| Basic Information | |
|---|---|
| Family ID | F011600 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 289 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MSLKAAEEVSEQVPAEDFQALEEKVYRTIELYKAAREARA |
| Number of Associated Samples | 242 |
| Number of Associated Scaffolds | 289 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.83 % |
| % of genes near scaffold ends (potentially truncated) | 98.27 % |
| % of genes from short scaffolds (< 2000 bps) | 86.16 % |
| Associated GOLD sequencing projects | 225 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.540 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.689 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.723 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.903 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.94% β-sheet: 0.00% Coil/Unstructured: 47.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 289 Family Scaffolds |
|---|---|---|
| PF00155 | Aminotran_1_2 | 34.95 |
| PF00080 | Sod_Cu | 21.11 |
| PF02190 | LON_substr_bdg | 4.84 |
| PF13521 | AAA_28 | 2.42 |
| PF12483 | GIDE | 2.08 |
| PF03484 | B5 | 2.08 |
| PF00873 | ACR_tran | 1.04 |
| PF00581 | Rhodanese | 1.04 |
| PF01979 | Amidohydro_1 | 1.04 |
| PF13414 | TPR_11 | 1.04 |
| PF03147 | FDX-ACB | 1.04 |
| PF12867 | DinB_2 | 1.04 |
| PF08238 | Sel1 | 0.69 |
| PF13177 | DNA_pol3_delta2 | 0.69 |
| PF02604 | PhdYeFM_antitox | 0.69 |
| PF01230 | HIT | 0.35 |
| PF02894 | GFO_IDH_MocA_C | 0.35 |
| PF13442 | Cytochrome_CBB3 | 0.35 |
| PF13450 | NAD_binding_8 | 0.35 |
| PF02896 | PEP-utilizers_C | 0.35 |
| PF01632 | Ribosomal_L35p | 0.35 |
| PF05164 | ZapA | 0.35 |
| PF00158 | Sigma54_activat | 0.35 |
| PF01336 | tRNA_anti-codon | 0.35 |
| PF02223 | Thymidylate_kin | 0.35 |
| PF00342 | PGI | 0.35 |
| PF00589 | Phage_integrase | 0.35 |
| PF00453 | Ribosomal_L20 | 0.35 |
| PF00707 | IF3_C | 0.35 |
| PF07238 | PilZ | 0.35 |
| PF14319 | Zn_Tnp_IS91 | 0.35 |
| PF02033 | RBFA | 0.35 |
| PF13519 | VWA_2 | 0.35 |
| PF11304 | DUF3106 | 0.35 |
| COG ID | Name | Functional Category | % Frequency in 289 Family Scaffolds |
|---|---|---|---|
| COG2032 | Cu/Zn superoxide dismutase | Inorganic ion transport and metabolism [P] | 21.11 |
| COG0072 | Phenylalanyl-tRNA synthetase beta subunit | Translation, ribosomal structure and biogenesis [J] | 3.11 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.69 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.69 |
| COG0125 | Thymidylate kinase | Nucleotide transport and metabolism [F] | 0.35 |
| COG0166 | Glucose-6-phosphate isomerase | Carbohydrate transport and metabolism [G] | 0.35 |
| COG0290 | Translation initiation factor IF-3 | Translation, ribosomal structure and biogenesis [J] | 0.35 |
| COG0291 | Ribosomal protein L35 | Translation, ribosomal structure and biogenesis [J] | 0.35 |
| COG0292 | Ribosomal protein L20 | Translation, ribosomal structure and biogenesis [J] | 0.35 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.35 |
| COG0858 | Ribosome-binding factor RbfA | Translation, ribosomal structure and biogenesis [J] | 0.35 |
| COG3027 | Cell division protein ZapA, inhibits GTPase activity of FtsZ | Cell cycle control, cell division, chromosome partitioning [D] | 0.35 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.54 % |
| Unclassified | root | N/A | 3.46 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908007|FWIRElOz_GKZ9IRQ01A10QV | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300000789|JGI1027J11758_12051996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 872 | Open in IMG/M |
| 3300001180|JGI12695J13573_1014252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 557 | Open in IMG/M |
| 3300001356|JGI12269J14319_10314744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 560 | Open in IMG/M |
| 3300001356|JGI12269J14319_10315548 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300001593|JGI12635J15846_10874990 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300001661|JGI12053J15887_10630723 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300002070|JGI24750J21931_1057884 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300002075|JGI24738J21930_10082417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300002077|JGI24744J21845_10074332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100093779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2804 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100270968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1584 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101190566 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300002568|C688J35102_118181378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 536 | Open in IMG/M |
| 3300003219|JGI26341J46601_10224844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 504 | Open in IMG/M |
| 3300003368|JGI26340J50214_10155178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 572 | Open in IMG/M |
| 3300004091|Ga0062387_100609227 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300004092|Ga0062389_102724161 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300004114|Ga0062593_100044434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2701 | Open in IMG/M |
| 3300005174|Ga0066680_10456487 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300005176|Ga0066679_10501171 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300005336|Ga0070680_101989077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 504 | Open in IMG/M |
| 3300005354|Ga0070675_100670427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 943 | Open in IMG/M |
| 3300005436|Ga0070713_100236120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1663 | Open in IMG/M |
| 3300005471|Ga0070698_100596218 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300005560|Ga0066670_10285813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1002 | Open in IMG/M |
| 3300005602|Ga0070762_10319845 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300005602|Ga0070762_10793720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 640 | Open in IMG/M |
| 3300005610|Ga0070763_10002230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 6856 | Open in IMG/M |
| 3300005712|Ga0070764_10612583 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300005718|Ga0068866_10005565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 5209 | Open in IMG/M |
| 3300005842|Ga0068858_100525246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1145 | Open in IMG/M |
| 3300005844|Ga0068862_100527450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1124 | Open in IMG/M |
| 3300005921|Ga0070766_10096161 | All Organisms → cellular organisms → Bacteria | 1747 | Open in IMG/M |
| 3300005944|Ga0066788_10136910 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005952|Ga0080026_10150222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 673 | Open in IMG/M |
| 3300006028|Ga0070717_11541352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 603 | Open in IMG/M |
| 3300006046|Ga0066652_100292158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1444 | Open in IMG/M |
| 3300006052|Ga0075029_100159953 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
| 3300006086|Ga0075019_10461113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 784 | Open in IMG/M |
| 3300006102|Ga0075015_100782205 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300006162|Ga0075030_100748725 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300006162|Ga0075030_101381267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 552 | Open in IMG/M |
| 3300006175|Ga0070712_101428051 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300006176|Ga0070765_100168332 | All Organisms → cellular organisms → Bacteria | 1968 | Open in IMG/M |
| 3300006176|Ga0070765_100586417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1051 | Open in IMG/M |
| 3300006354|Ga0075021_11128735 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300006755|Ga0079222_12118103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 557 | Open in IMG/M |
| 3300006797|Ga0066659_11194921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 635 | Open in IMG/M |
| 3300006806|Ga0079220_10887515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
| 3300006893|Ga0073928_10019180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7123 | Open in IMG/M |
| 3300006954|Ga0079219_11419098 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300009012|Ga0066710_101125605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1215 | Open in IMG/M |
| 3300009089|Ga0099828_11433082 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300009090|Ga0099827_10821600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 804 | Open in IMG/M |
| 3300009137|Ga0066709_100128366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3187 | Open in IMG/M |
| 3300009137|Ga0066709_101443466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 997 | Open in IMG/M |
| 3300009174|Ga0105241_11634826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300009519|Ga0116108_1179386 | Not Available | 625 | Open in IMG/M |
| 3300009545|Ga0105237_10270790 | All Organisms → cellular organisms → Bacteria | 1701 | Open in IMG/M |
| 3300009624|Ga0116105_1160357 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300009632|Ga0116102_1090488 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300009641|Ga0116120_1247210 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300009644|Ga0116121_1174118 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300009700|Ga0116217_10128349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1710 | Open in IMG/M |
| 3300009762|Ga0116130_1035266 | All Organisms → cellular organisms → Bacteria | 1615 | Open in IMG/M |
| 3300010048|Ga0126373_11656141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 704 | Open in IMG/M |
| 3300010048|Ga0126373_12978464 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300010339|Ga0074046_10013807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5860 | Open in IMG/M |
| 3300010341|Ga0074045_10044702 | All Organisms → cellular organisms → Bacteria | 3239 | Open in IMG/M |
| 3300010343|Ga0074044_10124782 | All Organisms → cellular organisms → Bacteria | 1727 | Open in IMG/M |
| 3300010343|Ga0074044_10261810 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300010343|Ga0074044_10874595 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300010360|Ga0126372_12555187 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300010366|Ga0126379_12423177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300010376|Ga0126381_102839705 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300010379|Ga0136449_101655262 | Not Available | 968 | Open in IMG/M |
| 3300010379|Ga0136449_101679755 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300010399|Ga0134127_10118993 | All Organisms → cellular organisms → Bacteria | 2347 | Open in IMG/M |
| 3300010399|Ga0134127_12082312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
| 3300010401|Ga0134121_10717964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 950 | Open in IMG/M |
| 3300011269|Ga0137392_10246383 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1470 | Open in IMG/M |
| 3300012096|Ga0137389_11163890 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300012096|Ga0137389_11240914 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300012096|Ga0137389_11643871 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300012206|Ga0137380_11009157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
| 3300012208|Ga0137376_10313513 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
| 3300012208|Ga0137376_11497984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 566 | Open in IMG/M |
| 3300012209|Ga0137379_11405278 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300012353|Ga0137367_10558700 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300012354|Ga0137366_10389276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1016 | Open in IMG/M |
| 3300012354|Ga0137366_11181763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300012361|Ga0137360_10120050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2043 | Open in IMG/M |
| 3300012362|Ga0137361_11914065 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300012363|Ga0137390_10390960 | Not Available | 1370 | Open in IMG/M |
| 3300012498|Ga0157345_1050071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300012923|Ga0137359_10368051 | Not Available | 1277 | Open in IMG/M |
| 3300012923|Ga0137359_10729484 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300012924|Ga0137413_11401293 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300012929|Ga0137404_10088458 | All Organisms → cellular organisms → Bacteria | 2472 | Open in IMG/M |
| 3300012929|Ga0137404_11401670 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300012960|Ga0164301_10930233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
| 3300012960|Ga0164301_11298282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300012961|Ga0164302_11090372 | Not Available | 630 | Open in IMG/M |
| 3300012975|Ga0134110_10491791 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300012986|Ga0164304_11317126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300013832|Ga0120132_1050062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300014151|Ga0181539_1076090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1474 | Open in IMG/M |
| 3300014155|Ga0181524_10194588 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300014164|Ga0181532_10050231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2757 | Open in IMG/M |
| 3300014164|Ga0181532_10483352 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300014167|Ga0181528_10430204 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300014169|Ga0181531_10233450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1120 | Open in IMG/M |
| 3300014325|Ga0163163_11499651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 736 | Open in IMG/M |
| 3300014501|Ga0182024_10654243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1305 | Open in IMG/M |
| 3300014501|Ga0182024_11436899 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300014839|Ga0182027_10106051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3378 | Open in IMG/M |
| 3300015264|Ga0137403_10511364 | Not Available | 1071 | Open in IMG/M |
| 3300015371|Ga0132258_10075032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7860 | Open in IMG/M |
| 3300015372|Ga0132256_101702877 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300015373|Ga0132257_100026425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6213 | Open in IMG/M |
| 3300015374|Ga0132255_102017748 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300015374|Ga0132255_105631980 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300016270|Ga0182036_11065946 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300016387|Ga0182040_10754871 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300017823|Ga0187818_10538798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300017942|Ga0187808_10383406 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300017955|Ga0187817_10727603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300017970|Ga0187783_10057320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 2872 | Open in IMG/M |
| 3300017972|Ga0187781_10100196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2012 | Open in IMG/M |
| 3300017974|Ga0187777_10775393 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300017975|Ga0187782_10461331 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300017995|Ga0187816_10209579 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300017995|Ga0187816_10411727 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300018012|Ga0187810_10488149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300018013|Ga0187873_1025526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2907 | Open in IMG/M |
| 3300018040|Ga0187862_10106086 | All Organisms → cellular organisms → Bacteria | 1940 | Open in IMG/M |
| 3300018040|Ga0187862_10743140 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300018042|Ga0187871_10403069 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300018043|Ga0187887_10300233 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300018046|Ga0187851_10247389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1046 | Open in IMG/M |
| 3300018047|Ga0187859_10125938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1352 | Open in IMG/M |
| 3300018085|Ga0187772_10098952 | All Organisms → cellular organisms → Bacteria | 1876 | Open in IMG/M |
| 3300018090|Ga0187770_11026834 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300018433|Ga0066667_10573768 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300018482|Ga0066669_11172847 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300019789|Ga0137408_1328627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300020006|Ga0193735_1107752 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300020021|Ga0193726_1025843 | All Organisms → cellular organisms → Bacteria | 2942 | Open in IMG/M |
| 3300020579|Ga0210407_10236144 | All Organisms → cellular organisms → Bacteria | 1423 | Open in IMG/M |
| 3300020580|Ga0210403_11275619 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300020581|Ga0210399_10052737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3270 | Open in IMG/M |
| 3300020581|Ga0210399_10224368 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
| 3300021086|Ga0179596_10593046 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300021088|Ga0210404_10602664 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300021170|Ga0210400_10577188 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300021170|Ga0210400_10657800 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300021171|Ga0210405_10532695 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300021178|Ga0210408_10949289 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300021180|Ga0210396_10337791 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
| 3300021181|Ga0210388_11644029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300021362|Ga0213882_10050879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1638 | Open in IMG/M |
| 3300021401|Ga0210393_11276344 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300021402|Ga0210385_10029585 | All Organisms → cellular organisms → Bacteria | 3540 | Open in IMG/M |
| 3300021402|Ga0210385_10245938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1313 | Open in IMG/M |
| 3300021404|Ga0210389_11194909 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300021406|Ga0210386_10821865 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300021420|Ga0210394_11755016 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300021432|Ga0210384_10259596 | All Organisms → cellular organisms → Bacteria | 1564 | Open in IMG/M |
| 3300021432|Ga0210384_10863099 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300021475|Ga0210392_10977315 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300021475|Ga0210392_11314573 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300021477|Ga0210398_10406522 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300021479|Ga0210410_10052661 | All Organisms → cellular organisms → Bacteria | 3549 | Open in IMG/M |
| 3300021479|Ga0210410_10244711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1608 | Open in IMG/M |
| 3300021560|Ga0126371_11391322 | Not Available | 833 | Open in IMG/M |
| 3300022557|Ga0212123_10911912 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300022733|Ga0224562_1001375 | All Organisms → cellular organisms → Bacteria | 1699 | Open in IMG/M |
| 3300023019|Ga0224560_102140 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1362 | Open in IMG/M |
| 3300023250|Ga0224544_1011157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1215 | Open in IMG/M |
| 3300023250|Ga0224544_1019478 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300023250|Ga0224544_1046920 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300025460|Ga0208562_1031319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1228 | Open in IMG/M |
| 3300025477|Ga0208192_1073121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300025480|Ga0208688_1015326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2081 | Open in IMG/M |
| 3300025507|Ga0208188_1006894 | All Organisms → cellular organisms → Bacteria | 3932 | Open in IMG/M |
| 3300025899|Ga0207642_10003032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5267 | Open in IMG/M |
| 3300025906|Ga0207699_10243726 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
| 3300025913|Ga0207695_10075272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3435 | Open in IMG/M |
| 3300025914|Ga0207671_10263484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1357 | Open in IMG/M |
| 3300025915|Ga0207693_10572667 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300025916|Ga0207663_10434191 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300025917|Ga0207660_10507828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 978 | Open in IMG/M |
| 3300025920|Ga0207649_10694961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
| 3300025922|Ga0207646_11148462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300025922|Ga0207646_11365632 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300025928|Ga0207700_10125486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2088 | Open in IMG/M |
| 3300025928|Ga0207700_10363833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1262 | Open in IMG/M |
| 3300025928|Ga0207700_10443477 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300025928|Ga0207700_10464980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1116 | Open in IMG/M |
| 3300025929|Ga0207664_10982166 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300025932|Ga0207690_11194224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300026041|Ga0207639_10114875 | All Organisms → cellular organisms → Bacteria | 2201 | Open in IMG/M |
| 3300026277|Ga0209350_1055745 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1139 | Open in IMG/M |
| 3300026298|Ga0209236_1103946 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300026309|Ga0209055_1150108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 802 | Open in IMG/M |
| 3300026333|Ga0209158_1041698 | All Organisms → cellular organisms → Bacteria | 1925 | Open in IMG/M |
| 3300026474|Ga0247846_1062757 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300026475|Ga0257147_1078348 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300026514|Ga0257168_1113584 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300026945|Ga0207743_1034059 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300027066|Ga0208236_1003857 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300027334|Ga0209529_1016730 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1234 | Open in IMG/M |
| 3300027371|Ga0209418_1032006 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300027516|Ga0207761_1017382 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300027548|Ga0209523_1109489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300027662|Ga0208565_1041499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1514 | Open in IMG/M |
| 3300027667|Ga0209009_1039661 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300027692|Ga0209530_1226848 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300027706|Ga0209581_1212160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 606 | Open in IMG/M |
| 3300027729|Ga0209248_10153633 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300027855|Ga0209693_10412806 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300027869|Ga0209579_10117136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1415 | Open in IMG/M |
| 3300027869|Ga0209579_10487493 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300027879|Ga0209169_10592484 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300027884|Ga0209275_10043812 | All Organisms → cellular organisms → Bacteria | 2122 | Open in IMG/M |
| 3300027898|Ga0209067_10029986 | All Organisms → cellular organisms → Bacteria | 2774 | Open in IMG/M |
| 3300027908|Ga0209006_10036537 | All Organisms → cellular organisms → Bacteria | 4441 | Open in IMG/M |
| 3300027908|Ga0209006_10386085 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300027910|Ga0209583_10625560 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300027911|Ga0209698_10219422 | All Organisms → cellular organisms → Bacteria | 1530 | Open in IMG/M |
| 3300027911|Ga0209698_10752022 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300028013|Ga0265350_105534 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300028023|Ga0265357_1044055 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300028047|Ga0209526_10549514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300028650|Ga0302170_10019366 | All Organisms → cellular organisms → Bacteria | 1928 | Open in IMG/M |
| 3300028746|Ga0302233_10407731 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300028747|Ga0302219_10053426 | All Organisms → cellular organisms → Bacteria | 1506 | Open in IMG/M |
| 3300028773|Ga0302234_10437312 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300028775|Ga0302231_10345056 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300028795|Ga0302227_10117758 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300028882|Ga0302154_10309245 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300028906|Ga0308309_10288022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1385 | Open in IMG/M |
| 3300028909|Ga0302200_10144960 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300029882|Ga0311368_10284335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1261 | Open in IMG/M |
| 3300029913|Ga0311362_10088563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4213 | Open in IMG/M |
| 3300029913|Ga0311362_11157326 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300029914|Ga0311359_10083164 | All Organisms → cellular organisms → Bacteria | 3177 | Open in IMG/M |
| 3300029943|Ga0311340_11000225 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300029984|Ga0311332_10670322 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300029987|Ga0311334_10421095 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300030618|Ga0311354_10614089 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300030646|Ga0302316_10467539 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300030737|Ga0302310_10370266 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300030906|Ga0302314_11623445 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300030940|Ga0265740_1052646 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300031057|Ga0170834_107102644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1180 | Open in IMG/M |
| 3300031122|Ga0170822_12108739 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300031236|Ga0302324_100381930 | All Organisms → cellular organisms → Bacteria | 2111 | Open in IMG/M |
| 3300031249|Ga0265339_10042255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2524 | Open in IMG/M |
| 3300031708|Ga0310686_107033414 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300031715|Ga0307476_10285813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1208 | Open in IMG/M |
| 3300031718|Ga0307474_11449475 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300031719|Ga0306917_10727205 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300031740|Ga0307468_101620445 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300031754|Ga0307475_10026866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4124 | Open in IMG/M |
| 3300031823|Ga0307478_10164044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1770 | Open in IMG/M |
| 3300031890|Ga0306925_10243691 | Not Available | 1938 | Open in IMG/M |
| 3300032160|Ga0311301_12150145 | Not Available | 643 | Open in IMG/M |
| 3300032180|Ga0307471_100081479 | All Organisms → cellular organisms → Bacteria | 2849 | Open in IMG/M |
| 3300032180|Ga0307471_100361977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1565 | Open in IMG/M |
| 3300032180|Ga0307471_104074659 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300032783|Ga0335079_10437087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1405 | Open in IMG/M |
| 3300032805|Ga0335078_10428668 | All Organisms → cellular organisms → Bacteria | 1725 | Open in IMG/M |
| 3300032805|Ga0335078_10500428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1562 | Open in IMG/M |
| 3300032898|Ga0335072_10062164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4953 | Open in IMG/M |
| 3300032898|Ga0335072_10871053 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300032954|Ga0335083_11181055 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300032955|Ga0335076_10213046 | All Organisms → cellular organisms → Bacteria | 1832 | Open in IMG/M |
| 3300032955|Ga0335076_11454764 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300032955|Ga0335076_11646018 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300033004|Ga0335084_12100310 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300033134|Ga0335073_10034250 | All Organisms → cellular organisms → Bacteria | 6943 | Open in IMG/M |
| 3300033158|Ga0335077_10302447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1750 | Open in IMG/M |
| 3300033158|Ga0335077_10352169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia bryophila | 1595 | Open in IMG/M |
| 3300033289|Ga0310914_11808076 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300033433|Ga0326726_10321389 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
| 3300034282|Ga0370492_0303229 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.69% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.30% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.19% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.50% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.81% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.46% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.77% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.77% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.42% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.42% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.08% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.08% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.08% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.73% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.73% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.38% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.38% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.38% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.04% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.04% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.04% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.04% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.69% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.69% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.69% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.35% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.35% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.35% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.35% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.35% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.35% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.35% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.35% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.35% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.35% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.35% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.35% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.35% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.35% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908007 | Soil microbial communities from sample at FACE Site Metagenome WIR_ElevOz2 | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001180 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Host-Associated | Open in IMG/M |
| 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Host-Associated | Open in IMG/M |
| 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Host-Associated | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Host-Associated | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022733 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 | Environmental | Open in IMG/M |
| 3300023019 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1 | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300025460 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025477 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026474 | Peat soil microbial communities from Stordalen Mire, Sweden - P.F.S.T0 | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026945 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 55 (SPAdes) | Environmental | Open in IMG/M |
| 3300027066 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF005 (SPAdes) | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028013 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE2 | Environmental | Open in IMG/M |
| 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028650 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_1 | Environmental | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300028909 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300030940 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FWIRElOz_01543770 | 2124908007 | Soil | VRMADEVSPQVPADDFQALEEKVYRTIEMYKSGKEARAVAERDTQRL |
| JGI1027J11758_120519961 | 3300000789 | Soil | MSLKVVEEVSAEVPAEDFQALEEKVYRTIELYKAAKEARTV |
| JGI12695J13573_10142522 | 3300001180 | Forest Soil | MSVKSIEEVSAQVPAEDFVALEEKVYRTIELYKAAKEARATAER |
| JGI12269J14319_103147442 | 3300001356 | Peatlands Soil | MGLNAVEPATDHVTEKVPADDFEALEHKVYRTIEMYKAARQAQTVAERETQRVRQQMQ |
| JGI12269J14319_103155481 | 3300001356 | Peatlands Soil | MALNAVERVAEQVPADDFQALEEKIYRTIERYKAAREAQAAAER |
| JGI12635J15846_108749902 | 3300001593 | Forest Soil | MSVKAAEGLSAQVPGDDFQALEEKVYRTIELYKSAREA |
| JGI12053J15887_106307232 | 3300001661 | Forest Soil | MALKAVDGLAEQLQADDFEALEEKVYRTIEMVKAA |
| JGI24750J21931_10578842 | 3300002070 | Corn, Switchgrass And Miscanthus Rhizosphere | MSARPLEEVSTQVPADDFEALEAKVYRTIEMYKAAREAKNVAERDA |
| JGI24738J21930_100824172 | 3300002075 | Corn Rhizosphere | MSARPLEEVSTQVPADDFEALEAKVYRTIEMYKAAREAKNVAE |
| JGI24744J21845_100743321 | 3300002077 | Corn, Switchgrass And Miscanthus Rhizosphere | MSARPLEEVSTQVPADDFEALEAKVYRTIEMYKAAREAKNVA |
| JGIcombinedJ26739_1000937792 | 3300002245 | Forest Soil | MSVRMAEGVSAQVPADDFQALEEKVYRTIELYKSAREARAAA |
| JGIcombinedJ26739_1002709683 | 3300002245 | Forest Soil | MALKAVEELAEQVPADDFQALEEKVYRTIEMYKAARQGQAAAERD |
| JGIcombinedJ26739_1011905662 | 3300002245 | Forest Soil | MVVKMAEEVSAQVASDDFQTLEQKVYRTIELYKAAREARSASE |
| C688J35102_1181813781 | 3300002568 | Soil | MSLRTVEEVSTQVPADDFQALEDKVYRTIELYKAAREGKASAE |
| JGI26341J46601_102248442 | 3300003219 | Bog Forest Soil | MALTAVEQVAGQVPVDDFQALEEKIYRTIELYKTARAGQAAAE |
| JGI26340J50214_101551781 | 3300003368 | Bog Forest Soil | MALNAVEQMAEQVPVDDFQALEEKIYRTIEMYKAARQAQAAAE |
| Ga0062387_1006092272 | 3300004091 | Bog Forest Soil | MALNAVEQVAEQVPADDFQALEDKIYRTIEMYKAARQAQVA |
| Ga0062389_1027241612 | 3300004092 | Bog Forest Soil | MVVRMAEDVTAQVPSDDFHSLEQKVYRTIEMYKAARDARSAA |
| Ga0062593_1000444344 | 3300004114 | Soil | MNLRAVEEVSTQVPADDFQALEDKVYRTIELYKSAREARSI |
| Ga0066680_104564872 | 3300005174 | Soil | MALKAVEQVADQVPADDFEALEEKVYRTIEMYKAARQAQA |
| Ga0066679_105011711 | 3300005176 | Soil | MAVNAVEQVTEQVPADDFEALEQKIYRTIEMYKAARQAQTAAERDAQRV |
| Ga0070680_1019890771 | 3300005336 | Corn Rhizosphere | MNLRAVEEVSTQVPADDFQALEDKVYRTIELYKSAREARSIAER |
| Ga0070675_1006704271 | 3300005354 | Miscanthus Rhizosphere | MSVRAVEEVSAQVPADDFHALEEKVYRTIELYKAARDARAV |
| Ga0070713_1002361203 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MNLRAVEEVSTQVPADDFQALEDKVYRTIELYKSAREARSIEEPAAS* |
| Ga0070698_1005962182 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MSVRMAEGASAQVPPDDFQALEEKVYRTIELYKSGREARA |
| Ga0066670_102858131 | 3300005560 | Soil | MAVRMAEEVSTQVPADDFQALEEKVYRTIELYKSA |
| Ga0070762_103198452 | 3300005602 | Soil | MAEEVSAQVPSDDFHALEQKVYRTIEMYKAAREARAA |
| Ga0070762_107937201 | 3300005602 | Soil | MAVNAVEQVTEQVPADDFQALEEKIYRTIEMYKAARQAQAT |
| Ga0070763_100022309 | 3300005610 | Soil | MVVRMSEEVSAQVPSDDFHALEQKVYRTIEMYKAAREARAAS |
| Ga0070764_106125831 | 3300005712 | Soil | MPLNAVEQVAGQVPADDFQALEEKIYRTIEMYKSA |
| Ga0068866_100055655 | 3300005718 | Miscanthus Rhizosphere | MNLRAVEEVSTQVPADDFQALEDKVYRTIELYKSARE |
| Ga0068858_1005252463 | 3300005842 | Switchgrass Rhizosphere | MNLRAVEEVSTQVPADDFQALEDKVYRTIELYKSAREARSIA |
| Ga0068862_1005274501 | 3300005844 | Switchgrass Rhizosphere | MSGRALEEVSTQVPADDFEALEAKVYRTIEMYKAAREA |
| Ga0070766_100961613 | 3300005921 | Soil | MALNAVEQVAEQVHADDFGVLEEKIYRTIEMYKAARQ |
| Ga0066788_101369102 | 3300005944 | Soil | MAVKVAEEVSSQIPADDFQVLEEKVYRTIEMYKAAREAKVTA |
| Ga0080026_101502222 | 3300005952 | Permafrost Soil | MSLRAVEEVSTQVPADDFQALEDKVYRTIELYKSAREARS |
| Ga0070717_115413521 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLRLAEEVSEQVPADDFQALEDKVYRTIELYKSAREA |
| Ga0066652_1002921582 | 3300006046 | Soil | MTLRAVEEVPTQVPADDFEALENKVYRTIELYKSA |
| Ga0075029_1001599532 | 3300006052 | Watersheds | MPSKSAEEMTEQVPADDFRALESKIYRTIEMYKAARQAQLSAEKEVDKLR |
| Ga0075019_104611132 | 3300006086 | Watersheds | MSVRMAEGVSAQVPADDFQALEEKVYRTIELYKSAREARSIA |
| Ga0075015_1007822052 | 3300006102 | Watersheds | MSVKPVEEVSAQVPAEDFQALEEKVYRTIELYKAA |
| Ga0075030_1007487252 | 3300006162 | Watersheds | MSANEVEEVTGQVPAEDFQALEEKVYRTIELYKAAK |
| Ga0075030_1013812672 | 3300006162 | Watersheds | MGLNAVEQVAEQVPADDFQALEDKIYRTIEMYKAARQA |
| Ga0070712_1014280513 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLRMAEEVSTQVPADDFQALEDKIYRTIDLYKSAQEARTTAERDVKRLR |
| Ga0070765_1001683323 | 3300006176 | Soil | MALNAVEQVAGQAPADDFQALEEKIYRTIEMYKSARQAQA |
| Ga0070765_1005864171 | 3300006176 | Soil | MGLNAVEEAAEQVPADYFQALEEKVYRTIEMYKSARQAQATAE |
| Ga0075021_111287351 | 3300006354 | Watersheds | MSVKEVEEVTGQVPAEDFEALEVKIYRTIELYKAAKEARA |
| Ga0079222_121181031 | 3300006755 | Agricultural Soil | MNLRAVEEVSTQVPADDFQALEDKVYRTIELYKSAREARSAAERL* |
| Ga0066659_111949211 | 3300006797 | Soil | MSLRMAEEVSAQVPADDFQALEDKVYRTIELYKAAREA |
| Ga0079220_108875151 | 3300006806 | Agricultural Soil | MSVRAVEEVSAQVPADDFHALEEKVYRTIELYKAARDARA |
| Ga0073928_100191809 | 3300006893 | Iron-Sulfur Acid Spring | MSVKTVEEVSAQVPPEDFQALEEKVYRTIELYKAAKEARA |
| Ga0079219_114190982 | 3300006954 | Agricultural Soil | MTLKAVEEVSAQVPPDDFQALEEKVYRTIELYKSAREARA |
| Ga0066710_1011256052 | 3300009012 | Grasslands Soil | MSAKALEDVSAQIPADDFQELEAKVYRTIEMYKAAREAKAVAERD |
| Ga0099828_114330821 | 3300009089 | Vadose Zone Soil | MSVKTVEEVSAQVPPEDFQALEDKVYRTIELYKAAKDARATA |
| Ga0099827_108216002 | 3300009090 | Vadose Zone Soil | MSLRTVEEVSTQVPADDFQALEDKVYRTIELYKSAREA |
| Ga0066709_1001283664 | 3300009137 | Grasslands Soil | MTLRAVEEVPTQVPTDDFEALENKVYRTIELYKSAREARSIA |
| Ga0066709_1014434663 | 3300009137 | Grasslands Soil | MTEEVSTQVPADDFQALEEKVYRTIEMFKSAREARSAAER |
| Ga0105241_116348261 | 3300009174 | Corn Rhizosphere | MNLRAVEEVSTQVPADDFQALEDKVYRTIELYKSAREARSIAERD |
| Ga0116108_11793861 | 3300009519 | Peatland | MAVRMAEEVSAPVPSDDFQALEQKVYRTIEMYKAAREARAASE |
| Ga0105237_102707903 | 3300009545 | Corn Rhizosphere | MALNAVEQVSEKVPADDFQALEEKVYRTIEMFKAAREGQANAERD |
| Ga0116105_11603571 | 3300009624 | Peatland | MALNAVEQVTEQVPADDFQALEEKIYRTIEMYKAAR |
| Ga0116102_10904882 | 3300009632 | Peatland | MSVKTVEEVSAEVPAEDFQALEEKVYRTIELYKAAKDARATAE |
| Ga0116120_12472101 | 3300009641 | Peatland | MSVKTVEEVSAQVPAEDFQALEEKVYRTIELYKAAKEARA |
| Ga0116121_11741182 | 3300009644 | Peatland | MALNAVEQQVTEQVPADDFQALEEKVYRTIEMYKAARQA |
| Ga0116217_101283492 | 3300009700 | Peatlands Soil | MSVKTEEEVSAQVPAEDFQALEEKVYRTIELYKAAKEAR |
| Ga0116130_10352661 | 3300009762 | Peatland | MALNAVEQVTEQVPADDFQALEEKIYRTIEMYKAARQAQATA |
| Ga0126373_116561412 | 3300010048 | Tropical Forest Soil | MALKAVEEVPAEVPADDFQALEDKVYRTIEMYKASREARIA |
| Ga0126373_129784642 | 3300010048 | Tropical Forest Soil | MASNAMEQVPHQVPADDFQALEQKIYRTIEMYKAAKQAQ |
| Ga0074046_100138078 | 3300010339 | Bog Forest Soil | MAVRLADEVSTQVPGDDFLALEQKVYRTIELYKAAREAQSVA |
| Ga0074045_100447021 | 3300010341 | Bog Forest Soil | MAANAIELTEQVPADDFQALEEKVYRTIEMYKAARQAHAAAE |
| Ga0074044_101247822 | 3300010343 | Bog Forest Soil | MAVRLADEVSTQVPGDDFLALEQKVYRTIELYKAAREAQSVAERDAQ |
| Ga0074044_102618101 | 3300010343 | Bog Forest Soil | MSMSVKTVEEVSAEVPAEDFQVLEEKVYRTIELYKAAKEARATA |
| Ga0074044_108745951 | 3300010343 | Bog Forest Soil | MSMSVKTVEEVSAEVPAEDFQALEEKVYRTIELYKAAKEARS |
| Ga0126372_125551872 | 3300010360 | Tropical Forest Soil | MASNAVEPVADQVPADDFQALEEKIYRTIEMYKAARQAQA |
| Ga0126379_124231772 | 3300010366 | Tropical Forest Soil | MASNAVEPVADQVPADDFQALEEKIYRTIEMYKAARQAQTTAE |
| Ga0126381_1028397052 | 3300010376 | Tropical Forest Soil | MSVRAVEEVSQQVPADDFHALESKVYRTIELYKAAREARAA |
| Ga0136449_1016552622 | 3300010379 | Peatlands Soil | MALNAAEQVSEQVPADDFEALEAKVYRTIEMYKAARQAQAAAERDTQR |
| Ga0136449_1016797551 | 3300010379 | Peatlands Soil | MALNAVERMTEQVPVDEFQALEEKIYRTIEMYKAAR |
| Ga0134127_101189933 | 3300010399 | Terrestrial Soil | MSARPLEEVSTQVPADDFEALEAKVYRTIEMYKAA |
| Ga0134127_120823122 | 3300010399 | Terrestrial Soil | MSGRALEEVSTQVPADDFEALEAKVYRTIEMYKAAREAKN |
| Ga0134121_107179641 | 3300010401 | Terrestrial Soil | MSARPLEEVSTQVPADDFEALEAKVYRTIEMYKAAREAKN |
| Ga0137392_102463831 | 3300011269 | Vadose Zone Soil | MALKAVEHVADQVPADDFEALEEKVYRTIEMVKAARQAQASAE |
| Ga0137389_111638902 | 3300012096 | Vadose Zone Soil | MAVNAVEQVTDQVPADDFEALEQKIYRTIEMYKAARQA |
| Ga0137389_112409142 | 3300012096 | Vadose Zone Soil | MSLRAVEEVSTQVPADDFQALEDKVYRTIELYKSAR |
| Ga0137389_116438712 | 3300012096 | Vadose Zone Soil | MALKVVAEVAEQVPADDFQELEEKVYRTIEMYKAA |
| Ga0137380_110091571 | 3300012206 | Vadose Zone Soil | MSEEVSTQVPADDFQALEEKVYRTIELYKSAREART |
| Ga0137376_103135131 | 3300012208 | Vadose Zone Soil | MVLRMTEEVSTQVPADDFQALEEKVYRTIEMFKSAREARS |
| Ga0137376_114979843 | 3300012208 | Vadose Zone Soil | VSAQVPADDFQALEEKVYRTIELYKSGREARAAA* |
| Ga0137379_114052781 | 3300012209 | Vadose Zone Soil | MSVKSVEEEVSAEVPAEDFQALEDKVYRTIELYKAAKEARATAERDVKR |
| Ga0137367_105587001 | 3300012353 | Vadose Zone Soil | MALNVVAQVAEQVPADNFQTLEEKIYRTIEMFKAARQ |
| Ga0137366_103892761 | 3300012354 | Vadose Zone Soil | MSEEVSTQVPADDFQALEEKVYRTIELYKSAREARTAA |
| Ga0137366_111817631 | 3300012354 | Vadose Zone Soil | MEEVTGQVPAEDFEALEEKIYRTIELYKAAKEARAASERDLKRL |
| Ga0137360_101200503 | 3300012361 | Vadose Zone Soil | MSVKTEEEASAQVPPEDFQALEDKVYRTIELYKAA |
| Ga0137361_119140651 | 3300012362 | Vadose Zone Soil | MSVKTVEEVSAQVPAEDFQALEEKVYRTIELYKAAKDA |
| Ga0137390_103909602 | 3300012363 | Vadose Zone Soil | MSVKTVEEVSTQVPAEDFQALEDKVYRTIELYKAA |
| Ga0157345_10500712 | 3300012498 | Arabidopsis Rhizosphere | MSLRAVEEVSTQVPADDFQALEDKVYRTIELYKSARE |
| Ga0137359_103680511 | 3300012923 | Vadose Zone Soil | MSVKTVEEVSAQVPPEDFQALEDKVYRTIELYKAAKEARA |
| Ga0137359_107294841 | 3300012923 | Vadose Zone Soil | MSLKAVEEVSTQVPAEDFEALEEKVYRTIELYKAAKEARTAAE |
| Ga0137413_114012931 | 3300012924 | Vadose Zone Soil | MTLNAVEQLAEQVPADDFEALEQKIYRTIEMYKAARQAQAAAERDS |
| Ga0137404_100884585 | 3300012929 | Vadose Zone Soil | MSLKAVEEVSAQVPAEDFEALEEKVYRTIELYKAA |
| Ga0137404_114016702 | 3300012929 | Vadose Zone Soil | MSVRMAEGVSAQVPADDFQALEEKVYRTIELYKSG |
| Ga0164301_109302332 | 3300012960 | Soil | MPSNAVEPLAEKVPADDFQALQQKVYRTIELYKAER |
| Ga0164301_112982822 | 3300012960 | Soil | MASNAVEPVSGQVPVDDFQALEEKIYRTIEMYKAARQAQA |
| Ga0164302_110903722 | 3300012961 | Soil | MALKAVDEVSAEVPTDDFQALEDKVYRTIEMYKAAREAKSA |
| Ga0134110_104917911 | 3300012975 | Grasslands Soil | MSVKAVEEVSTQVPADEFQSLEEKIYRTIELYKTARAGRMAAERD |
| Ga0164304_113171261 | 3300012986 | Soil | MTLRAVEEVSTQVPADDFQALEDKVYRTIDLYKSAREARA |
| Ga0120132_10500622 | 3300013832 | Permafrost | MAEEVSTQVPADDFQALEDKVYRTIELYKSAREASSV |
| Ga0181539_10760902 | 3300014151 | Bog | MSVKTVEEVSEQVRAEDFEALEEKVYRTIELYKAAKEA |
| Ga0181524_101945882 | 3300014155 | Bog | MSVKTVEEVSAEVPAEDFEALEEKVYRTIELYKAAKEARA |
| Ga0181532_100502314 | 3300014164 | Bog | MSVKTVEEVSAQVPAEDFQALEEKVYRTIELYKAAKEA |
| Ga0181532_104833522 | 3300014164 | Bog | MSMSVKTVEEVSAEVPAEDFQALEEKVYRTIELYKAAREA |
| Ga0181528_104302042 | 3300014167 | Bog | MASNAVEQVAEQVRADDFQQLEEKIYRTIDMYKAARQAQATAERDAQ |
| Ga0181531_102334503 | 3300014169 | Bog | MASNAVEQLSEQVPADDFRALEEKVYRTIEMYKAARQAQ |
| Ga0163163_114996511 | 3300014325 | Switchgrass Rhizosphere | MSLKAVEEVSSKVPTDDFQALEEKVYRTIELYKAA |
| Ga0182024_106542431 | 3300014501 | Permafrost | MALNAVEQVAEQVPADDFQALEDKIYRTIEMYKAARQAQATAER |
| Ga0182024_114368992 | 3300014501 | Permafrost | MALDAVEQVAEQVPADDFQALEDKIYRTIEMYKAARQAQATAER |
| Ga0182027_101060516 | 3300014839 | Fen | MSLKTVEEVSAEVPTEDFQALEEKVYRTIELYKAAK |
| Ga0137403_105113641 | 3300015264 | Vadose Zone Soil | MSAKPEALEFEVPADDFQALEEKVYRTVDLLKSAREGKA |
| Ga0132258_100750321 | 3300015371 | Arabidopsis Rhizosphere | MSARPLEEVSTQVPADDFEALEAKVYRTIEMYKAAR |
| Ga0132256_1017028771 | 3300015372 | Arabidopsis Rhizosphere | MALKAVDEVSAEVPTDDFQALEDKVYRTIEMYKAAREAKTAAE |
| Ga0132257_1000264256 | 3300015373 | Arabidopsis Rhizosphere | MSARPLEEVSTQVPADDFEALEAKVYRTIEMYKAAREAKNVAER |
| Ga0132255_1020177482 | 3300015374 | Arabidopsis Rhizosphere | MVLKAVEEVPAEVPADDFQALEEKVYRTIELYKAA |
| Ga0132255_1056319801 | 3300015374 | Arabidopsis Rhizosphere | MALNAVEQVAEQVPADDFQALEEKIYRTIEMYKAARQAQATA |
| Ga0182036_110659462 | 3300016270 | Soil | MSVKLAEEVSAQVPADDFQALEAKVYRTIELYKSAR |
| Ga0182040_107548711 | 3300016387 | Soil | MSVKLAEEVSAQVPTDDFQALEAKVYRTIELYKSAREARSAA |
| Ga0187818_105387982 | 3300017823 | Freshwater Sediment | MSVRMAEEVPAQVPADDFQALEQKVYRTIELYKSAR |
| Ga0187808_103834062 | 3300017942 | Freshwater Sediment | MSVKMGEEVSEQVPAEDFEALEEKVYRTIELYKAA |
| Ga0187817_107276032 | 3300017955 | Freshwater Sediment | MSVKLADEVSAQVPADDFSALEQKIYRTIELYKAVREARS |
| Ga0187783_100573202 | 3300017970 | Tropical Peatland | MSVKMAEEVSPQVPADDFQALEEKVYRTIELYKAAREAR |
| Ga0187781_101001963 | 3300017972 | Tropical Peatland | MAVNAVQEVTEQVPTDGFQALEQKIYRTIEMYKAA |
| Ga0187777_107753932 | 3300017974 | Tropical Peatland | MSVRMADEVSTQVPAEDFQTLEEKVYRTIEMYKSAREARLVA |
| Ga0187782_104613311 | 3300017975 | Tropical Peatland | MPARETEEVSAQVPAEDFQALEEKIYRTIELYKAAKEARATAERDVK |
| Ga0187816_102095791 | 3300017995 | Freshwater Sediment | MAEEVSAQVPSDDFQALEQKVYRTIEMYKAAREARAASERD |
| Ga0187816_104117271 | 3300017995 | Freshwater Sediment | MVVRTAEEVSAQVPSDDFQALEQKVYRTIEMYKAARDARS |
| Ga0187810_104881492 | 3300018012 | Freshwater Sediment | MSVRMAEEVSAQVPADDFQALEHKVYRTIELYKAAREAKSVAERDVKR |
| Ga0187873_10255263 | 3300018013 | Peatland | MSVKTVEEVSAEVPAEDFEALEEKVYRTIELYKAAKEARATAE |
| Ga0187862_101060863 | 3300018040 | Peatland | MSVKNVEEVSAQVPAEDFQALEEKVYRTIELYKAAKEA |
| Ga0187862_107431401 | 3300018040 | Peatland | MSVKTVEEVSAQVPAEDFQALEEKVYRTIELYKAAKEAR |
| Ga0187871_104030691 | 3300018042 | Peatland | MALNAVEQQVTEQVPADDFQALEEKVYRTIEMYKAARQAQ |
| Ga0187887_103002333 | 3300018043 | Peatland | MASNAIEQVAHQVPADDFQALEEKIYRTIEMYKAARQA |
| Ga0187851_102473893 | 3300018046 | Peatland | MASNAVEQVAEQVRADDFQQLEEKIYRTIDMYKAARQ |
| Ga0187859_101259383 | 3300018047 | Peatland | MALEAVAEQVPVDDFQALEEKIYRTIEMYKSARQA |
| Ga0187772_100989523 | 3300018085 | Tropical Peatland | MALNAVDPLADHVTEKVPADDFEALEQKVYRTIDMYKAARKAQSDAERDT |
| Ga0187770_110268341 | 3300018090 | Tropical Peatland | MSVKAAEEVSAQVPAEDFQALEEKIYRTIELYKAAKEA |
| Ga0066667_105737682 | 3300018433 | Grasslands Soil | MSAKALEDVSAQIPADDFQELEAKVYRTIEMYKAAREA |
| Ga0066669_111728472 | 3300018482 | Grasslands Soil | MTLRAVEEVPTQVPADDFEALENKVYRTIELYKSAREARSIAERDVK |
| Ga0137408_13286271 | 3300019789 | Vadose Zone Soil | MSVNAVRQLSAEIPTDDFNALEEKVYRTIELYKAARDA |
| Ga0193735_11077521 | 3300020006 | Soil | MSLRMAEEVSTQVPADDFQALEDKVYRTIELYKAAREARA |
| Ga0193726_10258431 | 3300020021 | Soil | MALKMTEEVHTQVPGDDFQALEDKVYRTIEMYKDAR |
| Ga0210407_102361441 | 3300020579 | Soil | MSVKTVEEVSAQVPPEDFQALEDKVYRTIELYKAAK |
| Ga0210403_112756192 | 3300020580 | Soil | MALNAVERETESAPVDDFQALEDKIYRTIEMYKAA |
| Ga0210399_100527374 | 3300020581 | Soil | MALKAVDGLAEQVQADDFEALEEKVYRTIEMVKAA |
| Ga0210399_102243682 | 3300020581 | Soil | MSVRMAEGVSAQVPADDFQALEEKVYRTIELYKSAR |
| Ga0179596_105930462 | 3300021086 | Vadose Zone Soil | MSVKTVEEVSAQVPPEDFQALEDKVYRTIELYKAAKEARAT |
| Ga0210404_106026642 | 3300021088 | Soil | MALKAVEEVSAEVPADDFQALEDKGYRTMEMDKAAREAKAAAEHETQRVSQ |
| Ga0210400_105771881 | 3300021170 | Soil | MAEEVSTQVPSDDFQTLEQKVYRTIEMYKAAREARS |
| Ga0210400_106578001 | 3300021170 | Soil | MALNAVEQVAEQVPADDFQALEDKIYRTIEMYKAARQAQA |
| Ga0210405_105326951 | 3300021171 | Soil | MALNAVEQVAEQVPADDFQALEDKIYRTIEMYKSARQAQAV |
| Ga0210408_109492892 | 3300021178 | Soil | MSLKAVEEVSAEVPADDFQALEDKVYRTIEMYKAARE |
| Ga0210396_103377911 | 3300021180 | Soil | MALNAVEQVAEQVPADDFQALEDKIYRTIEMFKSARQAQAV |
| Ga0210388_116440292 | 3300021181 | Soil | MSVKGIEEVSAQVPAEDFEALEEKVYRTIELYKAAK |
| Ga0213882_100508791 | 3300021362 | Exposed Rock | MSLRTLEEVSTQVPTDDFQALEDKVYRTIELYKSAREARSI |
| Ga0210393_112763441 | 3300021401 | Soil | MALNAVEQVAEQVPADDFQALEDKIYRSIEMYKAARQAQAAAERDAQRTRQQMQD |
| Ga0210385_100295851 | 3300021402 | Soil | MALNAVEQVADQVPADDFQALEDKIYRTIEMYKAARQ |
| Ga0210385_102459383 | 3300021402 | Soil | MALNAIEQVATQVPGDDFQALEEKVYRTIEMYKAARQAQASAERDTQ |
| Ga0210389_111949092 | 3300021404 | Soil | MVVRTVEEVSAQVPSDDFHALEQKVYRTIEMYKAAR |
| Ga0210386_108218652 | 3300021406 | Soil | MAEEVSAQVPSDDFHALEQKVYRTIEMYKAAREARA |
| Ga0210394_117550161 | 3300021420 | Soil | MALNAVEQVSEQVPADDFQALEDKIYRTIEMYKAARQAQA |
| Ga0210384_102595963 | 3300021432 | Soil | MAVNAVERMTEEVPADDFEALEHKIYRTIEMYKAARQAQAAAEHDAQ |
| Ga0210384_108630992 | 3300021432 | Soil | MSVRMAEGVSAQVPADDFQALEEKVYRTIELYKSAREARSI |
| Ga0210390_109568422 | 3300021474 | Soil | MALNAAEQVSGQVSEQISEQSSADDFQILEEKIFRTIEMYKAARQAQASAERDAQRVR |
| Ga0210392_109773152 | 3300021475 | Soil | MSLNAVEQVAEQVPADDFEALEQKIYRTIEMYKAA |
| Ga0210392_113145731 | 3300021475 | Soil | MALNAVEQVAEQVPADDFQALEDKIYRTIEMYKAARQA |
| Ga0210398_104065221 | 3300021477 | Soil | MAEEVSAQVPSDDFQALEQKVYRTIEMYKGAREARAASERDAQR |
| Ga0210410_100526611 | 3300021479 | Soil | MASNAVETVPDQVPADDFQALEEKIYRTIEMYKAARQAQASAE |
| Ga0210410_102447111 | 3300021479 | Soil | MSVRMAEDVSAQVPTDDFQALEEKVYRTIELYKTAREARAA |
| Ga0126371_113913221 | 3300021560 | Tropical Forest Soil | MALNAVEQVPDQVPAHDFQALEEKVYRTIEMYKAARQAQTIAE |
| Ga0212123_109119121 | 3300022557 | Iron-Sulfur Acid Spring | MALNAVEQVTEQGPADDFQALEEKIYRTIEMYKAARQAQAVAERD |
| Ga0224562_10013751 | 3300022733 | Soil | MAVRMAEEVSAQVPSDDFQALEQKVYRTIEMYKAAR |
| Ga0224560_1021403 | 3300023019 | Soil | MALDALEQVTEKVPVDDFQALEEKIYRTIEMYKAARQAQAVAE |
| Ga0224544_10111573 | 3300023250 | Soil | MALNAVEQVTEQVPVDEFQALEEKIYRNIEMYKAARQAQ |
| Ga0224544_10194781 | 3300023250 | Soil | MALNAVEQVTEQVPADDFQALEEKIYRTIEMYKTARQA |
| Ga0224544_10469201 | 3300023250 | Soil | MSVKTVEEVSAQVPPEDFQALEEKVYRTIELYKAAK |
| Ga0208562_10313191 | 3300025460 | Peatland | MSVKTVEEVSAEVPAEDFEALEEKVYRTIELYKAAKEA |
| Ga0208192_10731211 | 3300025477 | Peatland | MSVKTVEEVSEQVRAEDFEALEEKVYRTIELYKAAKEALAT |
| Ga0208688_10153262 | 3300025480 | Peatland | MALNAVERVAEQVPADDFQALEEKIYRTIERYKAAREAQAAADADLAEIVPART |
| Ga0208188_10068945 | 3300025507 | Peatland | MSVKTEEEVSAQVPAEDFQALEEKVYRTIELYKTAKE |
| Ga0207642_100030325 | 3300025899 | Miscanthus Rhizosphere | MNLRAVEEVSTQVPADDFQALEDKVYRTIELYKSAREARSIAERDVE |
| Ga0207699_102437263 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSNAVEPLAEKVPADDFQALEQKVYRTIELYKAARQAQTAAER |
| Ga0207695_100752721 | 3300025913 | Corn Rhizosphere | MNLQAVEEVSTQVPADDFQALEDKVYRTIELYKSA |
| Ga0207671_102634843 | 3300025914 | Corn Rhizosphere | MNLRAVEEVSTQVPADDFQALEDKVYRTIELYKSAREA |
| Ga0207693_105726672 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MALNAVEQVSEQVPADDFEALERKIYRTIEMYKAARQAQATAE |
| Ga0207663_104341911 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MALKAVDEVSAEVPTDDFQALEDKVYRTIEMYKAA |
| Ga0207660_105078281 | 3300025917 | Corn Rhizosphere | MALNAVEQVSEQVPADDFQALEEKVYRTIEMFKAAR |
| Ga0207649_106949612 | 3300025920 | Corn Rhizosphere | MNLRAVEEVSTQVPADDFQALEDKVYRTIELYKSAREAR |
| Ga0207646_111484622 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVRMSEEVSTQVPADDFQALEEKVYRTIELYKAAREARTAAE |
| Ga0207646_113656321 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MALNAVEQVAEQVPADDFQALEDKIYRTIELYKAARQAQVTAERDEQR |
| Ga0207700_101254861 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MNLQAVEEVSTQVPADDFQALEDKVYRTIELYKSAREARA |
| Ga0207700_103638333 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MNLRAVEEVSTQVPADDFQALEDKVYRTIELYKSAREARSIEEPAAS |
| Ga0207700_104434773 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MALKAVDEVSAEVPTDDFQALEDKVYRTIEMYKAAREAK |
| Ga0207700_104649801 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLRAVEEVSTQVPAEDFQALEEKVYRTIELYKSAREART |
| Ga0207664_109821661 | 3300025929 | Agricultural Soil | MSLRLAEEVSTQVPADDFQALEDKIYRTIDLYKSAQEAHTTAE |
| Ga0207690_111942242 | 3300025932 | Corn Rhizosphere | MNLRAVEEVSTQVPADDFQALEDKVYRTIELYKSAREARSIAE |
| Ga0207639_101148751 | 3300026041 | Corn Rhizosphere | MAVMMEEVSGQVPADDFHALEEKVYRTIELYKSARDAKVTAERDVK |
| Ga0209350_10557453 | 3300026277 | Grasslands Soil | MVLRMTEEVSTQVPADDFQALEEKVYRTIEMFKSAREARSAAER |
| Ga0209236_11039462 | 3300026298 | Grasslands Soil | MSAKALEEVSAQIPTDDFQELEAKVYRTIEMYKAARE |
| Ga0209055_11501082 | 3300026309 | Soil | MAVRMSEEVSTQVPADDFQALEEKVYRTIELYKSAREARTA |
| Ga0209158_10416981 | 3300026333 | Soil | MSVKALDEVSAQVPADDFQELEEKVYRTIELYKGAREA |
| Ga0247846_10627572 | 3300026474 | Soil | MSVKTVEEVSAEVPAEDFEALEEKVYRTIELYKAAREARAT |
| Ga0257147_10783481 | 3300026475 | Soil | MSLKAVEEVSAQVPAEDFVALEEKVYRTIELYKAAKEAR |
| Ga0257168_11135841 | 3300026514 | Soil | MSLRTVEEVSTQVPADDFQALEDKVYRTIEMYKSAREA |
| Ga0207743_10340592 | 3300026945 | Tropical Forest Soil | MTVKAVDEVSAQVPAEDFQALEEKIYRTIELYKAAKEAR |
| Ga0208236_10038573 | 3300027066 | Forest Soil | MALNAVEQVAGQAPADDFQALEEKIYRTIEMYKSARQAQAA |
| Ga0209529_10167303 | 3300027334 | Forest Soil | MALNAVERMEPAPVNDFQALEDKIYRIIEMYKAARQSQAVAERDAQRVR |
| Ga0209418_10320062 | 3300027371 | Forest Soil | MVLKAVEEVPSEVPADDFQALEDKVYRTIELYKESREAR |
| Ga0207761_10173821 | 3300027516 | Tropical Forest Soil | MALEAVEQVADKVPADDFQALEQKIYRTIEMYKSAR |
| Ga0209523_11094891 | 3300027548 | Forest Soil | MASNAVETVPDQVPADDFQALEQKIYRTIEMYKAARQA |
| Ga0208565_10414992 | 3300027662 | Peatlands Soil | MSVKTEEEVSAQVPAEDFQALEEKVYRTIELYKAAKEARA |
| Ga0209009_10396611 | 3300027667 | Forest Soil | MGSNAIEQVAEQVPADDFQALEDKIYRTIEMYKAARQAQAT |
| Ga0209530_12268482 | 3300027692 | Forest Soil | MALNAVAEAAAEQVPADYFQALEEKVYRTIEMYKSARQAQVTAERDAQRAR |
| Ga0209581_12121602 | 3300027706 | Surface Soil | MVVKMAEDVSTQVPADDFQALEQKIYRTIELYKAVQEARSI |
| Ga0209248_101536331 | 3300027729 | Bog Forest Soil | MALNAVEEAAQQVPADYFQALEEKVYRTIEMYKSARQAQ |
| Ga0209693_104128061 | 3300027855 | Soil | MVVRMAEEVSAQVPSDDFQALEQKVYRTIEMYKAAREARAASERDTQ |
| Ga0209579_101171361 | 3300027869 | Surface Soil | MASNVVEQVADQVPADDFQALEEKVYRTIEMYKASRQA |
| Ga0209579_104874931 | 3300027869 | Surface Soil | MSVKMVDEVAQAPADDFQALEQKVYRTIDMYKAARDARASAERDVTR |
| Ga0209169_105924842 | 3300027879 | Soil | MPLNAVEQVAGQVPADDFQALEEKIYRTIEMYKSARQAQAAAE |
| Ga0209275_100438125 | 3300027884 | Soil | MALNAVAEAAAEQVPADYFQALEEKVYRTIEMYKSARQAQVTAERDAQR |
| Ga0209067_100299863 | 3300027898 | Watersheds | MALNAVEAVAEEVPADNFQALEDKVYRTIEMYKAAK |
| Ga0209006_100365374 | 3300027908 | Forest Soil | MVVKMAEEVSAQVASDDFQTLEQKVYRTIELYKAAREA |
| Ga0209006_103860853 | 3300027908 | Forest Soil | MGLNAAEQVTEQVLVDDFQALEEKVYRTIERYKAA |
| Ga0209583_106255601 | 3300027910 | Watersheds | MALKAIEQVSAEVPSDDFQALEDKVYRTIELYKAA |
| Ga0209698_102194222 | 3300027911 | Watersheds | MSLKAAEEVSEQVPAEDFQALEEKVYRTIELYKAAREARA |
| Ga0209698_107520222 | 3300027911 | Watersheds | MASNAIEPVPDQVPADDFQALEEKIYRTIEMYKAARQA |
| Ga0265350_1055342 | 3300028013 | Soil | MALNAVAEAAAEQVPADYFQALEEKVYRTIEMYKSARQAQAL |
| Ga0265357_10440551 | 3300028023 | Rhizosphere | MALNAVEQVADQVPADDFQALEDKIYRTIELYKSA |
| Ga0209526_105495141 | 3300028047 | Forest Soil | MTLRMAEEVSTQVPADDFQALEDKIYRTIELYKSAQEARATA |
| Ga0302170_100193661 | 3300028650 | Fen | MSVKTVEEVSAQVPAEDFQALEEKVYRTIELYKAAKEARV |
| Ga0302233_104077311 | 3300028746 | Palsa | MALNAVEQVTEQVPVDEFQALEEKIYRTIEMYKAARQAQTVAERDA |
| Ga0302219_100534263 | 3300028747 | Palsa | MALNAVEPLAEQVPVDDFQALEDKIYRTIEMYKAAR |
| Ga0302234_104373121 | 3300028773 | Palsa | MALNAVQEAAEQVPADYFQALEEKVHRTIEMYKSARQAQATAERDAQRARQQLVERD |
| Ga0302231_103450561 | 3300028775 | Palsa | MSVKTVEEVSAEVPAEDFQVLEEKVYRTIELYKAAKEARST |
| Ga0302227_101177581 | 3300028795 | Palsa | MALNAVQEAAEQVPADYFQALEEKVHRTIEMYKSARQAQATAERDAQRARQQLVE |
| Ga0302154_103092452 | 3300028882 | Bog | MSVKTVEEVSAEVPAEDFQALEEKVYRTIELYKAAK |
| Ga0308309_102880222 | 3300028906 | Soil | MSVKTVEEVSAEVPAEDFQALEEKVYRTIELYKAAKE |
| Ga0302200_101449601 | 3300028909 | Bog | MAVDAVEQVTEQVPADDFQALEDKIYRTIEMYKAARQAQAT |
| Ga0311368_102843353 | 3300029882 | Palsa | MALNAVVAEQVPADDFQALEEKIYRTIELYKAARAAQ |
| Ga0311362_100885631 | 3300029913 | Bog | MALDAVEQMTEQVPADDFQALEQKIYRTIEMYKAARQAQATAERDSQRA |
| Ga0311362_111573262 | 3300029913 | Bog | MALNAVEQQVTEQVPADDFQALEEKVYRTIEMYKAARQAQTA |
| Ga0311359_100831644 | 3300029914 | Bog | MALDAVEQVTEQVQADDFQALEEKIYRTIEMYKAVRQAQAVAE |
| Ga0311340_110002251 | 3300029943 | Palsa | MALKAVEELAEQVPVDDFQALEEKVYRTIEMYKAARQA |
| Ga0311332_106703222 | 3300029984 | Fen | MPVKEAEEVSAEVPAENFQALEEKIYRTIELYKAAKEAKATAE |
| Ga0311334_104210952 | 3300029987 | Fen | MTLKVVEEVSAQVPAEDFQALEEKVYRTIELYKAAKE |
| Ga0311354_106140893 | 3300030618 | Palsa | MALNAVEEAAEQVPADYFQALEEKVYRTIEMYKSARQAQATAERDAQRAR |
| Ga0302316_104675392 | 3300030646 | Palsa | MALEAAETVVEQSPADDFQALEEKIFRTIEMYKTARQAQTAAERDA |
| Ga0302310_103702661 | 3300030737 | Palsa | MALNAVQEAAEQVPADYFQALEEKVHRTIEMYKSARQAQATAERDAQRARQQLSERDDQLDTLRREA |
| Ga0302314_116234452 | 3300030906 | Palsa | MALDAVEQVTEKVPADDFQALEGKIYRTIEMYKAA |
| Ga0265740_10526461 | 3300030940 | Soil | MAEEVSAQVPSDDFQALEQKVYRTIEMYKAARDARSAAER |
| Ga0170834_1071026443 | 3300031057 | Forest Soil | MALNAVEQITEQVPADDFEALEQKIYRTIEMYKAARQAQATAERDAL |
| Ga0170822_121087391 | 3300031122 | Forest Soil | MALNAVEQVADQVPADDFQALEDKIYRTIEMYKAAR |
| Ga0302324_1003819303 | 3300031236 | Palsa | MSVKTLEEVSAQVPAEDFQALEEKIYRTIELYKAAKDA |
| Ga0265339_100422551 | 3300031249 | Rhizosphere | MSAKGIEEVSAQVPAEDFQALEEKVYRTIELYKAAKD |
| Ga0310686_1070334142 | 3300031708 | Soil | MALNAVEQVAGQAPADDFQALEEKIYRTIEMYKSARQAQ |
| Ga0307476_102858133 | 3300031715 | Hardwood Forest Soil | MGLNAAEQVTEQVPVDDFQALEEKVYRTIERYKAARQAQAAAERDAQR |
| Ga0307474_114494751 | 3300031718 | Hardwood Forest Soil | MALNAVEQVAEQVPADDFQALEDKIYRTIEMYKAARQ |
| Ga0306917_107272051 | 3300031719 | Soil | MASNAVEPLADQVPADDFQALEQKIYRTIEMYKAA |
| Ga0307468_1016204451 | 3300031740 | Hardwood Forest Soil | MVLKAVEEVSAEVPVDDFQALEDKVYRTIELYKAAREAKASAERDVQ |
| Ga0307475_100268661 | 3300031754 | Hardwood Forest Soil | MSVKVAEEVSSQVPADDFQVLEDKVYRTIEMYKTAREGRAI |
| Ga0307478_101640441 | 3300031823 | Hardwood Forest Soil | MALNAVEQVATQVPADDFQALEEKVYRTIEMYKAARH |
| Ga0306925_102436912 | 3300031890 | Soil | MALKVVDEVAAQVPADEFQALEQKVYRTIALYKAAR |
| Ga0311301_121501451 | 3300032160 | Peatlands Soil | MGLNAVEPLADQVPADDFEALEHKVYRTIEMYKTE |
| Ga0307471_1000814794 | 3300032180 | Hardwood Forest Soil | MVLKAIEEVPTEVPADDFQALEEKVYRTIDLYKAAR |
| Ga0307471_1003619771 | 3300032180 | Hardwood Forest Soil | MALKAVDGLAEQVQADDFEVLEEKVYRTIEMVKAARQAQTSAERDAGR |
| Ga0307471_1040746592 | 3300032180 | Hardwood Forest Soil | MAVNAVEQVTEQVPADDFQALEEKIYRTIELYKAARQ |
| Ga0335079_104370872 | 3300032783 | Soil | MSVKGIEEVSAQVPAEDFQALEEKVYRTIELYKAAKEAR |
| Ga0335078_104286682 | 3300032805 | Soil | MASNVVEQLSEQVPPDDFQALEDKVYRTIEMYKAARQAQATAERD |
| Ga0335078_105004282 | 3300032805 | Soil | MSAKAAEEVSAQVPAEDFQALEEKIYRTIELYKAAKEARS |
| Ga0335072_100621641 | 3300032898 | Soil | MALNAVEQVTDKVPADNFEALETKVYRTIEMYKAARQAQATAERDVQ |
| Ga0335072_108710531 | 3300032898 | Soil | MALNAVETVADQVPADHFEALEEKIYRTIEMYKSARQAQASAQNDAQR |
| Ga0335083_111810551 | 3300032954 | Soil | MASNAIEQVPQQVPADDFQALEEKIYRTIEMYKAARQAQATA |
| Ga0335076_102130463 | 3300032955 | Soil | MASNAMEQLSEQVPADDFQALEDKVYRTIEMYKAARQAQATAERD |
| Ga0335076_114547641 | 3300032955 | Soil | MSVKTAEEVSAQVPSEDFQALEEKVYRTIEVYKDAKEARAT |
| Ga0335076_116460182 | 3300032955 | Soil | MASNAIEQVPPQVPADDFQALEEKIYRTIEMYKAARQAQATAER |
| Ga0335084_121003101 | 3300033004 | Soil | MAVKVTEEVSEQVSADDFQALEQKVYRTIELYKAA |
| Ga0335073_100342501 | 3300033134 | Soil | MALNAVETVANQVPADHFEALEEKVYRTIEMYKSARQAQASAQNDAQR |
| Ga0335077_103024471 | 3300033158 | Soil | MSVKGIEEVSAQVPAEDFQALEEKVYRTIELYKAAKEARA |
| Ga0335077_103521691 | 3300033158 | Soil | MSVKMAEETAAQVPADDFQALEEKVYRAIELYKAAQA |
| Ga0310914_118080761 | 3300033289 | Soil | MASNAVEPLPNQVPGDDFQALEQKIYRTIEMFKAAREAQA |
| Ga0326726_103213891 | 3300033433 | Peat Soil | MSANEVEEVTGQVPAEDFQALEEKVYRTIELYKAAKEA |
| Ga0370492_0303229_2_139 | 3300034282 | Untreated Peat Soil | MSANVSAKTVEEVSAEVPAEDFQALEEKVYRTIELYKAAKEARATA |
| ⦗Top⦘ |