| Ga0075423_120459491 | 3300009162 | Populus Rhizosphere | MMKLSDIKSSEAELQDYDAQLQSQHITPAWIGGGITREPKSKAVPWVWHWRD |
| Ga0105164_103338411 | 3300009777 | Wastewater | MLAVSDIQSSPEELEAYYAQLHAQHVTPAWIAGRSGGTNVEPKSS |
| Ga0105066_11601871 | 3300009822 | Groundwater Sand | MLQRSNIISPEEELQDFYAQLRLQHVTPAWISGGVSDEPQSKAV |
| Ga0105058_10579913 | 3300009837 | Groundwater Sand | MLKLSDIKASDEELRDYYAQLRTRHVTPAWIGGGISIEPRSK |
| Ga0126380_108754452 | 3300010043 | Tropical Forest Soil | MLQRSNIVSPEEELQDFYEELRAQHVTPAWISGGVGVE |
| Ga0126310_115013921 | 3300010044 | Serpentine Soil | MLELSDIQSSPEELEDYYAQLRQSHVTPAWIGGGISVEPQTRAVPYLWHW |
| Ga0126382_121509281 | 3300010047 | Tropical Forest Soil | MLQRSNIVSSEEELQHFYAQLQAQHITPAWISGGVS |
| Ga0126382_122079321 | 3300010047 | Tropical Forest Soil | MLKLSSIESSEQELKQFYEQLRVQNVTPAWIAGGVTVEPRSKAVGHVW |
| Ga0126373_100986874 | 3300010048 | Tropical Forest Soil | MLELSDIKSSEEELKDYYQQLSAQHITPAWIGGGISVEPQSKAVPYLWHWRHLR |
| Ga0126373_132086381 | 3300010048 | Tropical Forest Soil | MLELSDIHSSQEELEDYYAQLRAQHVTPAWIGGGIT |
| Ga0126318_101732692 | 3300010152 | Soil | MLELSDIQSSQEELQDYYAQLRAQHVTPAWIGGGISIEPQSK |
| Ga0099796_102771292 | 3300010159 | Vadose Zone Soil | MLELSDIQSSQEELQDYYAQLQAQHVTPAWIGGGISVEPRSEAVPYLWHWRD |
| Ga0134088_100587623 | 3300010304 | Grasslands Soil | MKLSDIKSSEADLQDYYAQLRSQHITPAWIGGGITREPE |
| Ga0134109_102667912 | 3300010320 | Grasslands Soil | MLELSDIQASPEELEDYYAQLRAQHVTPAWIGGGISLEPRSEAVPFVWHWRDLRPQ |
| Ga0134065_103860831 | 3300010326 | Grasslands Soil | MLELSDIQSSPEALQDYYEQLRAQHVTPAWLGGGISLEPQSQAVPYVWHWRDL |
| Ga0134062_103370291 | 3300010337 | Grasslands Soil | MLELSEIQSSQEALEEYYAQLRALHVAPAWLSEAVSVAPQTAAAPYLWHWRDLR |
| Ga0126372_103400583 | 3300010360 | Tropical Forest Soil | MLTRSNIVSSEQELQDFYAQLEAQHITPAWISGGVSVEPRSTAVP |
| Ga0126372_108891662 | 3300010360 | Tropical Forest Soil | MLTRSNIVSSEEELQDFYAQLQAQHITPAWISGGVSVEPRSTAVPAVW |
| Ga0126378_132961861 | 3300010361 | Tropical Forest Soil | MLELSDIKSSEEELQDYYTQLRAQHVTPAWIGGGISIEPQSKAVPYLWHW |
| Ga0126377_102320632 | 3300010362 | Tropical Forest Soil | MLELSDIQSSQEELEDYYAQLGAQHITPAWDRRWH* |
| Ga0126379_105041782 | 3300010366 | Tropical Forest Soil | VLKRSSINAREDELQDFFTQLRSQHVTPAWISDGTT |
| Ga0126379_128252162 | 3300010366 | Tropical Forest Soil | MLELSDIQSSQEELQDYYAQLAAQHVTPAWIGGGISI* |
| Ga0126381_1027092591 | 3300010376 | Tropical Forest Soil | MLELSDIQSSQEELEDYYAQLRAQHVTPAWIGGGISIE |
| Ga0126381_1031386861 | 3300010376 | Tropical Forest Soil | MLELSDIQSSQEELEDYYAQLGAQHITPAWIGGGISVEPHSKAAPHVWHWRDLR |
| Ga0126381_1048628711 | 3300010376 | Tropical Forest Soil | MLELSDIQSSQQELQDYYTQLRAQHVTPAWIGGGISLEPRSK |
| Ga0134124_131789332 | 3300010397 | Terrestrial Soil | MLEVSDIQSSPEELDDYYAQLRAQHVTPAWIGGGISVEP |
| Ga0126383_101162044 | 3300010398 | Tropical Forest Soil | MLELSDIKSSEEELKDYYQQLSAQHITPAWIGGGISVEPQS |
| Ga0126383_106136822 | 3300010398 | Tropical Forest Soil | MLTRSNIVSSEEELQDFYAQLEAQHITPAWISGGVSVEPRSTAVPAV* |
| Ga0126383_117721612 | 3300010398 | Tropical Forest Soil | MLQRSNIVSSEEELQKFYEQLEAQHITPAWLSGGVSVEPRSKAVPAVWHWRDL |
| Ga0134122_101868233 | 3300010400 | Terrestrial Soil | MMKLSDIKSPEAELQDYYAQLQSQHITPAWIGGGITREPKSKAV |
| Ga0137776_17556251 | 3300010937 | Sediment | MLELSDIQSSQEELEDYYAQLRAQHVTPAWTGGGIS |
| Ga0137392_101453453 | 3300011269 | Vadose Zone Soil | MLQLSDIQSSQEELQDYYAQLQAQHVTPAWIGDSIGVEPKSAA |
| Ga0137389_106791592 | 3300012096 | Vadose Zone Soil | MLAVSDIQSSQEELQEFYAQLAAQHVTPAWIGGGISVEPR |
| Ga0137389_110763012 | 3300012096 | Vadose Zone Soil | MALRLSDIKSSEAELEAYYEALRAQHVVPAWISGGITFEPKSKAVPH |
| Ga0137380_109538112 | 3300012206 | Vadose Zone Soil | MLQVSDIQSSPEELEDYYAQLRAQYVTPAWTGGGISVEPRS |
| Ga0137380_115493772 | 3300012206 | Vadose Zone Soil | MLAVSDIQSSQEELQEYYAQLAAQHVTPAWIGGGISV |
| Ga0137381_108189163 | 3300012207 | Vadose Zone Soil | MALRLSDIKSSEAELEAYYEALRSQHVVPAWISGGITFEPKSKAVPHVWHWRDLR |
| Ga0137381_111899422 | 3300012207 | Vadose Zone Soil | MLKLSDIKSSDEELRDYYAQLRTQHVTPAWIGGGISIE |
| Ga0137376_110488691 | 3300012208 | Vadose Zone Soil | MKLSDIKPSEAELQDYYAQLRSQHISPAWIGGGITREPESKAVPWVWHWRDLRPQA |
| Ga0137377_113221792 | 3300012211 | Vadose Zone Soil | MLELSEIQASQEALEEYYAQLRALHVAPAWLSEAVSVAPQTAAAPYLWHWRDLRPQAM |
| Ga0137377_115614911 | 3300012211 | Vadose Zone Soil | MLQVSDIQSSQEERQEYHAQLAAQHVPPAWFGVGISVEPRSEA |
| Ga0137377_116988062 | 3300012211 | Vadose Zone Soil | MLELSDIQSSPEELQDYYAQLRAQHVTPAWIGGGI |
| Ga0137386_104810963 | 3300012351 | Vadose Zone Soil | MLELSDIQSSQEELQEYYAQLRAQQVTPAWIGGGISIEPTSEAVPYLWCWRDL |
| Ga0137386_106317221 | 3300012351 | Vadose Zone Soil | MLQRSNIVSSEEELQEFYAQLQAQHITPAWISGGVSVEPRSTAVPAVWHWCDLRPQAMRAAE |
| Ga0137390_114124962 | 3300012363 | Vadose Zone Soil | MLELSDIESSQEELQDYYAQLQAQHVTPAWIGGGIS |
| Ga0134061_10695892 | 3300012399 | Grasslands Soil | MLQRSNIVSSEEELQEFYAQLQAQHVTPAWIGGGVSVEP |
| Ga0150984_1154867872 | 3300012469 | Avena Fatua Rhizosphere | MLQRSNIVSSEEELQKFYAQLQAQHITPAWISGGVSVEPRSTA |
| Ga0137373_101690481 | 3300012532 | Vadose Zone Soil | MLKLSDIKSSDEELQDYYAQLRTQHVTPAWIGGGISIEPRSKA |
| Ga0137358_110782202 | 3300012582 | Vadose Zone Soil | MLELSDIQASPEELEDYYAQLRAQRVTPAWIGGGI |
| Ga0137398_103728341 | 3300012683 | Vadose Zone Soil | MLELSDIQSSQEELQEYYAQLQAQHVTPAWIGGGIST |
| Ga0137413_104172631 | 3300012924 | Vadose Zone Soil | MLQLSDIQSSPEELQDYYEQLRAQHVTPAWLGGGISLEPQSQAVPYVWHWRD |
| Ga0137419_105771012 | 3300012925 | Vadose Zone Soil | MQLSDIKSSEAELQDYYAKLRSQHITPAWIGGGITREPKSKAVPWVWHWRDLR |
| Ga0137407_108933342 | 3300012930 | Vadose Zone Soil | MLELSDIQSSQEELQDYYAQLQAQHVTPAWIGGGISIEPQSKAVPYLWHWRDLR |
| Ga0126375_120812262 | 3300012948 | Tropical Forest Soil | MLELSDIQSSQEELEDYYAQLGAQHITPAWIGGGISVEPHSKAVPYVWHW |
| Ga0126369_101939632 | 3300012971 | Tropical Forest Soil | MKLSDIKSSEAELQDYYAQLRSQHITPAWIGGGITREPKSKAVPWVW |
| Ga0126369_135897992 | 3300012971 | Tropical Forest Soil | MLELSDIQSSQEELQNYYAQLQAQQVTPAWIGGGIS |
| Ga0134110_105427941 | 3300012975 | Grasslands Soil | MLELSDIQSSPEELQDYYAQLSAQHITPAWIGGGISVEPQSQAVPFVWHWQDLRPQ |
| Ga0134076_100467341 | 3300012976 | Grasslands Soil | MLKLSDIKASDEELRDYYAQLRTQHVTPAWIGGGISIEPRSKAVPHVWR |
| Ga0134078_104331662 | 3300014157 | Grasslands Soil | MLQVSDIQSSPEELQQYYAELRTQHITPAWIGGGITTEPRSEAVPFVWHW |
| Ga0157379_107817032 | 3300014968 | Switchgrass Rhizosphere | MLQLSDIQSSQEELQEYYDQLAAQQVTPAWIGGGISVEPQ |
| Ga0157376_114757541 | 3300014969 | Miscanthus Rhizosphere | MLQLSDIQSSREELQEYYDQLAAQQVTPAWIGGGIRVEPQSTAVPYIWHWRDLR |
| Ga0134073_100324961 | 3300015356 | Grasslands Soil | MLELSDIQASPEELEDYYAQLRAQRVTPAWIGGGISIEPRSEAVPFVWH |
| Ga0182036_105611021 | 3300016270 | Soil | MLELSDIKSSEEELQDYYTQLRAQHVTPAWIGGGISSEPQSKAVPYLWHWRDL |
| Ga0182041_103737781 | 3300016294 | Soil | MLELSDIKSSEEELEDYYTQLRAQHVTPAWIGGGISIEPRSKAVPHLW |
| Ga0182033_122189972 | 3300016319 | Soil | MPELSDIQSSQEELQDYYSQLRAQHVTPAWIGGGIS |
| Ga0182037_105427522 | 3300016404 | Soil | MLELSDIQSSQEELQDYYTQLSEQHVTPAWIGGGISIEPRSKAVPHLWRWRDL |
| Ga0134069_13046142 | 3300017654 | Grasslands Soil | MLKLSDIKSSEEELREYYEQLRSQHVSPLWLGGGISLEPK |
| Ga0187808_106085991 | 3300017942 | Freshwater Sediment | MLELSDIQSSQEELQDYYTQLSAQHVTPAWIGGGISVEPRSKAVPYLW |
| Ga0187781_111041781 | 3300017972 | Tropical Peatland | MLELSDIQSSQEELEDYYAQLRAQRITPAWIGGGISVEPRSTA |
| Ga0187815_103744212 | 3300018001 | Freshwater Sediment | MLELSDIQSSPEELQDYYAQLAAQHITPAWIGGGITIEPQSKAVP |
| Ga0184626_101228922 | 3300018053 | Groundwater Sediment | MLKLSDIKSSDAELQEYYAQLRSQHVTPAWIGGGISLEPK |
| Ga0187765_110095492 | 3300018060 | Tropical Peatland | MLELSDIQSSQEELQDYYTQLRAQHVTPAWIGGGVSMEPRSKAVP |
| Ga0184633_103513292 | 3300018077 | Groundwater Sediment | MLKLSDIKSSEEELQEYYEQLRSQHISPAWTGGGISLEPKS |
| Ga0184629_106361833 | 3300018084 | Groundwater Sediment | MNLTNIESSEEERQDYYAQLRSQHVTPAWIAGGTTVEPKSKAVPHVWHW |
| Ga0066655_102485641 | 3300018431 | Grasslands Soil | MLELSDIQASPEELDDYYAQLPRQHVTPAWHGGGISL |
| Ga0066667_102453702 | 3300018433 | Grasslands Soil | MKLSDIKSSEAELQDYYAQLRSQHITPAWIGGGITREPKSKAVPWVWHWRGLA |
| Ga0066667_111535103 | 3300018433 | Grasslands Soil | VKLSNIQSSEEDLKAYYEQLRAQHVTPAWIAFATTIEPKSTAVPYVWHWRDLR |
| Ga0184645_12770702 | 3300019233 | Groundwater Sediment | MLQRSNIVSPEEELQDFYEELRAQHVTPAWISGGISVEP |
| Ga0184648_10664081 | 3300019249 | Groundwater Sediment | MLKLSDIKSSDGELRDYYAQLRSQHVTPAWIGGGISIEPRSKAVPHVWRWRDL |
| Ga0184646_14514902 | 3300019259 | Groundwater Sediment | MLQRSNIVSPEEELQDFYEELRAQHVTPAWISGGISVE |
| Ga0193751_11809372 | 3300019888 | Soil | MLAVSDIQSSPEELEHYYAQLAAQHVTPAWIGGGISVEPKSAAVPYLW |
| Ga0180109_14224861 | 3300020067 | Groundwater Sediment | MLQRSNIVSPEEELQDSYEELRAQHVTPAWISGGVSVE |
| Ga0210399_102246624 | 3300020581 | Soil | MLELSDIQSSQEELQDYYAQLAAQHITPAWIGGGISVEPQSKAVPYLWHWRDLRPTPRIPDR |
| Ga0210395_111626071 | 3300020582 | Soil | MPELSDIRSSQRELDDYYAQLQAQHVTPAWIGGGISI |
| Ga0210401_110875061 | 3300020583 | Soil | VLELSDIQSSQEMLQDYYVRLRAQNVTPAWIGGGISI |
| Ga0210406_104421401 | 3300021168 | Soil | MLELSDIKSSEEELQDYYTKLRAQHVTPAWIGGGVSI |
| Ga0210406_104915762 | 3300021168 | Soil | MLELSDIQSSEEELLDYYAQLRAQHVTPAWIGGGISIERPSSSGPSRPNAGFFA |
| Ga0210405_103536272 | 3300021171 | Soil | MLELSDIQSSQEELQEYYAQLQAQHVMPAWIGGGIST |
| Ga0210405_104375331 | 3300021171 | Soil | MLELSDIKSSEKELQEYYAQLRAEQVTPAWIGGGVSIEPQSK |
| Ga0210408_107095862 | 3300021178 | Soil | MLQVSDIQSSQEELEDYYAQLRDQHVTPAWIGGGISNEPRSEA |
| Ga0210408_109356612 | 3300021178 | Soil | MLELSDIQSSQEELQDYYTQLSAQHVTPAWIGGGISI |
| Ga0179585_11964801 | 3300021307 | Vadose Zone Soil | MLQRSNIVSSEEELQDFYAQLQAQHVTPAWISGGVSVEPRSTAVPAIWHWCDLRPQAM |
| Ga0210385_100316531 | 3300021402 | Soil | VLELSDIQSSQEMLQDYYVRLRAQNVTPAWIGGGISIEPRSKA |
| Ga0210387_103906182 | 3300021405 | Soil | MLELSDIQTSQEELQDYYAQLQAQHVTPAWIGGGISIEPRSEAVPHLWRWQDL |
| Ga0210386_117501292 | 3300021406 | Soil | VLELSDINSSEEELLDYYAGLNAQHVTPAWIGGGISIEPQGKAG |
| Ga0210394_118196941 | 3300021420 | Soil | MLELSDIQSSQEDLESYYAQLRDQHVTPAWIGGVISVEPQARAVPH |
| Ga0210384_108116802 | 3300021432 | Soil | MLELSDIQTSQEELQDYYAQLQAQHVTPAWIGGGISIEPRSEAVP |
| Ga0210384_116075591 | 3300021432 | Soil | MLELSDIKSSEKELQEYYTQLSAQHVTPAWIGGGIS |
| Ga0210391_108040592 | 3300021433 | Soil | VLELSDIQSSQEMLQDYYVQLRAQNVTPAWIGGGISIEPRS |
| Ga0210390_110643971 | 3300021474 | Soil | MLELSDIQSSPEELDAYYAQLQAQHITPAWIGGGIS |
| Ga0210410_109742743 | 3300021479 | Soil | MLELSDIQSSQEELQDYYAQLRGRHITPAWIGGGIMCRP |
| Ga0210409_101669024 | 3300021559 | Soil | MLELSDIQSSQQELEEYYAQLGAQHVTPAWIGGGISIEPRSEAVPHL |
| Ga0126371_103482423 | 3300021560 | Tropical Forest Soil | MLELSEIQSSQEALEEYYAQLRALHVAPAWLSEAVSVAPQTA |
| Ga0126371_116241881 | 3300021560 | Tropical Forest Soil | MLELSDIKSSEEELQDYYAQLSAQHVTPAWIGGGISIEP |
| Ga0126371_125483371 | 3300021560 | Tropical Forest Soil | MLELSDIQSSPEELEDYYAQLRAQHITPAWIGGGISVEPQSKAV |
| Ga0222625_10929511 | 3300022195 | Groundwater Sediment | MLQRSNIVSPEEELQDFYEELRAQHVTPAWISGGVGVEPKSK |
| Ga0242656_10078361 | 3300022525 | Soil | MLELSDIQSSQEELQDYYAQLCAQHVTPAWIGGGISIEPQSKAVPYL |
| Ga0242664_10166782 | 3300022527 | Soil | MQLSDIQASPEELQDYYAQLRAQHVTPAWIGGGIS |
| Ga0242662_102306451 | 3300022533 | Soil | QGGSPMLELSDIQSSQEELQDYYAQLQAQHVTPAWIGGGIST |
| Ga0242654_101282283 | 3300022726 | Soil | MLELSDIQSSQEELQDYYAQLAAQHITPAWIGGGISVEPQGKAV |
| Ga0207710_107406071 | 3300025900 | Switchgrass Rhizosphere | MLQLSDIQSSREELQEYYDQLAAQQVTPAWIGGGISVEPQSTA |
| Ga0207700_107631901 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MLELSDIQSSPEELQDYYAQLRAQHITPAWIGGGISVEPRSEAVPHVWHWRDLRPQAM |
| Ga0207704_119566452 | 3300025938 | Miscanthus Rhizosphere | MQLSDIQASPDELRDYYAQLRAQHVAPAWIGGGNSIEPRS |
| Ga0207661_109083672 | 3300025944 | Corn Rhizosphere | MQLSDIQASPDELRDYYAQFCEQHVAPAWIGGGISIEPR |
| Ga0207712_118789141 | 3300025961 | Switchgrass Rhizosphere | MLELSDIQSSQEELKDYYAQLGAQHITPAWTGGGISVEPHSKAVPYVWHWRDL |
| Ga0209235_11430501 | 3300026296 | Grasslands Soil | MLKLSDIKSSDEELRDYYAQLRTQHVTPAWIGGGISLEPRS |
| Ga0209153_11360251 | 3300026312 | Soil | MLELSDIQSSKEELEDYYAKLQAQHVTPAWIGGGISVEPRSEAVPYL |
| Ga0209153_12428231 | 3300026312 | Soil | MLELSDIQSSPEELEEYYAQLRAQHVTPAWIGGGVSVEPQSKAAPHLWQWRDL |
| Ga0209155_12172452 | 3300026316 | Soil | MLELSDIQSSPEELQDYYAQLSAQHITPAWIGGGISVEPQSQAVPFVWHW |
| Ga0209152_101510082 | 3300026325 | Soil | MKLSDIKSSEAELQDYYAQLRSQHITPAWIGGGITREPKS |
| Ga0257171_10862122 | 3300026377 | Soil | MLKLSDIKSSDEELRDYYAQLRTQHVTPAWIGGGISIEPRSK |
| Ga0209378_12562582 | 3300026528 | Soil | MKLSDIKSSEAELQDYYAQLRSQHITPAWIGGGITREPKSKAVPWV |
| Ga0209806_11388762 | 3300026529 | Soil | MKLSDIKSSEAELQDYYAQLRSQHITPAWIGGGITREPKSKAVPWVWHWRD |
| Ga0209156_102356781 | 3300026547 | Soil | MLQRSNIVSSEEELQKFYEQLQAQHITPAWISGGVSV |
| Ga0209474_100235246 | 3300026550 | Soil | MKLSDIKSSEAELQDYYAQLRSQHITPAWIGGGITR |
| Ga0209474_103654802 | 3300026550 | Soil | MLQLSDIQSSPEELQQYYAELRAQHITPAWIGGGITTEPRSEAVPFV |
| Ga0207777_10932971 | 3300027330 | Tropical Forest Soil | MLELSDIQSSPEELENYYAQLAAQHVTPAWIGGGISIEPRSAAVPY |
| Ga0209446_10733672 | 3300027698 | Bog Forest Soil | MLELSDIQSSQEELQAYYAQLRAQHVTPAWIGGGISIEPRSEAVPYLWRWQDLR |
| Ga0209655_101941241 | 3300027767 | Bog Forest Soil | MLELSDIHSSQEELQDYYTQLSAQHVTPAWIGGGISVEPRS |
| Ga0209772_100788752 | 3300027768 | Bog Forest Soil | MLELSDIQSSQQELEDYYTQLRAQHVTPAWIGGGI |
| Ga0209726_105520232 | 3300027815 | Groundwater | MLAVSDIQSSPEELEHYYAQLAAQHVTPAWIGGGISVEPRSRAVPYLWHWR |
| Ga0209465_104029981 | 3300027874 | Tropical Forest Soil | MKLSDIKSSEAELQDYYALLRSQHITPAWIGGGITREPKSKALPWVWHWRD |
| Ga0209380_102605881 | 3300027889 | Soil | VLELSDIQSSQEMLQDYYAQLRAQNVTPAWIGGGISIEPRSKAVPFLWHWRDLRPQAMRA |
| Ga0209382_117337802 | 3300027909 | Populus Rhizosphere | MLQRSNIVSSEEELQKFYEQLEAQHVTPAWISGGVSVEPRS |
| Ga0209382_120051591 | 3300027909 | Populus Rhizosphere | MLQRSHIVSSEEELQEFYTQLEAQHITPAWTSGGVTVEPRSKAVP |
| Ga0209526_101730083 | 3300028047 | Forest Soil | MLELSDIQSSQEELQDYYAQLAAQHITPAWIGGGISIEPQSKAVPYLWHW |
| Ga0268265_108885263 | 3300028380 | Switchgrass Rhizosphere | MLQRSNIVSSEEELQEFYAQLQAQHITPAWTSGGVSVEPRSMAVPAVWHWRDLRP |
| Ga0307504_103050002 | 3300028792 | Soil | MALKLSDIKSSEAELEAYYEALRAQHIVPAWISGGITYEPKSKAVPHVWHWRDLR |
| Ga0222749_102785992 | 3300029636 | Soil | MLELSDIKSSETELQEYYTQLSAQHVTPAWIGGGISLEPR |
| Ga0222748_11018551 | 3300029701 | Soil | MLELSDIQTSQEELQDYYAQLQAQHVTPAWIGGGISIEPRSEAVPYLWHW |
| Ga0308204_103340522 | 3300031092 | Soil | MLQRSNIISPEEELQEFYAQLQAQHVTPAWISGGVSVEP |
| Ga0308199_10249062 | 3300031094 | Soil | MLQRSHIVSSEEELQDFYAQLRAQHVTPAWTAGGVSVEPMSKAVPYVWHW |
| Ga0299914_103718331 | 3300031228 | Soil | MLQRSSIQASEAELQDFYAQLQAQHVTPAWISGGISTEPV |
| Ga0170824_1039297571 | 3300031231 | Forest Soil | MLELSDIQSSPEELQDYYAQLRAQHITPAWIGGGISVEPRSEAVPYVW |
| Ga0318516_105753921 | 3300031543 | Soil | MPELSDIQSSQEELQDYYTQLRAQHVTPAWIGGGISLEPQSKAVPYLWHWRDLRP |
| Ga0318541_101675793 | 3300031545 | Soil | MLELSDIKSSPEELQDYYTQLSAQHITPAWIGGGISTEPRSKAVPY |
| Ga0318541_103125732 | 3300031545 | Soil | MLELSDIKSSEAELQDYYTQLSAQRITPAWIGGGIS |
| Ga0318538_100487203 | 3300031546 | Soil | MLELSDIKSSEEELQDYYTQLRAQHVTPAWIGGGISIEPHSKAVPY |
| Ga0318571_103927352 | 3300031549 | Soil | MKLSDIKSSEAELQNYYAQLRSQHVTPAWIGGGISHEPKS |
| Ga0310915_100515505 | 3300031573 | Soil | MLELSDIQSSPEELENYYAQLAAQHVTPAWIGGGISIEPRSAAVPC |
| Ga0318542_106209312 | 3300031668 | Soil | MLELSDIQSSPEELDNYYAQLAAQHITPAWTGGGISIEPQSKAVPY |
| Ga0318561_107982991 | 3300031679 | Soil | MQLSEIQASPEELQDYYAQLRTQHVTPAWIGGGVSVEPRSEAVPYLWR |
| Ga0318560_105519511 | 3300031682 | Soil | MLVLSDIKSSDEELLDYYEQLRAQHVTPAWIGGGISTEPHSKAVPYLWHW |
| Ga0318560_106590881 | 3300031682 | Soil | MLELSDIKSSEAELQDYYTQLSAQRITPAWIGGGISTE |
| Ga0310686_1122503241 | 3300031708 | Soil | MLELSDIQSSQQELEEDYYAQLRAQHVTPAWIGGGISIE |
| Ga0310686_1167804812 | 3300031708 | Soil | MLQLSDIQSSPEELQDYYAQLRAQHVTPAWIGGGISLEPHSKAVPYLWHWR |
| Ga0318496_107284742 | 3300031713 | Soil | MLELSDIKSSEEELEDYYTQLRAQHVTPAWIGGGVS |
| Ga0307469_117618631 | 3300031720 | Hardwood Forest Soil | MKLSDIKSSEAELQDYYAQLRSQHITPAWTGGGITREPKS |
| Ga0318500_103168241 | 3300031724 | Soil | MLELSDIKSSEEELQDYYTQLRAQHVTPAWIGGGISIEPHSKAVPYL |
| Ga0318502_100739223 | 3300031747 | Soil | MLELSDIQSSPEELDNYYAQLAAQHITPAWTGGGISIEPQSKAVPYLW |
| Ga0318502_101308562 | 3300031747 | Soil | MLELSDIQSSQEELQDYYAQLRAQHVTPAWIGGGISI |
| Ga0318537_100910361 | 3300031763 | Soil | MLELSDIKSSEEELQEYYAQLSAQHVTPAWISGGISV |
| Ga0318537_101529662 | 3300031763 | Soil | MLELSDIQSSPEELENYYAQLAAQHVTPAWIGGGISIE |
| Ga0318554_103931792 | 3300031765 | Soil | MLELSDIKSSEEELQEYYAQLSAQHVTPAWIGGGISIEPQSKAVPFLWHW |
| Ga0318509_103964512 | 3300031768 | Soil | MLELSDIKSSEEELQNYYAQLSAQYVTPAWISGGISTEPQSKAVPYL |
| Ga0318509_106807401 | 3300031768 | Soil | MLELSDIKSSEAELQDYYTQLRAQHVTPAWIGGGISIEPQSKAVPYLW |
| Ga0318543_100194105 | 3300031777 | Soil | MLELSDIQSSPEELENYYAQLAAQHVTPAWIGGGISI |
| Ga0318543_101895952 | 3300031777 | Soil | MLELSDIQSSQEELQDYYTQLSAQHVTPAWIDGGIS |
| Ga0318498_105247981 | 3300031778 | Soil | MLGLSDIQSSQKELQDYYAQLDAQHVTPAWIGGGISIEPQSKAVPYLW |
| Ga0318552_102237431 | 3300031782 | Soil | MLELSDIKSSEEELQDYYTQLRAQHVTPAWIGGGISIE |
| Ga0318529_100436281 | 3300031792 | Soil | MLELSDIQSSQEELEDYYAQLRAQHVTPAWIGGGISIEPRSEAV |
| Ga0318529_104540962 | 3300031792 | Soil | MKLSDIKSSEAELQNYYAQLRSQHVTPAWIGGGISHEPK |
| Ga0318548_101142283 | 3300031793 | Soil | MLELSDIQSSQEELQDYYTQLSEQHVTPAWIGGGISIEPRSKAVPHLWRWRDLR |
| Ga0318557_104329332 | 3300031795 | Soil | MLGLSDIQSSQKELQDYYAQLDAQHVTPAWIGGGISIE |
| Ga0318568_107590082 | 3300031819 | Soil | MPELSDIQSSPEVLEEYYAQLRAQYVTPAWIGGGISVEPQSKAVPY |
| Ga0307473_106530432 | 3300031820 | Hardwood Forest Soil | MLKLSDIKSSDEELQDYYEQLRSQHVSPAWIGGGISLEPRSKAVP |
| Ga0318567_105526602 | 3300031821 | Soil | MLELSDIKSSEAELQDYYTQLRAQHVTPAWIGGGISIEPQSKAVPYLWRW |
| Ga0318499_102566121 | 3300031832 | Soil | MLELSDIKSSEEELQEYYAQLSAQHVTPAWISGGISVEPQSKAVPYLWHWR |
| Ga0318511_100876692 | 3300031845 | Soil | MLELSDIKSSPEELQDYYTQLSAQHITPAWIGGGISTEPRS |
| Ga0318511_105372431 | 3300031845 | Soil | MLGLSDIQSSQKELQDYYAQLDAQHVTPAWIGGGISIEPQSKAVPHLWHWRDLRP |
| Ga0318544_103537941 | 3300031880 | Soil | MLELSDIQSSQKELQDYYTQLRAQHITPAWIGGGISIEPQSKAV |
| Ga0318536_105262781 | 3300031893 | Soil | MLELSDIQSSQEELQDYYTQLSAQHVTPAWIGGGISIEPR |
| Ga0318551_109142681 | 3300031896 | Soil | MLELSDIKSSEEELQDYYTQLRAQHVTPAWIGGGISSEPQSKA |
| Ga0306921_100430958 | 3300031912 | Soil | MLELSDIKSSQEELQGYYTQLRTQHVTPAWIGGGISIEP |
| Ga0306921_120255461 | 3300031912 | Soil | MLELSDIQSSQEELQDYYTQLSAQHVTPAWIGGGI |
| Ga0306921_124751921 | 3300031912 | Soil | MQLSDIQASPEELQDYYAQLRAQHVTPAWIGGGTSVEPCSEAVPYVWRWRD |
| Ga0310912_101762321 | 3300031941 | Soil | MLELSDIKSSEEELEDYYTQLRAQHVTPAWIGGGVSIE |
| Ga0310912_107528752 | 3300031941 | Soil | MLELSDIKSSEEELQEYYAQLSAQHVTPAWISGGISI |
| Ga0310910_105376992 | 3300031946 | Soil | MLELSDIKSSEAELQDYYTQLSAQHITPAWIGGGISTEPQSK |
| Ga0310909_114674811 | 3300031947 | Soil | MLELSNIQSSQEELENYYAQLRAQHVTPAWIGGGISIEPRSEAVPHLW |
| Ga0318530_101155671 | 3300031959 | Soil | MLELSDIKSSEAELQDYYTQLSTQHITPAWIGGGISVEPQS |
| Ga0306922_105127894 | 3300032001 | Soil | MLELSDIKSSEEELQDYYAQLSAQHVTPAWIGGGISLEPRSKA |
| Ga0318559_100037311 | 3300032039 | Soil | MLELSDIQSSPEELENYYAQLAAQHVTPAWIGGGISIEPRSAAVPYLWHWLR |
| Ga0318556_104830422 | 3300032043 | Soil | MLELSDIKSSEEELQDYYAQLSAQHVTPAWIGGGISLEPRSKAVPY |
| Ga0318558_101476013 | 3300032044 | Soil | MLELSDIKSSEEELQDYYAQLSAQHVTPAWIGGGISIEPHSKAVPY |
| Ga0318558_106741122 | 3300032044 | Soil | MQLSDIQASPEELRDYYAQLRAQHVTPAWIGGGISAE |
| Ga0318506_104062301 | 3300032052 | Soil | MLELSDIQSSQEELEDYYAQLRAQHVTPAWIGGGISIEPRSEAVPYLWH |
| Ga0318570_103049041 | 3300032054 | Soil | MKLSDIKSSEAELQNYYAQLRSQHVTPAWIGGGISHEPKSK |
| Ga0318575_103731651 | 3300032055 | Soil | MLELSDIKSSEEELQDYYTQLRAQHVTPAWIGGGISIEPHSKAVPYLWRWRDL |
| Ga0318575_104795531 | 3300032055 | Soil | MLELSDIQPSQEELQDYYTQLSAQHVTPAWIGGGISIEPRSK |
| Ga0318510_101661401 | 3300032064 | Soil | MLELSDIKSSPEELQDYYTQLSAQHITPAWIGGGISTEPRSKAV |
| Ga0318513_103941641 | 3300032065 | Soil | MLELSDIKSSEEELQDYYTQLRAQHIIPAWIGGGISVEPRSQAVPYLWHW |
| Ga0308173_107350762 | 3300032074 | Soil | MLQLSDIQSSQEELQDYYAQLGAQHVTPAWIGGGISI |
| Ga0318525_102665272 | 3300032089 | Soil | MLELSDIQSSQEELQDYYTQLSAQHVTPAWIGGGISIEPRSKAVPHL |
| Ga0318525_102703011 | 3300032089 | Soil | MLELSDIQSSQEELEDYYAQLRAQHVTPAWIGGGIS |
| Ga0318577_100046171 | 3300032091 | Soil | MLELSDIQSSQEELEDYYAQLRAQHVTPAWIGGGISIEPRS |
| Ga0307470_103170551 | 3300032174 | Hardwood Forest Soil | MLELPDIKSSEKKLQEYYTRLSAQHVTPAWIGGGIITEP |
| Ga0307470_111803502 | 3300032174 | Hardwood Forest Soil | MPELSDIQSSPEVLEDYYAQLRAQHATPAWIGGGI |
| Ga0307471_1035543201 | 3300032180 | Hardwood Forest Soil | MALKLSDIKSSEAELEAYYEELRAQHVVPAWISGGITFE |
| Ga0307472_1014307732 | 3300032205 | Hardwood Forest Soil | MLELSDIQSSQEELQDYYAQLRAQHVTPAWIGGGISIEPQSKAVPY |
| Ga0335073_115826291 | 3300033134 | Soil | MLELSDIQSSHEELEEYYAQLRAQHILPAWIGGGISTAPQSPATPYVWHWRELRPQ |
| Ga0310914_104386781 | 3300033289 | Soil | MLELSDIKSSPEELQDYYTQLSAQHITPAWIGGGISTEPRSKAVPYL |
| Ga0310914_114427302 | 3300033289 | Soil | MLELSDIKSSEEELLDYYEQLRAQHVTPAWIGGGISLEPRSKAVPYLWR |
| Ga0316628_1035135172 | 3300033513 | Soil | MLAVSDIQSSPEELEHYYAQLRAQHVTPAWIGGGISVEPRSKAVPYLWH |
| Ga0364942_0215059_484_627 | 3300034165 | Sediment | MLKLSDIKSSEEELKDYYEQLRLQHISPAWIGGGISLEPRSKAVPHVW |
| Ga0364942_0271620_1_132 | 3300034165 | Sediment | MLQRSNIVSPEEELQDFYEQLRTQHVTPAWISGGVSLEPQSKAV |
| Ga0314786_029410_3_176 | 3300034664 | Soil | MLQRSNIVSSEEELQDFYAQLQAQHITPAWISGGVSVEPRSTAVPAVWHWRDLRPQAM |
| Ga0370541_062642_3_152 | 3300034680 | Soil | MLQRSNIISPEEELQDFYAQLRAQHVTPAWIAGGVSVEPRSKAVPYVWHW |
| ⦗Top⦘ |