Basic Information | |
---|---|
Family ID | F011625 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 289 |
Average Sequence Length | 41 residues |
Representative Sequence | VHLALLPTNEDRAKAVVDWAGAGLTHQRSGRITVET |
Number of Associated Samples | 237 |
Number of Associated Scaffolds | 289 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.04 % |
% of genes near scaffold ends (potentially truncated) | 98.62 % |
% of genes from short scaffolds (< 2000 bps) | 94.46 % |
Associated GOLD sequencing projects | 222 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.40 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (80.277 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.301 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.758 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.637 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.50% β-sheet: 0.00% Coil/Unstructured: 62.50% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 289 Family Scaffolds |
---|---|---|
PF00479 | G6PD_N | 29.41 |
PF01654 | Cyt_bd_oxida_I | 22.84 |
PF02781 | G6PD_C | 19.72 |
PF02036 | SCP2 | 10.38 |
PF14742 | GDE_N_bis | 5.54 |
PF00083 | Sugar_tr | 1.73 |
PF00723 | Glyco_hydro_15 | 1.38 |
PF01263 | Aldose_epim | 1.38 |
PF00664 | ABC_membrane | 1.04 |
PF07690 | MFS_1 | 1.04 |
PF06897 | DUF1269 | 0.35 |
PF01804 | Penicil_amidase | 0.35 |
PF00582 | Usp | 0.35 |
PF04199 | Cyclase | 0.35 |
PF02653 | BPD_transp_2 | 0.35 |
COG ID | Name | Functional Category | % Frequency in 289 Family Scaffolds |
---|---|---|---|
COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 49.13 |
COG1271 | Cytochrome bd-type quinol oxidase, subunit 1 | Energy production and conversion [C] | 22.84 |
COG0676 | D-hexose-6-phosphate mutarotase | Carbohydrate transport and metabolism [G] | 1.38 |
COG2017 | Galactose mutarotase or related enzyme | Carbohydrate transport and metabolism [G] | 1.38 |
COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 1.38 |
COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.35 |
COG2366 | Acyl-homoserine lactone (AHL) acylase PvdQ | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.35 |
COG4803 | Uncharacterized membrane protein | Function unknown [S] | 0.35 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 80.28 % |
Unclassified | root | N/A | 19.72 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2228664021|ICCgaii200_c0471602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 636 | Open in IMG/M |
3300000789|JGI1027J11758_11692032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 570 | Open in IMG/M |
3300000858|JGI10213J12805_10813519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 627 | Open in IMG/M |
3300000891|JGI10214J12806_11360133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 960 | Open in IMG/M |
3300000891|JGI10214J12806_11418300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 707 | Open in IMG/M |
3300000955|JGI1027J12803_107919274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 607 | Open in IMG/M |
3300000956|JGI10216J12902_101936523 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
3300000956|JGI10216J12902_113771084 | Not Available | 556 | Open in IMG/M |
3300000956|JGI10216J12902_115264932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 979 | Open in IMG/M |
3300000956|JGI10216J12902_126954751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 658 | Open in IMG/M |
3300001205|C688J13580_1046903 | Not Available | 578 | Open in IMG/M |
3300001978|JGI24747J21853_1039467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 557 | Open in IMG/M |
3300002244|JGI24742J22300_10091932 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300002568|C688J35102_119293786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 669 | Open in IMG/M |
3300002568|C688J35102_120249754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 949 | Open in IMG/M |
3300003998|Ga0055472_10077100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 896 | Open in IMG/M |
3300004081|Ga0063454_101841831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 531 | Open in IMG/M |
3300004114|Ga0062593_102071700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter | 634 | Open in IMG/M |
3300004157|Ga0062590_101199441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 740 | Open in IMG/M |
3300004479|Ga0062595_101823764 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300004479|Ga0062595_102633355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
3300004480|Ga0062592_101274523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 692 | Open in IMG/M |
3300004643|Ga0062591_101067015 | Not Available | 775 | Open in IMG/M |
3300005093|Ga0062594_101562195 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300005093|Ga0062594_102311928 | Not Available | 585 | Open in IMG/M |
3300005329|Ga0070683_100044570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4090 | Open in IMG/M |
3300005332|Ga0066388_100379441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2060 | Open in IMG/M |
3300005336|Ga0070680_100535975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1003 | Open in IMG/M |
3300005347|Ga0070668_100442061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1116 | Open in IMG/M |
3300005353|Ga0070669_101184777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 660 | Open in IMG/M |
3300005356|Ga0070674_100528870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 986 | Open in IMG/M |
3300005366|Ga0070659_100513255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1023 | Open in IMG/M |
3300005435|Ga0070714_101314982 | Not Available | 706 | Open in IMG/M |
3300005436|Ga0070713_101968992 | Not Available | 567 | Open in IMG/M |
3300005440|Ga0070705_101223417 | Not Available | 620 | Open in IMG/M |
3300005450|Ga0066682_10832065 | Not Available | 555 | Open in IMG/M |
3300005456|Ga0070678_102183149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
3300005457|Ga0070662_100710796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus | 850 | Open in IMG/M |
3300005526|Ga0073909_10274215 | Not Available | 758 | Open in IMG/M |
3300005530|Ga0070679_101370720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 653 | Open in IMG/M |
3300005535|Ga0070684_101005794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter | 782 | Open in IMG/M |
3300005536|Ga0070697_100327090 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
3300005549|Ga0070704_101384022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 645 | Open in IMG/M |
3300005574|Ga0066694_10564233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
3300005577|Ga0068857_100192277 | All Organisms → cellular organisms → Bacteria | 1859 | Open in IMG/M |
3300005616|Ga0068852_102080787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 590 | Open in IMG/M |
3300005764|Ga0066903_100399009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2261 | Open in IMG/M |
3300005764|Ga0066903_100922801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1584 | Open in IMG/M |
3300005764|Ga0066903_101029887 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
3300005764|Ga0066903_101547144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1255 | Open in IMG/M |
3300005764|Ga0066903_101713854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1197 | Open in IMG/M |
3300005764|Ga0066903_102112770 | Not Available | 1084 | Open in IMG/M |
3300005764|Ga0066903_102986663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 916 | Open in IMG/M |
3300005764|Ga0066903_103228592 | Not Available | 882 | Open in IMG/M |
3300005764|Ga0066903_105914686 | Not Available | 641 | Open in IMG/M |
3300005764|Ga0066903_106278710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
3300005840|Ga0068870_10545874 | Not Available | 780 | Open in IMG/M |
3300005840|Ga0068870_10567421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter | 766 | Open in IMG/M |
3300005841|Ga0068863_100530011 | Not Available | 1162 | Open in IMG/M |
3300005841|Ga0068863_101051359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter | 818 | Open in IMG/M |
3300006102|Ga0075015_100724498 | Not Available | 592 | Open in IMG/M |
3300006163|Ga0070715_10889302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 547 | Open in IMG/M |
3300006237|Ga0097621_101261936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 697 | Open in IMG/M |
3300006358|Ga0068871_101749300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 590 | Open in IMG/M |
3300006572|Ga0074051_11168992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 853 | Open in IMG/M |
3300006572|Ga0074051_11754666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 870 | Open in IMG/M |
3300006575|Ga0074053_11951979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 728 | Open in IMG/M |
3300006576|Ga0074047_11598811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 625 | Open in IMG/M |
3300006580|Ga0074049_12449759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 557 | Open in IMG/M |
3300006606|Ga0074062_12531329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 620 | Open in IMG/M |
3300006791|Ga0066653_10198187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Leifsonia → Leifsonia xyli → Leifsonia xyli subsp. xyli | 1016 | Open in IMG/M |
3300006797|Ga0066659_10344108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1154 | Open in IMG/M |
3300006806|Ga0079220_11573437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 568 | Open in IMG/M |
3300006844|Ga0075428_100079760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3572 | Open in IMG/M |
3300006844|Ga0075428_101328781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 756 | Open in IMG/M |
3300006845|Ga0075421_101448200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 754 | Open in IMG/M |
3300006871|Ga0075434_100697393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1033 | Open in IMG/M |
3300006954|Ga0079219_10631577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 793 | Open in IMG/M |
3300007076|Ga0075435_101927037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
3300009012|Ga0066710_100922468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1345 | Open in IMG/M |
3300009100|Ga0075418_10604900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1180 | Open in IMG/M |
3300009147|Ga0114129_10983985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1063 | Open in IMG/M |
3300009147|Ga0114129_11188752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 950 | Open in IMG/M |
3300009156|Ga0111538_10049268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5402 | Open in IMG/M |
3300009162|Ga0075423_12867518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba | 528 | Open in IMG/M |
3300009176|Ga0105242_11447971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 716 | Open in IMG/M |
3300009177|Ga0105248_11510018 | Not Available | 761 | Open in IMG/M |
3300009177|Ga0105248_12509661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 587 | Open in IMG/M |
3300009177|Ga0105248_13192010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
3300009545|Ga0105237_11415888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 702 | Open in IMG/M |
3300009551|Ga0105238_11956639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 619 | Open in IMG/M |
3300009553|Ga0105249_10543745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1211 | Open in IMG/M |
3300009821|Ga0105064_1134361 | Not Available | 525 | Open in IMG/M |
3300010040|Ga0126308_10061499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2212 | Open in IMG/M |
3300010042|Ga0126314_11285107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → Cellulomonas hominis | 548 | Open in IMG/M |
3300010326|Ga0134065_10230674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 683 | Open in IMG/M |
3300010333|Ga0134080_10584504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 541 | Open in IMG/M |
3300010358|Ga0126370_11938314 | Not Available | 574 | Open in IMG/M |
3300010359|Ga0126376_11497654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 703 | Open in IMG/M |
3300010360|Ga0126372_13280495 | Not Available | 503 | Open in IMG/M |
3300010373|Ga0134128_10934464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 959 | Open in IMG/M |
3300010375|Ga0105239_13589585 | Not Available | 504 | Open in IMG/M |
3300010376|Ga0126381_101793981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 886 | Open in IMG/M |
3300010376|Ga0126381_103430986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 623 | Open in IMG/M |
3300010396|Ga0134126_12928232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
3300010400|Ga0134122_11257237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → Cellulomonas hominis | 745 | Open in IMG/M |
3300010403|Ga0134123_12694905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 565 | Open in IMG/M |
3300010999|Ga0138505_100004324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1418 | Open in IMG/M |
3300011000|Ga0138513_100005880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1395 | Open in IMG/M |
3300011107|Ga0151490_1459453 | Not Available | 614 | Open in IMG/M |
3300011119|Ga0105246_10243109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1424 | Open in IMG/M |
3300011119|Ga0105246_10887523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 798 | Open in IMG/M |
3300011119|Ga0105246_12480162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
3300012285|Ga0137370_10638547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 660 | Open in IMG/M |
3300012354|Ga0137366_10961209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 597 | Open in IMG/M |
3300012374|Ga0134039_1207569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 814 | Open in IMG/M |
3300012389|Ga0134040_1285732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 548 | Open in IMG/M |
3300012483|Ga0157337_1020730 | Not Available | 605 | Open in IMG/M |
3300012493|Ga0157355_1043558 | Not Available | 511 | Open in IMG/M |
3300012506|Ga0157324_1021946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
3300012884|Ga0157300_1019315 | Not Available | 889 | Open in IMG/M |
3300012896|Ga0157303_10104244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 693 | Open in IMG/M |
3300012905|Ga0157296_10331142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
3300012907|Ga0157283_10252337 | Not Available | 587 | Open in IMG/M |
3300012911|Ga0157301_10138564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 761 | Open in IMG/M |
3300012912|Ga0157306_10159625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 721 | Open in IMG/M |
3300012914|Ga0157297_10185619 | Not Available | 707 | Open in IMG/M |
3300012948|Ga0126375_11194856 | Not Available | 632 | Open in IMG/M |
3300012955|Ga0164298_10906560 | Not Available | 642 | Open in IMG/M |
3300012958|Ga0164299_10283693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1008 | Open in IMG/M |
3300012961|Ga0164302_10950750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 665 | Open in IMG/M |
3300012961|Ga0164302_11815276 | Not Available | 515 | Open in IMG/M |
3300012971|Ga0126369_12393509 | Not Available | 614 | Open in IMG/M |
3300012971|Ga0126369_12413065 | Not Available | 612 | Open in IMG/M |
3300012975|Ga0134110_10341989 | Not Available | 653 | Open in IMG/M |
3300012985|Ga0164308_11998660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
3300012986|Ga0164304_11334238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 586 | Open in IMG/M |
3300012987|Ga0164307_10607364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 844 | Open in IMG/M |
3300012987|Ga0164307_10871332 | Not Available | 722 | Open in IMG/M |
3300012989|Ga0164305_10825125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 772 | Open in IMG/M |
3300013100|Ga0157373_11209948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 570 | Open in IMG/M |
3300013104|Ga0157370_10914159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 796 | Open in IMG/M |
3300013308|Ga0157375_11809214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 724 | Open in IMG/M |
3300014325|Ga0163163_12042385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 633 | Open in IMG/M |
3300014326|Ga0157380_12676649 | Not Available | 565 | Open in IMG/M |
3300014745|Ga0157377_10017285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3727 | Open in IMG/M |
3300015356|Ga0134073_10059400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1046 | Open in IMG/M |
3300015356|Ga0134073_10410600 | Not Available | 513 | Open in IMG/M |
3300015357|Ga0134072_10132506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 802 | Open in IMG/M |
3300015372|Ga0132256_100435648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1416 | Open in IMG/M |
3300015372|Ga0132256_101232064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 861 | Open in IMG/M |
3300015373|Ga0132257_100234735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2185 | Open in IMG/M |
3300015373|Ga0132257_101335345 | Not Available | 911 | Open in IMG/M |
3300015373|Ga0132257_103133651 | Not Available | 602 | Open in IMG/M |
3300015374|Ga0132255_101137710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1174 | Open in IMG/M |
3300015374|Ga0132255_104182465 | Not Available | 612 | Open in IMG/M |
3300016341|Ga0182035_11113457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 703 | Open in IMG/M |
3300016341|Ga0182035_11271328 | Not Available | 658 | Open in IMG/M |
3300016445|Ga0182038_10365808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1199 | Open in IMG/M |
3300016445|Ga0182038_10564397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 979 | Open in IMG/M |
3300017792|Ga0163161_11129212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 675 | Open in IMG/M |
3300017947|Ga0187785_10762877 | Not Available | 512 | Open in IMG/M |
3300017961|Ga0187778_10657326 | Not Available | 706 | Open in IMG/M |
3300018027|Ga0184605_10113750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1201 | Open in IMG/M |
3300018061|Ga0184619_10320115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 709 | Open in IMG/M |
3300018081|Ga0184625_10207539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1027 | Open in IMG/M |
3300018469|Ga0190270_13002579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 533 | Open in IMG/M |
3300018476|Ga0190274_13362019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 539 | Open in IMG/M |
3300018481|Ga0190271_10495807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1332 | Open in IMG/M |
3300018482|Ga0066669_11118778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 711 | Open in IMG/M |
3300019279|Ga0184642_1208254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 644 | Open in IMG/M |
3300019356|Ga0173481_10472266 | Not Available | 632 | Open in IMG/M |
3300019458|Ga0187892_10362117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 702 | Open in IMG/M |
3300019885|Ga0193747_1048854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1052 | Open in IMG/M |
3300020005|Ga0193697_1051906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1018 | Open in IMG/M |
3300020021|Ga0193726_1288273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 644 | Open in IMG/M |
3300022694|Ga0222623_10324797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 589 | Open in IMG/M |
3300022756|Ga0222622_10300497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1104 | Open in IMG/M |
3300023064|Ga0247801_1079995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 532 | Open in IMG/M |
3300023077|Ga0247802_1009163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1276 | Open in IMG/M |
3300024055|Ga0247794_10166032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 697 | Open in IMG/M |
3300024245|Ga0247677_1019785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 961 | Open in IMG/M |
3300024286|Ga0247687_1080152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → Cellulomonas hominis | 505 | Open in IMG/M |
3300024290|Ga0247667_1024735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1152 | Open in IMG/M |
3300024325|Ga0247678_1073549 | Not Available | 567 | Open in IMG/M |
3300025321|Ga0207656_10134511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1161 | Open in IMG/M |
3300025893|Ga0207682_10640033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
3300025898|Ga0207692_10125371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1443 | Open in IMG/M |
3300025898|Ga0207692_10695032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 660 | Open in IMG/M |
3300025899|Ga0207642_10506051 | Not Available | 740 | Open in IMG/M |
3300025899|Ga0207642_10906890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 565 | Open in IMG/M |
3300025908|Ga0207643_10043295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2541 | Open in IMG/M |
3300025908|Ga0207643_10092482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1765 | Open in IMG/M |
3300025909|Ga0207705_10201649 | Not Available | 1507 | Open in IMG/M |
3300025915|Ga0207693_11013070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 634 | Open in IMG/M |
3300025916|Ga0207663_10235016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1341 | Open in IMG/M |
3300025916|Ga0207663_10450745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 992 | Open in IMG/M |
3300025920|Ga0207649_10970007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 668 | Open in IMG/M |
3300025926|Ga0207659_10797598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 811 | Open in IMG/M |
3300025927|Ga0207687_10296608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1301 | Open in IMG/M |
3300025928|Ga0207700_10253327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1505 | Open in IMG/M |
3300025932|Ga0207690_10275913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1308 | Open in IMG/M |
3300025933|Ga0207706_10537769 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1007 | Open in IMG/M |
3300025934|Ga0207686_10925434 | Not Available | 704 | Open in IMG/M |
3300025942|Ga0207689_10378805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1178 | Open in IMG/M |
3300025944|Ga0207661_10134945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. 9MFCol3.1 | 2118 | Open in IMG/M |
3300025945|Ga0207679_10093508 | All Organisms → cellular organisms → Bacteria | 2332 | Open in IMG/M |
3300025972|Ga0207668_10162730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1741 | Open in IMG/M |
3300026075|Ga0207708_10044521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 3381 | Open in IMG/M |
3300026075|Ga0207708_11082329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 698 | Open in IMG/M |
3300026078|Ga0207702_11381039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 698 | Open in IMG/M |
3300026121|Ga0207683_10737229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 914 | Open in IMG/M |
3300026142|Ga0207698_12053626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 585 | Open in IMG/M |
3300026547|Ga0209156_10214367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 912 | Open in IMG/M |
3300026547|Ga0209156_10370060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
3300026550|Ga0209474_10378684 | Not Available | 759 | Open in IMG/M |
3300027041|Ga0209876_1004914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 898 | Open in IMG/M |
3300027379|Ga0209842_1073079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 601 | Open in IMG/M |
3300027511|Ga0209843_1068591 | Not Available | 614 | Open in IMG/M |
3300027876|Ga0209974_10219898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 707 | Open in IMG/M |
3300027907|Ga0207428_10060296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3006 | Open in IMG/M |
3300028592|Ga0247822_11325193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 604 | Open in IMG/M |
3300028592|Ga0247822_11664828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 542 | Open in IMG/M |
3300028596|Ga0247821_10629133 | Not Available | 695 | Open in IMG/M |
3300028597|Ga0247820_10735903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 690 | Open in IMG/M |
3300028708|Ga0307295_10119801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 718 | Open in IMG/M |
3300028716|Ga0307311_10003825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3348 | Open in IMG/M |
3300028717|Ga0307298_10108914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 790 | Open in IMG/M |
3300028720|Ga0307317_10211002 | Not Available | 655 | Open in IMG/M |
3300028722|Ga0307319_10026464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1787 | Open in IMG/M |
3300028722|Ga0307319_10253591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 579 | Open in IMG/M |
3300028771|Ga0307320_10077571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1247 | Open in IMG/M |
3300028778|Ga0307288_10150001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 877 | Open in IMG/M |
3300028787|Ga0307323_10071312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1235 | Open in IMG/M |
3300028791|Ga0307290_10130942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 918 | Open in IMG/M |
3300028793|Ga0307299_10072143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1281 | Open in IMG/M |
3300028796|Ga0307287_10174603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 816 | Open in IMG/M |
3300028796|Ga0307287_10192678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 774 | Open in IMG/M |
3300028812|Ga0247825_11037855 | Not Available | 596 | Open in IMG/M |
3300028814|Ga0307302_10264151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 844 | Open in IMG/M |
3300028814|Ga0307302_10309067 | Not Available | 778 | Open in IMG/M |
3300028872|Ga0307314_10135877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 700 | Open in IMG/M |
3300028872|Ga0307314_10203308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 597 | Open in IMG/M |
3300028875|Ga0307289_10129056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1037 | Open in IMG/M |
3300028881|Ga0307277_10565044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 511 | Open in IMG/M |
3300030336|Ga0247826_10708144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 782 | Open in IMG/M |
3300031092|Ga0308204_10128147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 731 | Open in IMG/M |
3300031114|Ga0308187_10096393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 911 | Open in IMG/M |
3300031170|Ga0307498_10084372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 945 | Open in IMG/M |
3300031170|Ga0307498_10413075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
3300031184|Ga0307499_10302435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
3300031226|Ga0307497_10690334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 526 | Open in IMG/M |
3300031421|Ga0308194_10067551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 958 | Open in IMG/M |
3300031423|Ga0308177_1033630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
3300031547|Ga0310887_10901640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 560 | Open in IMG/M |
3300031549|Ga0318571_10262811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 638 | Open in IMG/M |
3300031562|Ga0310886_11042184 | Not Available | 526 | Open in IMG/M |
3300031572|Ga0318515_10589167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 591 | Open in IMG/M |
3300031679|Ga0318561_10833119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
3300031724|Ga0318500_10683226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
3300031736|Ga0318501_10749414 | Not Available | 539 | Open in IMG/M |
3300031740|Ga0307468_102503416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
3300031748|Ga0318492_10114190 | Not Available | 1338 | Open in IMG/M |
3300031782|Ga0318552_10543033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 593 | Open in IMG/M |
3300031805|Ga0318497_10346257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 830 | Open in IMG/M |
3300031821|Ga0318567_10205837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1099 | Open in IMG/M |
3300031831|Ga0318564_10525525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
3300031854|Ga0310904_10537423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 789 | Open in IMG/M |
3300031896|Ga0318551_10678187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 597 | Open in IMG/M |
3300031954|Ga0306926_12715104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
3300032000|Ga0310903_10303868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 786 | Open in IMG/M |
3300032002|Ga0307416_101175233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 873 | Open in IMG/M |
3300032013|Ga0310906_10150873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1355 | Open in IMG/M |
3300032013|Ga0310906_11355744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 521 | Open in IMG/M |
3300032211|Ga0310896_10040821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1815 | Open in IMG/M |
3300032211|Ga0310896_10695765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 575 | Open in IMG/M |
3300032770|Ga0335085_11950030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 597 | Open in IMG/M |
3300032828|Ga0335080_11036059 | Not Available | 834 | Open in IMG/M |
3300032892|Ga0335081_11248085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 843 | Open in IMG/M |
3300032954|Ga0335083_10631279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 879 | Open in IMG/M |
3300032955|Ga0335076_11737686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
3300033004|Ga0335084_10006085 | All Organisms → cellular organisms → Bacteria | 11961 | Open in IMG/M |
3300033004|Ga0335084_11516541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 662 | Open in IMG/M |
3300033289|Ga0310914_11301269 | Not Available | 629 | Open in IMG/M |
3300033550|Ga0247829_10026945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 3767 | Open in IMG/M |
3300033551|Ga0247830_10224203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1413 | Open in IMG/M |
3300033551|Ga0247830_10806672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea marina | 747 | Open in IMG/M |
3300034150|Ga0364933_132986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 639 | Open in IMG/M |
3300034660|Ga0314781_079392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 632 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.30% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.23% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.54% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.50% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.81% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.81% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.77% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.42% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.42% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.42% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.42% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.08% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.73% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.73% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.73% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.73% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.38% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.38% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.38% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.38% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.04% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.04% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.04% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.04% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.04% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.69% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.69% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.69% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.69% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.69% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.69% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.69% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.69% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.69% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.69% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.69% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.69% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.69% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.69% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.35% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.35% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.35% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.35% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.35% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.35% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.35% |
Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.35% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.35% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.35% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.35% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.35% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.35% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.35% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001205 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Host-Associated | Open in IMG/M |
3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Host-Associated | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012374 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012389 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Host-Associated | Open in IMG/M |
3300012493 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610 | Environmental | Open in IMG/M |
3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Host-Associated | Open in IMG/M |
3300012884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 | Environmental | Open in IMG/M |
3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300023064 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6 | Environmental | Open in IMG/M |
3300023077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6 | Environmental | Open in IMG/M |
3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
3300024286 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28 | Environmental | Open in IMG/M |
3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027041 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031423 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_148 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
3300034660 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICCgaii200_04716021 | 2228664021 | Soil | GKDAQLAWGTVHLALLPTIQDRAKAIVDWAGAALTHQRAGRITVSADRD |
JGI1027J11758_116920321 | 3300000789 | Soil | ALLPTNQDRAKAIVDWAGAALTHQRAGRITXSADRD* |
JGI10213J12805_108135191 | 3300000858 | Soil | ALLPTNEDRAKAVVDWAGSEFTHQRVGRISVDADE* |
JGI10214J12806_113601333 | 3300000891 | Soil | LALLPTNEDRAKAVVDWAGSELTHQRVGRITVDTEEDD* |
JGI10214J12806_114183001 | 3300000891 | Soil | FAWRTVHLALLPTNEDRTKAIVDWAGSELTHQRVGRIRVDEDEQ* |
JGI1027J12803_1079192743 | 3300000955 | Soil | KAQAAWGAVHLALLPTNEDRAKAVVDWAGAGLTHQRSGRITVEVGDSER* |
JGI10216J12902_1019365232 | 3300000956 | Soil | MTGLKTQLAWGTVHLALLPTDDDRAKAVVSWAGAAMTHQRVGRITVEDE* |
JGI10216J12902_1137710842 | 3300000956 | Soil | LLPTNEDRAKAIVDWAGAGLTHQRAGRITVRTEEAE* |
JGI10216J12902_1152649322 | 3300000956 | Soil | TAQAAWGAVHLALLPTNEDRAKAVVDWAGAGLTHQRPGRITVHADQE* |
JGI10216J12902_1269547511 | 3300000956 | Soil | PTNEDRAKAVVDWAGAAFTHQRVGRITIEQEVSE* |
C688J13580_10469032 | 3300001205 | Soil | HLALLPTNEDRAKAVVDWAGAGLTHQRSGRIRVET* |
JGI24747J21853_10394672 | 3300001978 | Corn, Switchgrass And Miscanthus Rhizosphere | KAQFAWRAVHLALLPTNEDRAKAVVDWAGSELTHQRVGRISVAEDE* |
JGI24742J22300_100919322 | 3300002244 | Corn, Switchgrass And Miscanthus Rhizosphere | WGTVHLALLPTNEDRAKAVVDWAGAGLTHQRGARITVET* |
C688J35102_1192937861 | 3300002568 | Soil | KAQLAWATVHLALLPTNSDRAKAVVDWTGAALTHQRSGRISVNSEKGAR* |
C688J35102_1202497542 | 3300002568 | Soil | AAWAAVHLALLPTNQDRAKAVVDWTGAAFTHQRAGRITVGDE* |
Ga0055472_100771001 | 3300003998 | Natural And Restored Wetlands | FAWRTVHLALLPTNEDRAKAIVDWAGSELTHQRVGRISVDEDE* |
Ga0063454_1018418311 | 3300004081 | Soil | GKKAQAAWGAVHLALLPTNGDRAKAVVDWAGAALTHQRAGRITVEAE* |
Ga0062593_1020717001 | 3300004114 | Soil | QFAWRAVHLALLPTNEDRAKAVVDWAGSELTHQRVGRISVSQDE* |
Ga0062590_1011994411 | 3300004157 | Soil | VHLALLPTNEDRAHAVVDWAGAALTHQRTGRITVESGGE* |
Ga0062595_1018237642 | 3300004479 | Soil | ASLAWGTVHLALLPTNEDRAKAVVDWAGAGLTHQRGARITVET* |
Ga0062595_1026333552 | 3300004479 | Soil | GKKAQAAWGAVHLALLPTNEDRAKAVVDWAGAALTHQRAGRITVEAE* |
Ga0062592_1012745231 | 3300004480 | Soil | QVAWGTVHLALLPTNQDRAKAVVDWAGAGLTHQRGARITVES* |
Ga0062591_1010670152 | 3300004643 | Soil | KAQLAWATVHLALLPTNEDRAKAVVDWAGATFSHQRAGRITVESD* |
Ga0062594_1015621951 | 3300005093 | Soil | KAQVAWGVVHLALLPTNQNRAKAVVDWAGAGLTHQRSARITVET* |
Ga0062594_1023119281 | 3300005093 | Soil | AWGTVHLALLPTNEDRAKAVVSWAGAAFTHQRADRITVEGE* |
Ga0070683_1000445701 | 3300005329 | Corn Rhizosphere | KGLKAQVAWGTVHLALLPTNEDRANAVVEWAGAGLTHQRAGRITVTTDEP* |
Ga0066388_1003794415 | 3300005332 | Tropical Forest Soil | AQVAWGAVHLALLPTNEDRAKAVVDWAGVAFDHQRVGRFSVGDE* |
Ga0070680_1005359752 | 3300005336 | Corn Rhizosphere | TVHLALLPTNEDRANAVVEWAGAGLTHQRAGRITVTTDEP* |
Ga0070668_1004420611 | 3300005347 | Switchgrass Rhizosphere | AVHLALLPTNEDRAKAVVDWAGSELTHQRVGRISVGPDE* |
Ga0070669_1011847771 | 3300005353 | Switchgrass Rhizosphere | LAWGTVHLALLPTNEDRAKAVVDWAGAGLTHQRSGRITVEVGDSER* |
Ga0070674_1005288703 | 3300005356 | Miscanthus Rhizosphere | GHKAQFAWRTVHLALLPTNEDRTKAIVDWAGSELTHQRVGRIRVDEDEQ* |
Ga0070659_1005132551 | 3300005366 | Corn Rhizosphere | GAVHLALLPTNEDRAKAVVDWAGAGLTHQRSGRITVEVGDSER* |
Ga0070714_1013149822 | 3300005435 | Agricultural Soil | AWGAVHVALLPTNADRAKAVVDWAGAALTHQRVGRITVGPD* |
Ga0070713_1019689922 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | GTVHLALLPTNEDRAKAVTDWAGAMMTHQRVGRITVEAD* |
Ga0070705_1012234171 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | KAQAAWGVVHLALLPTNEDRAKAVVSWAGAATTHQRVGRITVEAE* |
Ga0066682_108320652 | 3300005450 | Soil | AWGAVHLELLPTNEDRAKAIIDWAGSAFTHQRAGRITVESE* |
Ga0070678_1021831492 | 3300005456 | Miscanthus Rhizosphere | VHLALLPTNEDRAKAVVDWAGSELTHQRVGRITVDTEEDD* |
Ga0070662_1007107962 | 3300005457 | Corn Rhizosphere | ATVHLALLPTNEDRAKAVVDWAGATFTHQRAGRITVENE* |
Ga0073909_102742151 | 3300005526 | Surface Soil | GVVHLALLPTNEDRAKAVVDWAGAAFTHQRVGRITVEAD* |
Ga0070679_1013707201 | 3300005530 | Corn Rhizosphere | QLAWGTVHLALLPTNEDRAKAVVEWAGAGLTHQRSARITVET* |
Ga0070684_1010057942 | 3300005535 | Corn Rhizosphere | AWRAVHLALLPTNEDRAKAVVDWAGSELTHQRVGRISVGPDE* |
Ga0070697_1003270903 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | GKKAQLAWGTVHLALLPTNEDRAKAVVDWAGAGFTHQRGARITVDT* |
Ga0070704_1013840221 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | AWGTVHLALLPTNEDRAKAVVEWAGAGLTHQRSARITVET* |
Ga0066694_105642332 | 3300005574 | Soil | TVHLALLPTNEDRAKAVVDWAGAGLTHQRSGRIRVET* |
Ga0068857_1001922771 | 3300005577 | Corn Rhizosphere | AQLAWATVHLALLPTNENRAKAIVDWAGAGLTHQRSARISVET* |
Ga0068852_1020807872 | 3300005616 | Corn Rhizosphere | LALLPTNEDRAKAVVDWAGSELTHQRVGRISVEPDE* |
Ga0066903_1003990093 | 3300005764 | Tropical Forest Soil | WLGVHMMLLPTNEDRAKALVDWAGAGISHQRVGRIMVGRE* |
Ga0066903_1009228012 | 3300005764 | Tropical Forest Soil | HLALLPTNEDRAKAVVDWAGALMTHQRVGRITVESD* |
Ga0066903_1010298871 | 3300005764 | Tropical Forest Soil | TVHLALLPTNEDRAKAIVDWAGAGLTHQRTGRITVDSEEGRAG* |
Ga0066903_1015471441 | 3300005764 | Tropical Forest Soil | AQLAWGTVHLALLPTNEDRAKAVVSWAGAAMTHQRAGRITVEGD* |
Ga0066903_1017138541 | 3300005764 | Tropical Forest Soil | HLALLPTNEDRAKAIVDWVGAGLTHQRIGRITVETGKEA* |
Ga0066903_1021127702 | 3300005764 | Tropical Forest Soil | KAQVAWGTVHLALLPTNEDRAKAVVDWAGAGMTHQRVGRITVGSE* |
Ga0066903_1029866632 | 3300005764 | Tropical Forest Soil | AKAQVAWGTVHLALLPTNEDRAKAVVDWAGAAFTHQRSGRIRVET* |
Ga0066903_1032285921 | 3300005764 | Tropical Forest Soil | VHLALLPTNEDRAKAVVSWFGAATTHQRVGRITVEAE* |
Ga0066903_1059146862 | 3300005764 | Tropical Forest Soil | VHLALLPTNEDRAKAVVDWAGATFTHQRVGRITVGTD* |
Ga0066903_1062787102 | 3300005764 | Tropical Forest Soil | TVHLALLPTNEDRAKAVVDWAGAGLTHQRTGRITIDSEEGRAG* |
Ga0068870_105458741 | 3300005840 | Miscanthus Rhizosphere | VHLALLPTNEDRAKAVVDWAGSELTHQRVGRISVGPDE* |
Ga0068870_105674211 | 3300005840 | Miscanthus Rhizosphere | QFAWRAVHLALLPTNEDRAKAVVDWAGSELTHQRVGRISVGPDE* |
Ga0068863_1005300112 | 3300005841 | Switchgrass Rhizosphere | HLALLPTNEDRAKAVVSWAGAATTHQRVGRITVEAE* |
Ga0068863_1010513592 | 3300005841 | Switchgrass Rhizosphere | QFAWRAVHLALLPTNEDRTKAVVDWAGSELTHQRVGRISVGPDE* |
Ga0075015_1007244982 | 3300006102 | Watersheds | WGAVHLARLPTNEDRAKAAVDWSGAMLTHQRVGRITVSTDDE* |
Ga0070715_108893021 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | GKAAQVAWGTVHLALLPTNQDRAKAVVDWAGAGLTHQRGARITVES* |
Ga0097621_1012619362 | 3300006237 | Miscanthus Rhizosphere | LALLPTNEDRAKAVVDWAGAGLTHQRAARITVET* |
Ga0068871_1017493001 | 3300006358 | Miscanthus Rhizosphere | LALLPTNEDRAKAVVDWAGAGLTHQRGARITVET* |
Ga0074051_111689921 | 3300006572 | Soil | VHLALLPTNEDRAKAVVDWSGAAFTHQRVGRIIVRADE* |
Ga0074051_117546662 | 3300006572 | Soil | AWGTVHLALLPTNEDRAKAVVDWAGAGLTHQRPGRITVETDDDRR* |
Ga0074053_119519793 | 3300006575 | Soil | LLPTNEDRAKAIVDWAGAAMTHQRVGRITVDTDDKE* |
Ga0074047_115988111 | 3300006576 | Soil | TVHLALLPTNEDRAKAVVDWAGAGFTHERSARISVET* |
Ga0074049_124497592 | 3300006580 | Soil | GLKAQLAWGTVHLALLPTNEDRAKAVVSWVGAAMTHQRAGRITVEDE* |
Ga0074062_125313292 | 3300006606 | Soil | LAWGTVHLALLPTNDDRAKAVVSWAGAAMTHQRVGRITVEDE* |
Ga0066653_101981872 | 3300006791 | Soil | ALLPTNADRAKAVVDWAGAGFTHQRVGRIIVGSE* |
Ga0066659_103441082 | 3300006797 | Soil | ASVAWGTVHLALLPTNEDRAKAVVDWAGAGLTHQRGARITVET* |
Ga0079220_115734371 | 3300006806 | Agricultural Soil | KAQAAWGAVHLALLPTNEDRAKAVVDWVGAATTHQRAGRITVERS* |
Ga0075428_1000797601 | 3300006844 | Populus Rhizosphere | AQFAWRTVHLALLPTNEDRAKAIVDWAGSEFTHQRVGRISVDADE* |
Ga0075428_1013287811 | 3300006844 | Populus Rhizosphere | WGTVHLALLPTNEDRAKAVVDWAGAAFTHERAGRITVET* |
Ga0075421_1014482001 | 3300006845 | Populus Rhizosphere | GRKAQFAWRTVHLALLPTNEDRAKAIVDWAGSELTHQRVGRISVDADE* |
Ga0075434_1006973931 | 3300006871 | Populus Rhizosphere | HKAQFAWRTVHLALLPTNEDRAKAIVDWAGSELTHQRVGRITVDENE* |
Ga0079219_106315772 | 3300006954 | Agricultural Soil | AWGSVHLALLPTNEDRAKAVVAWAGAGLTHQRSARIRVET* |
Ga0075435_1019270372 | 3300007076 | Populus Rhizosphere | VHLALLPTNEDRAKAVVDWAGAGLTHQRSARITVET* |
Ga0066710_1009224683 | 3300009012 | Grasslands Soil | VHLALLPTNEDRAKAVVSWAGGATTHQRAGRITVEAE |
Ga0075418_106049001 | 3300009100 | Populus Rhizosphere | LALLPTNEDRAKAVVDWAGAAFTHQRTGRITVETDQDSSR* |
Ga0114129_109839851 | 3300009147 | Populus Rhizosphere | AWGTVHLALLPTNEDRAKAVVDWAGAGLTHQRTGRITVETDQDSSR* |
Ga0114129_111887522 | 3300009147 | Populus Rhizosphere | HLALLPTNEDRAKAIVDWAGSELTHQRVGRISVDTDE* |
Ga0111538_100492681 | 3300009156 | Populus Rhizosphere | RAVHLALLPTNEDRAKAVVDWAGSELTHQRVGRISVAEDE* |
Ga0075423_128675181 | 3300009162 | Populus Rhizosphere | WGTVHLAVLPTNEDRAKAVVDWAGAMFTHQRAGRITVEDE* |
Ga0105242_114479712 | 3300009176 | Miscanthus Rhizosphere | AWGTVHLALLPTNEDRAKAVVDWAGAGLTHQRGARITVET* |
Ga0105248_115100181 | 3300009177 | Switchgrass Rhizosphere | QFAWRTVHLALLPTNEDRAKAIVDWAGSQLTHQRVGRISVDADE* |
Ga0105248_125096611 | 3300009177 | Switchgrass Rhizosphere | LPTNEDRAKAVVEWAGAAFSHQRTGRITVTSDSD* |
Ga0105248_131920102 | 3300009177 | Switchgrass Rhizosphere | HLALLPTNEDRAKAVVDWAGAGFTHQRSARISVET* |
Ga0105237_114158883 | 3300009545 | Corn Rhizosphere | TVHLALLPTTEDRAKAVVSWAGAAMTHQRAGRITVEDD* |
Ga0105238_119566391 | 3300009551 | Corn Rhizosphere | TVHLALLPTNEDRAHAVVDWAGAALTHQRTGRITVKTDDA* |
Ga0105249_105437451 | 3300009553 | Switchgrass Rhizosphere | PTNEDRAKAVVDWAGAAFTHQRTGRITVETDQDSSR* |
Ga0105064_11343611 | 3300009821 | Groundwater Sand | LPTNEDRAKAVVDWAGAGLTHQRAGRITVRTEEAE* |
Ga0126308_100614993 | 3300010040 | Serpentine Soil | MAWGTVHLALLPTNQDRAKAVVDLAGAGLTHQRSGRIMVDVGEPAEKR* |
Ga0126314_112851072 | 3300010042 | Serpentine Soil | WGAVHLALLPTNEDRAKAVVDWAGAALTHQRVGRISVGSE* |
Ga0134065_102306741 | 3300010326 | Grasslands Soil | SAQVAWATVHLALLPTNENRAKAVVDWAGAGLTHQRSARISVET* |
Ga0134080_105845042 | 3300010333 | Grasslands Soil | LAWGAVHLALLPTNNDRAKAVVSWSGAALTHQRVGRITVEED* |
Ga0126370_119383142 | 3300010358 | Tropical Forest Soil | ALLPTNEDRAKAVVSWFGAATSHQRVGRITVEAD* |
Ga0126376_114976541 | 3300010359 | Tropical Forest Soil | VHLALLPTNEDRAKAVVDWAGATFTHQRTGRIRVET* |
Ga0126372_132804951 | 3300010360 | Tropical Forest Soil | LALLPTNEDRAKAVVSWVGAATTHQRVGRITVGAD* |
Ga0134128_109344642 | 3300010373 | Terrestrial Soil | LAWGTVHLALLPTNEDRAKAVVEWAGAGLTHQRSARITVET* |
Ga0105239_135895851 | 3300010375 | Corn Rhizosphere | FTGKKAQIAWGVVHLALLPTNEDRAKAIVDWAGSTLTHQRVGRITVGSE* |
Ga0126381_1017939811 | 3300010376 | Tropical Forest Soil | AQAAWGVVHLALLPTNEDRAKAVVDWAGAAATHQRVGRITVEHS* |
Ga0126381_1034309862 | 3300010376 | Tropical Forest Soil | WGTVHLALLPTNEARAKAVVDWAGAGLTHQRAGRITVPTDEHART* |
Ga0134126_129282322 | 3300010396 | Terrestrial Soil | HLALLPTNEDRAKAVVDWAGAGLTHQRGARITVET* |
Ga0134122_112572372 | 3300010400 | Terrestrial Soil | KKAQVAWGTVHLALLPTNQDRAKAIVDWAGAAMTHQRAGRIRVERS* |
Ga0134123_126949052 | 3300010403 | Terrestrial Soil | AWATVHLALLPTNEDRAKAVVDWAGATFTHQRAGRITVESE* |
Ga0138505_1000043241 | 3300010999 | Soil | AAWGPVHLALLPTNEDRAKAVVDWAGAGLTHQRGARITVET* |
Ga0138513_1000058801 | 3300011000 | Soil | AQLAWATVHLALLPTNEDRAKAVVDWAGATFSHQRAGRITVEDE* |
Ga0151490_14594531 | 3300011107 | Soil | ALLPTNEDRAKAVVSWAGAAMTHQRAGRITVEDD* |
Ga0105246_102431092 | 3300011119 | Miscanthus Rhizosphere | RAVHLALLPTNEDRAKAVVDWAGSELTHQRVGRISVGPDE* |
Ga0105246_108875232 | 3300011119 | Miscanthus Rhizosphere | FAWRAVHLALLPTNEDRAKAVVDWAGSELTHQRVGRISVGEDE* |
Ga0105246_124801622 | 3300011119 | Miscanthus Rhizosphere | RAVHLALLPTNEDRTKAVVDWAGSELTHQRVGRISVGQDE* |
Ga0137370_106385472 | 3300012285 | Vadose Zone Soil | KGKKAQVAWGTVHLALLPTNEDRAKAVVDWAGAGLTHQRSGRIRVET* |
Ga0137366_109612091 | 3300012354 | Vadose Zone Soil | KSAQMAWATVHLALLPTNESRAKAVVDWAGAGLTHQRSGRITVET* |
Ga0134039_12075691 | 3300012374 | Grasslands Soil | GKLASAAWGSVHLALLPTNQDRAKAVVDWAGAGLTHQREARITVET* |
Ga0134040_12857321 | 3300012389 | Grasslands Soil | WGSVHLALLPTNQDRAKAVVDWAGAGLTHQREARITVET* |
Ga0157337_10207302 | 3300012483 | Arabidopsis Rhizosphere | ALLPTNEDRAKAVVDWAGAAFTHQRTGRITVGDD* |
Ga0157355_10435582 | 3300012493 | Unplanted Soil | LLPTNEDRAKAVVDWAGAVTTHQRVGRIHVEAGVARADGL |
Ga0157324_10219461 | 3300012506 | Arabidopsis Rhizosphere | LALLPTNEDRAKAVVDWAGSELTHQRVGRISVAEDE* |
Ga0157300_10193151 | 3300012884 | Soil | AKAQLAWGTVHLALLPTNEDRAKAVVSWAGAAMTHQRAGRITVEDD* |
Ga0157303_101042441 | 3300012896 | Soil | KGKKAQLAWGTVHLALLPTNQDRAKAVVDWAGAGLTHQRSGRIRVET* |
Ga0157296_103311421 | 3300012905 | Soil | LLPTNEDRAKAVVDWAGSELTHQRVGRISVGQDE* |
Ga0157283_102523372 | 3300012907 | Soil | ALLPTNEDRAKAVVSWAGAATTHQRVGRITVEAE* |
Ga0157301_101385641 | 3300012911 | Soil | LLPTNEDRAKAIVDWAGSQLTHQRVGRISVDADE* |
Ga0157306_101596251 | 3300012912 | Soil | APLPTNEDRTKAIVDWAGSELTHQRVGRIRVDEDEQ* |
Ga0157297_101856192 | 3300012914 | Soil | ALLPTNEDRAKAVVDWAGATFTHQRAGRITVESE* |
Ga0126375_111948562 | 3300012948 | Tropical Forest Soil | GKKAQVAWGTVHLALLPTNEDRAKAVVDWAGATFTHQRVGRITVGSE* |
Ga0164298_109065601 | 3300012955 | Soil | KAQAAWGAVHLALLPTNEDRAKAVVSWFGAATTHQRVGRITVEAE* |
Ga0164299_102836933 | 3300012958 | Soil | AWGTVHLALLPTNESRAKAIVDWAGAGLTHQRSARISVET* |
Ga0164302_109507503 | 3300012961 | Soil | TAQVAWGTVHLALLPTNESRAKAVVDWAGAGLTHQRSARISVET* |
Ga0164302_118152761 | 3300012961 | Soil | TGTAAQAAWAAVHLALLPTNEDRAKAVVDWAGATFSHQRVGRITVGSE* |
Ga0126369_123935092 | 3300012971 | Tropical Forest Soil | WLTVHMALLPTNEDRAKAVVDWAGAALTHQRTGRITVEST* |
Ga0126369_124130652 | 3300012971 | Tropical Forest Soil | KAQLAWSAVHLALLPTNEDRARAVVDWAGATMTHQRAGRITVESS* |
Ga0134110_103419891 | 3300012975 | Grasslands Soil | AVHLALLPTNEDRAKAVVSWAGAATTHQRAGRITVEAE* |
Ga0164308_119986602 | 3300012985 | Soil | WRTVHLALLPTNEDRAKAVVDWAGSELTHQRVGRITVDTEEDD* |
Ga0164304_113342381 | 3300012986 | Soil | QAAWGTVHLALLPTNSDRAKAVVDWAGAGLTHQRSGRIRVKT* |
Ga0164307_106073641 | 3300012987 | Soil | HLALLPTNEDRAKAVVDWAGAAFTHQRVGRITVHTDEPDIG* |
Ga0164307_108713321 | 3300012987 | Soil | TGKKAQFAWGTVHLALLPTNEDRARAVVAWAGAGFSHQRVGRITVEAD* |
Ga0164305_108251253 | 3300012989 | Soil | WGTVHLALLPTNESRAKAVVDWAGAGLTHQRSARISVET* |
Ga0157373_112099481 | 3300013100 | Corn Rhizosphere | AAWGVVHLALLPTNEDRAKAIVDWSGAALTHQRTGRISYESDVNASR* |
Ga0157370_109141592 | 3300013104 | Corn Rhizosphere | VHLALLPTNEDRAKAVVDWAGAGLTHQRGARITVET* |
Ga0157375_118092141 | 3300013308 | Miscanthus Rhizosphere | TVHLALLPTNEDRANAVVEWAGAGLTHQRAGRITVTTDEL* |
Ga0163163_120423851 | 3300014325 | Switchgrass Rhizosphere | HLALLPTNEDRAKAVVDWAGSELTHQRVGRISVGPDE* |
Ga0157380_126766491 | 3300014326 | Switchgrass Rhizosphere | KKAQLAWGTVHLALLPTNEDRAKAVIDWAGAGLTHQRVGRITVESE* |
Ga0157377_100172854 | 3300014745 | Miscanthus Rhizosphere | AQFAWRAVHLALLPTNEDRAKAVVDWAGSELTHQRVGRISVAEDE* |
Ga0134073_100594001 | 3300015356 | Grasslands Soil | AQAAWGTVHLALLPTNQDRAKAVVDWAGAGLTHQRSGRIRVET* |
Ga0134073_104106002 | 3300015356 | Grasslands Soil | LAWGTVHLALLPTNQDRAKAVVDWSGAVLTHQRAGRITVAADD* |
Ga0134072_101325062 | 3300015357 | Grasslands Soil | VASAAWGSVHLALLPTNQDRAKAVVDWAGAGLTHQREARITVET* |
Ga0132256_1004356482 | 3300015372 | Arabidopsis Rhizosphere | GTVHLALLPTNEDRAKAVVDWAGSAFTHQRVGRISVGSE* |
Ga0132256_1012320641 | 3300015372 | Arabidopsis Rhizosphere | KKAQVAWGTVHLALLPTNEDRAKAVVDWAGATFTHQRSGRIRVET* |
Ga0132257_1002347353 | 3300015373 | Arabidopsis Rhizosphere | LAWGTVHLALLPTNESRAKAIVDWAGAGLTHQRSARISVET* |
Ga0132257_1013353451 | 3300015373 | Arabidopsis Rhizosphere | GAVHLALLPTNEDRAKAVVDWAGSVLTHQRVGRITVGND* |
Ga0132257_1031336512 | 3300015373 | Arabidopsis Rhizosphere | VHLALLPTNEDRAKAVVSWAGAAFTHQRADRITVEGE* |
Ga0132255_1011377102 | 3300015374 | Arabidopsis Rhizosphere | AVHLALLPTNEDRTKAVVDWAGSELTHQRVGRISVDADE* |
Ga0132255_1041824651 | 3300015374 | Arabidopsis Rhizosphere | AQFAWRTVHLALLPTNEDRAKAIVDWGGSELTHQRVGRISVDADE* |
Ga0182035_111134571 | 3300016341 | Soil | LLPTNEDRAKAIVDWAGAGLTHQRTGRITVSANSD |
Ga0182035_112713281 | 3300016341 | Soil | QLAWGTVHLALLPTNEDRAKAVVSWAGAAFTHQRVGRITVGAD |
Ga0182038_103658081 | 3300016445 | Soil | VHLALLPTNEDRAKAVVDWAGSQLTHQRVGRISVEVEE |
Ga0182038_105643971 | 3300016445 | Soil | KAQVAWSTVHLALLPTNEDRAKAVVDWAGAGLTHQRVGRITVET |
Ga0163161_111292123 | 3300017792 | Switchgrass Rhizosphere | HLALLPTNQDRAKAVVDWAGAGLTHQRGARITVES |
Ga0187785_107628772 | 3300017947 | Tropical Peatland | VHLALLPTNEDRAKAVVDWAGAATTHQRVGRITVEAD |
Ga0187778_106573261 | 3300017961 | Tropical Peatland | LAWLTVHMALLPTNEDRAKALVDWAGAGLTHQRPGRFTVESR |
Ga0184605_101137502 | 3300018027 | Groundwater Sediment | SLAWGTVHLALLPTNEDRAKAVVDWAGAGLTHQREARITVET |
Ga0184619_103201152 | 3300018061 | Groundwater Sediment | AWGTVHLALLPTNEDRAKAVVDWAGAGLTHQRAARITVET |
Ga0184625_102075391 | 3300018081 | Groundwater Sediment | KAQFAWRAVHLALLPTNEDRAKAVVDWVGSELTHQRVGRITVDVDE |
Ga0190270_130025791 | 3300018469 | Soil | WGAVHLALLPTNEDRAKAVIDWAGATFTHQRVGRITVGDE |
Ga0190274_133620191 | 3300018476 | Soil | QVAWGTVHLALLPTNEDRAKAVVDWAGAAFTHERAARITVET |
Ga0190271_104958072 | 3300018481 | Soil | ALLPTNEDRAKAIVDWAGSAFTHQRTGRITVESDADAGRGTT |
Ga0066669_111187782 | 3300018482 | Grasslands Soil | VHLALLPTNQDRAKAVVDWAGAGLTHQREARITVET |
Ga0184642_12082542 | 3300019279 | Groundwater Sediment | WGTVHLALLPTNEDRAKAVVDWAGAGLTHQREARITVET |
Ga0173481_104722662 | 3300019356 | Soil | AKAQLAWGTVHLALLPTNEDRAKAVVSWAGAAMTHQRAGRITVEDD |
Ga0187892_103621171 | 3300019458 | Bio-Ooze | VHLALLPTNEDRAKAIVDWAGSELAHQRVGRFTVEGE |
Ga0193747_10488542 | 3300019885 | Soil | VGGKKAQVAWGTVHLALLPTNEDRAKAVVDWAGAGLTHQRSGRIRVET |
Ga0193697_10519061 | 3300020005 | Soil | AQLAWGAVHLALLPTNEDRAKAVVDWAGAGFTHQRAGRITVEVGDSER |
Ga0193726_12882731 | 3300020021 | Soil | WGTVHLALLPTNEDRAKAVVDWAGAGLTHQRGARITVET |
Ga0222623_103247972 | 3300022694 | Groundwater Sediment | LPTNEDRAKAVVDWAGAGFTHQRAGRITVEVGDSER |
Ga0222622_103004972 | 3300022756 | Groundwater Sediment | VHLALLPTNEDRAKAVVDWAGSEFTHQRVGRISVDADE |
Ga0247801_10799951 | 3300023064 | Soil | LAWATVHLALLPTNEDRAKAVVDWAGATFTHQRAGRITVESE |
Ga0247802_10091631 | 3300023077 | Soil | KAQLAWGTVHLALLPTNEDRAKAVVSWAGAAFTHQRADRITVEGE |
Ga0247794_101660321 | 3300024055 | Soil | QLAWGTLHLALLPTNEDRAKAVVEWAGAGLTHQRSARITVET |
Ga0247677_10197851 | 3300024245 | Soil | WCVLALLPTNEDRAKAVVDWAGAAMTHQRTGRIRVET |
Ga0247687_10801522 | 3300024286 | Soil | KAQAAWGAVHLALLPTNEDRAKAVVDWAGAATTHQRTGRITVERS |
Ga0247667_10247352 | 3300024290 | Soil | AWGAVHLALLPTNEDRAKAVVDWAGAATTHQRTGRITVERS |
Ga0247678_10735492 | 3300024325 | Soil | QAAWGAVHLALLPTNEDRAKAVVDWAGAATTHQRTGRITVERS |
Ga0207656_101345111 | 3300025321 | Corn Rhizosphere | QAAWGTVHLALLPTNEDRAKAIVDWAGAGLTHQRVGRITVETDEGDRAKART |
Ga0207682_106400331 | 3300025893 | Miscanthus Rhizosphere | GAKAQLAWGTVHLALLPTNEDRAKAVVDWAGAAMTHQRTGRIRVET |
Ga0207692_101253711 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | TVHLALLPTNEDRAKAVVDWAGAGFTHQRGARITVDT |
Ga0207692_106950322 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LLPTNQDRAKAVVDWAGAAFTHQRAGRISVDTDKR |
Ga0207642_105060512 | 3300025899 | Miscanthus Rhizosphere | TKAQLAWATVHLALLPTNEDRAKAVVDWAGATFTHQRAGRITVENE |
Ga0207642_109068902 | 3300025899 | Miscanthus Rhizosphere | LLPTNEDRAKAIVDWSGAALTHQRTGRISYESDVNASR |
Ga0207643_100432953 | 3300025908 | Miscanthus Rhizosphere | HLALLPTNEDRAKAVVDWAGSELTHQRVGRISVAEDE |
Ga0207643_100924823 | 3300025908 | Miscanthus Rhizosphere | HLALLPTNEDRAKAVVDWAGSELTHQRVGRISVGPDE |
Ga0207705_102016491 | 3300025909 | Corn Rhizosphere | KAQAAWGTVHLALLPTNEDRAHAVVDWAGAALTHQRTGRITVKTDDA |
Ga0207693_110130702 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | AASLAWGTVHLALLPTNEDRAKAVVDWAGAGLTHQRSGRITVET |
Ga0207663_102350161 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | HLALLPTNEDRAKAVVDWAGAAMTHQRTGRIRVET |
Ga0207663_104507451 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AKAQLAWGTVHLALLPTNEDRAKAVVDWAGAAMTHQRTGRIRVET |
Ga0207649_109700072 | 3300025920 | Corn Rhizosphere | TKAQLAWATVHLALLPTNEDRAKAVVDWAGATFTHQRAGRITVESE |
Ga0207659_107975982 | 3300025926 | Miscanthus Rhizosphere | KAQFAWRAVHLALLPTNEDRAKAVVDWAGSELTHQRVGRISVAEDE |
Ga0207687_102966081 | 3300025927 | Miscanthus Rhizosphere | AWGTVHLALLPTNEDRAKAVVDWAGAGLTHQRGARITVET |
Ga0207700_102533272 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GKKAQLAWGTVHLALLPTNEDRAKAVVDWAGAGLTHQRSGRIRVET |
Ga0207690_102759132 | 3300025932 | Corn Rhizosphere | LALLPTNEDRAKAVVDWAGSELTHQRVGRISVGPDE |
Ga0207706_105377691 | 3300025933 | Corn Rhizosphere | AQMAWGTVHLALLPTNEDRAKAVVDWAGAGFTHQRSGRIRVET |
Ga0207686_109254342 | 3300025934 | Miscanthus Rhizosphere | TVHLALLPTNEDRAKAIIDWAGSQLTHQRVGRISVDADE |
Ga0207689_103788052 | 3300025942 | Miscanthus Rhizosphere | FAWRAVHLALRPTNEDRAKAVVDWAGSELTHQRVGRISVAEDE |
Ga0207661_101349453 | 3300025944 | Corn Rhizosphere | QFAWRTVHLALLPTNEDRAKAVVDWAGSELTHQRVGRISVGPDE |
Ga0207679_100935081 | 3300025945 | Corn Rhizosphere | ATVHLALRPTNENRAKAIVDWAGAGLTHQRSARISVET |
Ga0207668_101627301 | 3300025972 | Switchgrass Rhizosphere | RAVHLALLPTNEDRAKAVVDWAGSELTHQRVGRISVGPDE |
Ga0207708_100445211 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | HLALLPTNEDRAKAVVDWAGATFTHQRAGRITVEKE |
Ga0207708_110823291 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MKGKTAFVAWGTVHLALLPTNEDRAKAIVDWAGAGLTHQRQARITVET |
Ga0207702_113810391 | 3300026078 | Corn Rhizosphere | GKKAQVAWGTVHLALLPTNEDRAKAVVDWAGATLTHQRSGRIRVET |
Ga0207683_107372291 | 3300026121 | Miscanthus Rhizosphere | LPTNEDRAKAVVDWAGSELTHQRVGRITVDTEEDD |
Ga0207698_120536262 | 3300026142 | Corn Rhizosphere | AWGTVHLALLPTNEDRAKAVVEWAGAGLTHQRSARITVET |
Ga0209156_102143671 | 3300026547 | Soil | MTGKKASLAWGTVHLALLPTNEDRAKAVVDWAGAGLTHQRQARITVEP |
Ga0209156_103700601 | 3300026547 | Soil | KTAQLAWGTVHLALLPTNEDRAKAVVDWAGAGLTHQRQARITVET |
Ga0209474_103786841 | 3300026550 | Soil | TGLKAQGAWGAVHLALLPTNEDRAKAVVSWAGAATTHQRAGRITVGSE |
Ga0209876_10049141 | 3300027041 | Groundwater Sand | RAVHLALLPTNEDRAKAVVDWVGSELTHQRVGRITVDVDE |
Ga0209842_10730793 | 3300027379 | Groundwater Sand | ATVHLALLPTNEDRAKAVVDWAGAGLTHQRSGRITVET |
Ga0209843_10685913 | 3300027511 | Groundwater Sand | KAAQLAWGTVHLALLPTNEDRAKAVVDWAGAGLTHQRAGRITVRTEEAE |
Ga0209974_102198982 | 3300027876 | Arabidopsis Thaliana Rhizosphere | FAWRAVHLALLPTNEDRAKAVVDWAGSELTHQRVGRISVGPDE |
Ga0207428_100602961 | 3300027907 | Populus Rhizosphere | AWRAVHLALLPTNEDRAKAVVDWAGSELTHQRVGRISVGPDE |
Ga0247822_113251931 | 3300028592 | Soil | ALLPTNEDRAKAIVDWAGAGLTHQRTGRISYESEVNTSR |
Ga0247822_116648282 | 3300028592 | Soil | AWGAVHLALLPTNEDRAHAVVDWAGAALTHQRTGRITVETGGE |
Ga0247821_106291331 | 3300028596 | Soil | GVHLALLPTNEDRAKAVIDWAGATFTHQRVGRITIDDE |
Ga0247820_107359031 | 3300028597 | Soil | WGTVHLALLPTNEDRAHAVVDWAGAALTHQRTGRITVDTGGE |
Ga0307295_101198012 | 3300028708 | Soil | GKTASLAWGTVHLALLPTNEDRAKAVVDWAGAGLTHQREARITVET |
Ga0307311_100038251 | 3300028716 | Soil | VHLALLPTNEDRAKAVVDWAGAGLTHQRSGRITVET |
Ga0307298_101089143 | 3300028717 | Soil | WGTVHLALLPTNQDRAKAVVDWAGAGLTHQRGARITVES |
Ga0307317_102110021 | 3300028720 | Soil | LGLLPTNEDRAKAVVSWAGAAMTHRPVGRLSVEND |
Ga0307319_100264643 | 3300028722 | Soil | WATVHLALLPTNEDRAKAVVDWAGATFSHQRAGRITVENE |
Ga0307319_102535911 | 3300028722 | Soil | AQLAWGTVHLMLLPTNESRAKALVDWAGAGLTHQRSARITVET |
Ga0307320_100775711 | 3300028771 | Soil | VHLALLPTNEDRANAVVDWVGSELTHQRVGRITVDEDE |
Ga0307288_101500013 | 3300028778 | Soil | RKAQLAWGTVHLALLPTNEDRAKAVVDWAGAGLTHQRSARITVET |
Ga0307323_100713121 | 3300028787 | Soil | HLALLPTNEDRANAVVDWVGSELTHQRVGRITVDEDE |
Ga0307290_101309421 | 3300028791 | Soil | WGAVHLALLPTNEDRAKAVVDWAGAGFTHQRAGRITVEVGDSER |
Ga0307299_100721431 | 3300028793 | Soil | AVHLALLPTNEDRAKAVVDWAGAGFTHQRAGRITVEVGDSER |
Ga0307287_101746032 | 3300028796 | Soil | KGKTASLAWGTVHLALLPTNEDRAKAVVDWAGAGLTHQRSGRITVET |
Ga0307287_101926781 | 3300028796 | Soil | GTVHLALLPTNEDRAKAVVDWAGAGMTHQREARITVET |
Ga0247825_110378553 | 3300028812 | Soil | VHLALLPTNEDRAKAVIDWAGATFTHQRVGRITIDDE |
Ga0307302_102641512 | 3300028814 | Soil | WGTVHLALLPTNEDRAKAVVDWAGAGLTHQREARITVEP |
Ga0307302_103090671 | 3300028814 | Soil | QAAWGVVHLALLPTNEDRAKAVVDWAGAALTHQRAGRITVEAE |
Ga0307314_101358771 | 3300028872 | Soil | VHLALLPTNEDRAKAVVDWAGAGLTHQREARITVET |
Ga0307314_102033082 | 3300028872 | Soil | VHLALLPTNEDRAKAVVDWAGAGLTHQRAARITVET |
Ga0307289_101290562 | 3300028875 | Soil | GTVHLALLPTNEDRAKAVVDWAGAGLTHQRAARITVET |
Ga0307277_105650442 | 3300028881 | Soil | HLALLPTNEDRAKAVVDWAGAGFTHQRAGRITVEVGDSER |
Ga0247826_107081442 | 3300030336 | Soil | LLPTNEDRAKAVVDWVGAGLTHQRSGRITVETDVDANP |
Ga0308204_101281472 | 3300031092 | Soil | GTVHLALLPTNQDRAKAVVDWAGAGLTHQRSARITVET |
Ga0308187_100963931 | 3300031114 | Soil | TVHLALLPTNEDRAKAVVDWAGAGLTHQRSGRITVDVGEPAEKR |
Ga0307498_100843721 | 3300031170 | Soil | TGRKAQFAWRTVHLTLLPTNEDRAKAIVDWSGSELTHQRVGRIHVEDE |
Ga0307498_104130751 | 3300031170 | Soil | WRTVHLALLPTNEDRAKAIVDWAGSEFTHQRVGRINVDLDE |
Ga0307499_103024352 | 3300031184 | Soil | LAWGTVHLALLPTNEDRAKAVVDWAGAGLTHQRSARITVDT |
Ga0307497_106903342 | 3300031226 | Soil | LAWGTVHLALLPTNEDRAKAVVDWAGAGLTHQRGARITVET |
Ga0308194_100675512 | 3300031421 | Soil | TNEDRAKAVVDWAGAGLTHQRAGRITVDTEETEPVGAKKP |
Ga0308177_10336302 | 3300031423 | Soil | GKTAQLAWATVHLALLPTNEDRAKAVVDWAGAGLTHQRSGRITVET |
Ga0310887_109016401 | 3300031547 | Soil | VVHLALLPTNEDRAKAIVDWSGAALTHQRTGRITYESDVNASR |
Ga0318571_102628111 | 3300031549 | Soil | RAKAVVDWAGATLTHQRTGRITVAAGKPESEKGAA |
Ga0310886_110421841 | 3300031562 | Soil | KGHKAQFAWRTVHLALLPTNEDRAKAIVDWAGSQLTHQRVGRISVDADE |
Ga0318515_105891672 | 3300031572 | Soil | GFKAQAAWGAVHLALLPTNEDRAKAVVDWAGAGFTHQRVGRITVSTD |
Ga0318561_108331192 | 3300031679 | Soil | ALLPTNEDRAKAVVDWAGAGLTHQRVGRISVDADEPARA |
Ga0318500_106832262 | 3300031724 | Soil | QAAWGAVHLALLPTNEDRAKAVVDWAGAGLTHQRVGRITVET |
Ga0318501_107494142 | 3300031736 | Soil | RAPRRHRALLPTNEDRAKAVVDWAGAALTHQRVGRITVGSE |
Ga0307468_1025034161 | 3300031740 | Hardwood Forest Soil | TVHLALLPTNEDRAKAIVDWAGSQLTHQRVGRIHVETDEDN |
Ga0318492_101141901 | 3300031748 | Soil | WGTVHLALLPTNEDRAKAVVDWAGAALTHQRVGRITVGSE |
Ga0318552_105430332 | 3300031782 | Soil | AWGAVHLALLPTNEDRAKAVVDWAGAGFTHQRTGRISVRADEHDTG |
Ga0318497_103462572 | 3300031805 | Soil | AWRAVHLALLPTNEDRAKAIVDWTGSQLSHQRVGRITVEEDE |
Ga0318567_102058371 | 3300031821 | Soil | AWGAVHLALLPTNEDRAKAVVDWAGATVTHQRAGRITVEHS |
Ga0318564_105255252 | 3300031831 | Soil | GKKAQVAWGTVHLALLPTNEDRAKAVVDWVGATLTHQRTGRITVSAGGAED |
Ga0310904_105374232 | 3300031854 | Soil | AWGTVHLALLPTNEDRAKAVVDWAGAAMTHQRTGRIRVET |
Ga0318551_106781872 | 3300031896 | Soil | LALLPTNEDRAKAVVDWAGATTTHQRVGRITVESG |
Ga0306926_127151042 | 3300031954 | Soil | TNEDRAKAVVDWVGGGLTHQRVGRITVDAEERESG |
Ga0310903_103038681 | 3300032000 | Soil | QLAWGTVHLALLPTNEDRAKAVVDWAGAAMTHQRTGRIRVET |
Ga0307416_1011752331 | 3300032002 | Rhizosphere | WGAVHLALLPTNEDRAHAVVDWAGAALTHQRTGRITVESGGE |
Ga0310906_101508731 | 3300032013 | Soil | FKAQAAWGTVHLALLPTNEDRAKAIVDWAGAALTHQRSGRITYESEVNTSR |
Ga0310906_113557442 | 3300032013 | Soil | LLPTNEDRAHAVVDWAGAALTHQRTGRITVDTGGE |
Ga0310896_100408213 | 3300032211 | Soil | AWRTVHLALLPTNEDRAKAIVDWAGSEFTHQRVGRIRVDEDE |
Ga0310896_106957652 | 3300032211 | Soil | KAAQMAWGTVHLALLPTNEDRAKAVVDWAGAGFTHQRSGRIRVET |
Ga0335085_119500301 | 3300032770 | Soil | KAAQLAWGTVHLALLPTNADRAKAIVDWAGAGLTHQRTGRIIVRANE |
Ga0335080_110360592 | 3300032828 | Soil | AAWGAVHLALLPTNEDRAKAVVDWAGAITTHQRVGRITVEAD |
Ga0335081_112480852 | 3300032892 | Soil | KGKKAQVAWGTVHLALLPTNEDRAKAVVDWAGAGLTHQRSARIRIET |
Ga0335083_106312792 | 3300032954 | Soil | GTVHMVLLPTNEDRVKAVVDWVGAAMTHERAGKISVGTE |
Ga0335076_117376862 | 3300032955 | Soil | WGAVHLALLPTNEDRAKAVIDWAGAGLTHQRVGRITVSTGDE |
Ga0335084_100060851 | 3300033004 | Soil | KKAQLAWLTVHMALLPTNEDRAKALVDWSGATLTHQRAGRFTVESR |
Ga0335084_115165413 | 3300033004 | Soil | AWGTVHLALLPTNEDRAKAVVSWAGAAMTHQRVGRITVEDD |
Ga0310914_113012691 | 3300033289 | Soil | RAVAAWGTVHLALLPTNEDRAKAVVDWAGAALTHQRVGRITVGSE |
Ga0247829_100269451 | 3300033550 | Soil | TKAQLAWATVHLALLPTNEDRAKAVVDWAGATLSHQRAGRITVEDE |
Ga0247830_102242032 | 3300033551 | Soil | AQFAWRAVHLALLPTNEDRAKAVVDWAGSELTHQRVGRISVEPDE |
Ga0247830_108066721 | 3300033551 | Soil | HLALLPTNEDRAKAVVDWAGATLTHQRVGRITVDDE |
Ga0364933_132986_530_637 | 3300034150 | Sediment | ALLPTNEDRAKAVVDWAGSEFTHQRVGRISVDADE |
Ga0314781_079392_510_626 | 3300034660 | Soil | VHLALLPTNEDRAKAIVDWAGSEFTHQRVGRIRVDEDE |
⦗Top⦘ |