Basic Information | |
---|---|
Family ID | F011520 |
Family Type | Metagenome |
Number of Sequences | 290 |
Average Sequence Length | 39 residues |
Representative Sequence | LLIIVKKLNVPVDLIRFINHISLKFAPFVYLININEKN |
Number of Associated Samples | 187 |
Number of Associated Scaffolds | 290 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 97.93 % |
% of genes from short scaffolds (< 2000 bps) | 87.24 % |
Associated GOLD sequencing projects | 171 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (77.586 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (31.379 % of family members) |
Environment Ontology (ENVO) | Unclassified (82.414 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (82.759 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.36% β-sheet: 0.00% Coil/Unstructured: 63.64% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 290 Family Scaffolds |
---|---|---|
PF03949 | Malic_M | 47.59 |
PF00390 | malic | 44.83 |
PF00590 | TP_methylase | 3.10 |
PF04972 | BON | 1.72 |
PF13458 | Peripla_BP_6 | 0.69 |
PF00012 | HSP70 | 0.69 |
PF03023 | MurJ | 0.34 |
PF01025 | GrpE | 0.34 |
PF14667 | Polysacc_synt_C | 0.34 |
COG ID | Name | Functional Category | % Frequency in 290 Family Scaffolds |
---|---|---|---|
COG0281 | Malic enzyme | Energy production and conversion [C] | 92.41 |
COG0686 | Alanine dehydrogenase (includes sporulation protein SpoVN) | Amino acid transport and metabolism [E] | 47.59 |
COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
COG0534 | Na+-driven multidrug efflux pump, DinF/NorM/MATE family | Defense mechanisms [V] | 0.34 |
COG0576 | Molecular chaperone GrpE (heat shock protein HSP-70) | Posttranslational modification, protein turnover, chaperones [O] | 0.34 |
COG0728 | Lipid II flippase MurJ/MviN (peptidoglycan biosynthesis) | Cell wall/membrane/envelope biogenesis [M] | 0.34 |
COG2244 | Membrane protein involved in the export of O-antigen and teichoic acid | Cell wall/membrane/envelope biogenesis [M] | 0.34 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 77.59 % |
All Organisms | root | All Organisms | 22.41 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000117|DelMOWin2010_c10141084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 810 | Open in IMG/M |
3300000181|LPjun08P4500mDRAFT_c1048433 | Not Available | 526 | Open in IMG/M |
3300001346|JGI20151J14362_10040062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2158 | Open in IMG/M |
3300001522|Mariner_1080574 | Not Available | 609 | Open in IMG/M |
3300001748|JGI11772J19994_1012363 | Not Available | 1412 | Open in IMG/M |
3300001972|GOS2216_10038085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1767 | Open in IMG/M |
3300001974|GOS2246_10143771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1642 | Open in IMG/M |
3300002040|GOScombined01_100723931 | Not Available | 811 | Open in IMG/M |
3300002040|GOScombined01_101861103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1489 | Open in IMG/M |
3300003476|NAP2_1120281 | Not Available | 583 | Open in IMG/M |
3300004273|Ga0066608_1179792 | Not Available | 509 | Open in IMG/M |
3300005398|Ga0066858_10184574 | Not Available | 601 | Open in IMG/M |
3300005404|Ga0066856_10029212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2406 | Open in IMG/M |
3300005430|Ga0066849_10398404 | Not Available | 518 | Open in IMG/M |
3300005521|Ga0066862_10062800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1296 | Open in IMG/M |
3300005522|Ga0066861_10201405 | Not Available | 682 | Open in IMG/M |
3300005522|Ga0066861_10280665 | Not Available | 566 | Open in IMG/M |
3300005596|Ga0066834_10121807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 844 | Open in IMG/M |
3300005605|Ga0066850_10054817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1565 | Open in IMG/M |
3300005605|Ga0066850_10148433 | Not Available | 864 | Open in IMG/M |
3300005605|Ga0066850_10334796 | Not Available | 531 | Open in IMG/M |
3300005606|Ga0066835_10170374 | Not Available | 727 | Open in IMG/M |
3300005838|Ga0008649_10221247 | Not Available | 729 | Open in IMG/M |
3300005945|Ga0066381_10074850 | Not Available | 948 | Open in IMG/M |
3300005945|Ga0066381_10101026 | Not Available | 816 | Open in IMG/M |
3300005951|Ga0066379_10146170 | Not Available | 752 | Open in IMG/M |
3300006019|Ga0066375_10107230 | Not Available | 893 | Open in IMG/M |
3300006024|Ga0066371_10281283 | Not Available | 522 | Open in IMG/M |
3300006027|Ga0075462_10211943 | Not Available | 580 | Open in IMG/M |
3300006166|Ga0066836_10140531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1417 | Open in IMG/M |
3300006166|Ga0066836_10938901 | Not Available | 522 | Open in IMG/M |
3300006190|Ga0075446_10056527 | Not Available | 1204 | Open in IMG/M |
3300006193|Ga0075445_10007420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 5036 | Open in IMG/M |
3300006193|Ga0075445_10170927 | Not Available | 772 | Open in IMG/M |
3300006305|Ga0068468_1113088 | Not Available | 631 | Open in IMG/M |
3300006310|Ga0068471_1147065 | Not Available | 1055 | Open in IMG/M |
3300006313|Ga0068472_11128047 | Not Available | 883 | Open in IMG/M |
3300006337|Ga0068495_1345822 | Not Available | 963 | Open in IMG/M |
3300006338|Ga0068482_1273327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2796 | Open in IMG/M |
3300006339|Ga0068481_1147510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2309 | Open in IMG/M |
3300006341|Ga0068493_10609972 | Not Available | 775 | Open in IMG/M |
3300006344|Ga0099695_1202610 | Not Available | 624 | Open in IMG/M |
3300006902|Ga0066372_10405752 | Not Available | 788 | Open in IMG/M |
3300006902|Ga0066372_10482557 | Not Available | 727 | Open in IMG/M |
3300006947|Ga0075444_10359527 | Not Available | 553 | Open in IMG/M |
3300008225|Ga0105352_1042485 | Not Available | 1153 | Open in IMG/M |
3300008735|Ga0115657_1022330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 5551 | Open in IMG/M |
3300009055|Ga0102905_1065058 | Not Available | 734 | Open in IMG/M |
3300009077|Ga0115552_1127306 | Not Available | 1082 | Open in IMG/M |
3300009104|Ga0117902_1357627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1318 | Open in IMG/M |
3300009104|Ga0117902_1685873 | Not Available | 769 | Open in IMG/M |
3300009109|Ga0117922_1166768 | Not Available | 998 | Open in IMG/M |
3300009126|Ga0118723_1069506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2274 | Open in IMG/M |
3300009172|Ga0114995_10007718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 6862 | Open in IMG/M |
3300009173|Ga0114996_11052333 | Not Available | 575 | Open in IMG/M |
3300009193|Ga0115551_1369294 | Not Available | 619 | Open in IMG/M |
3300009193|Ga0115551_1521204 | Not Available | 505 | Open in IMG/M |
3300009409|Ga0114993_10181275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1634 | Open in IMG/M |
3300009409|Ga0114993_10529680 | Not Available | 873 | Open in IMG/M |
3300009420|Ga0114994_10321003 | Not Available | 1030 | Open in IMG/M |
3300009420|Ga0114994_10467005 | Not Available | 833 | Open in IMG/M |
3300009420|Ga0114994_10560650 | Not Available | 750 | Open in IMG/M |
3300009420|Ga0114994_10569608 | Not Available | 743 | Open in IMG/M |
3300009420|Ga0114994_10686192 | Not Available | 669 | Open in IMG/M |
3300009420|Ga0114994_10826205 | Not Available | 602 | Open in IMG/M |
3300009420|Ga0114994_11091015 | Not Available | 515 | Open in IMG/M |
3300009425|Ga0114997_10010150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 6750 | Open in IMG/M |
3300009425|Ga0114997_10010340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 6674 | Open in IMG/M |
3300009425|Ga0114997_10083931 | Not Available | 1971 | Open in IMG/M |
3300009425|Ga0114997_10366593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 784 | Open in IMG/M |
3300009425|Ga0114997_10672799 | Not Available | 542 | Open in IMG/M |
3300009438|Ga0115559_1292317 | Not Available | 572 | Open in IMG/M |
3300009443|Ga0115557_1333813 | Not Available | 566 | Open in IMG/M |
3300009445|Ga0115553_1111071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1158 | Open in IMG/M |
3300009445|Ga0115553_1115514 | Not Available | 1129 | Open in IMG/M |
3300009447|Ga0115560_1148099 | Not Available | 933 | Open in IMG/M |
3300009449|Ga0115558_1343122 | Not Available | 589 | Open in IMG/M |
3300009467|Ga0115565_10296408 | Not Available | 736 | Open in IMG/M |
3300009481|Ga0114932_10239264 | Not Available | 1097 | Open in IMG/M |
3300009497|Ga0115569_10009827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 6359 | Open in IMG/M |
3300009497|Ga0115569_10067059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1909 | Open in IMG/M |
3300009497|Ga0115569_10170125 | Not Available | 1028 | Open in IMG/M |
3300009498|Ga0115568_10256362 | Not Available | 786 | Open in IMG/M |
3300009505|Ga0115564_10178139 | Not Available | 1122 | Open in IMG/M |
3300009505|Ga0115564_10261699 | Not Available | 877 | Open in IMG/M |
3300009508|Ga0115567_10032804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4209 | Open in IMG/M |
3300009508|Ga0115567_10534729 | Not Available | 711 | Open in IMG/M |
3300009508|Ga0115567_10599456 | Not Available | 665 | Open in IMG/M |
3300009508|Ga0115567_10688334 | Not Available | 613 | Open in IMG/M |
3300009526|Ga0115004_10057456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2464 | Open in IMG/M |
3300009526|Ga0115004_10221921 | Not Available | 1129 | Open in IMG/M |
3300009526|Ga0115004_10664334 | Not Available | 618 | Open in IMG/M |
3300009526|Ga0115004_10680667 | Not Available | 610 | Open in IMG/M |
3300009526|Ga0115004_10682083 | Not Available | 610 | Open in IMG/M |
3300009526|Ga0115004_10695548 | Not Available | 603 | Open in IMG/M |
3300009550|Ga0115013_10583057 | Not Available | 743 | Open in IMG/M |
3300009593|Ga0115011_10057474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2666 | Open in IMG/M |
3300009593|Ga0115011_11406703 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 612 | Open in IMG/M |
3300009705|Ga0115000_10509743 | Not Available | 756 | Open in IMG/M |
3300009705|Ga0115000_10704686 | Not Available | 623 | Open in IMG/M |
3300009705|Ga0115000_10795317 | Not Available | 581 | Open in IMG/M |
3300009705|Ga0115000_10800275 | Not Available | 579 | Open in IMG/M |
3300009706|Ga0115002_10279568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1266 | Open in IMG/M |
3300009706|Ga0115002_10884168 | Not Available | 619 | Open in IMG/M |
3300009785|Ga0115001_10011269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 6124 | Open in IMG/M |
3300009785|Ga0115001_10064576 | Not Available | 2407 | Open in IMG/M |
3300009785|Ga0115001_10086355 | Not Available | 2056 | Open in IMG/M |
3300009785|Ga0115001_10618256 | Not Available | 661 | Open in IMG/M |
3300009786|Ga0114999_11095655 | Not Available | 572 | Open in IMG/M |
3300010883|Ga0133547_10205062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4196 | Open in IMG/M |
3300010883|Ga0133547_10477307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2526 | Open in IMG/M |
3300010883|Ga0133547_10726272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1963 | Open in IMG/M |
3300010883|Ga0133547_11704532 | Not Available | 1171 | Open in IMG/M |
3300010883|Ga0133547_11953791 | Not Available | 1077 | Open in IMG/M |
3300010883|Ga0133547_12074410 | Not Available | 1038 | Open in IMG/M |
3300012919|Ga0160422_10951612 | Not Available | 555 | Open in IMG/M |
3300012928|Ga0163110_10390789 | Not Available | 1040 | Open in IMG/M |
3300012936|Ga0163109_10438316 | Not Available | 957 | Open in IMG/M |
3300012954|Ga0163111_10098566 | Not Available | 2393 | Open in IMG/M |
3300012954|Ga0163111_10229701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1617 | Open in IMG/M |
3300012954|Ga0163111_11494851 | Not Available | 668 | Open in IMG/M |
3300012954|Ga0163111_12387745 | Not Available | 537 | Open in IMG/M |
3300017697|Ga0180120_10059410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1710 | Open in IMG/M |
3300017760|Ga0181408_1140282 | Not Available | 623 | Open in IMG/M |
3300017786|Ga0181424_10026588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2509 | Open in IMG/M |
3300017786|Ga0181424_10384190 | Not Available | 573 | Open in IMG/M |
3300017786|Ga0181424_10392596 | Not Available | 565 | Open in IMG/M |
3300017786|Ga0181424_10425100 | Not Available | 538 | Open in IMG/M |
3300017824|Ga0181552_10346525 | Not Available | 722 | Open in IMG/M |
3300017962|Ga0181581_10651332 | Not Available | 637 | Open in IMG/M |
3300019459|Ga0181562_10585253 | Not Available | 523 | Open in IMG/M |
3300020053|Ga0181595_10261665 | Not Available | 726 | Open in IMG/M |
3300020185|Ga0206131_10169654 | Not Available | 1114 | Open in IMG/M |
3300020238|Ga0211492_1070267 | Not Available | 632 | Open in IMG/M |
3300020265|Ga0211533_1057417 | Not Available | 647 | Open in IMG/M |
3300020292|Ga0211663_1023188 | Not Available | 943 | Open in IMG/M |
3300020295|Ga0211530_1017224 | Not Available | 1445 | Open in IMG/M |
3300020317|Ga0211688_1061954 | Not Available | 733 | Open in IMG/M |
3300020324|Ga0211630_1053121 | Not Available | 826 | Open in IMG/M |
3300020358|Ga0211689_1053841 | Not Available | 1183 | Open in IMG/M |
3300020361|Ga0211531_1015898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2464 | Open in IMG/M |
3300020370|Ga0211672_10170649 | Not Available | 670 | Open in IMG/M |
3300020372|Ga0211683_10096750 | Not Available | 956 | Open in IMG/M |
3300020372|Ga0211683_10125595 | Not Available | 827 | Open in IMG/M |
3300020372|Ga0211683_10239910 | Not Available | 573 | Open in IMG/M |
3300020372|Ga0211683_10250364 | Not Available | 558 | Open in IMG/M |
3300020376|Ga0211682_10317788 | Not Available | 583 | Open in IMG/M |
3300020382|Ga0211686_10039900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1897 | Open in IMG/M |
3300020382|Ga0211686_10067283 | Not Available | 1455 | Open in IMG/M |
3300020382|Ga0211686_10258517 | Not Available | 716 | Open in IMG/M |
3300020382|Ga0211686_10290949 | Not Available | 670 | Open in IMG/M |
3300020382|Ga0211686_10354566 | Not Available | 598 | Open in IMG/M |
3300020382|Ga0211686_10411518 | Not Available | 546 | Open in IMG/M |
3300020385|Ga0211677_10227009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 766 | Open in IMG/M |
3300020385|Ga0211677_10273857 | Not Available | 680 | Open in IMG/M |
3300020391|Ga0211675_10020904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3402 | Open in IMG/M |
3300020396|Ga0211687_10342129 | Not Available | 584 | Open in IMG/M |
3300020397|Ga0211583_10040044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1869 | Open in IMG/M |
3300020411|Ga0211587_10260706 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 717 | Open in IMG/M |
3300020412|Ga0211552_10225325 | Not Available | 673 | Open in IMG/M |
3300020413|Ga0211516_10329023 | Not Available | 683 | Open in IMG/M |
3300020413|Ga0211516_10340820 | Not Available | 669 | Open in IMG/M |
3300020431|Ga0211554_10186852 | Not Available | 1005 | Open in IMG/M |
3300020432|Ga0211556_10069853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1706 | Open in IMG/M |
3300020432|Ga0211556_10143120 | Not Available | 1115 | Open in IMG/M |
3300020438|Ga0211576_10167031 | Not Available | 1184 | Open in IMG/M |
3300020440|Ga0211518_10212101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 947 | Open in IMG/M |
3300020441|Ga0211695_10011597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2760 | Open in IMG/M |
3300020442|Ga0211559_10018912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3490 | Open in IMG/M |
3300020442|Ga0211559_10266317 | Not Available | 802 | Open in IMG/M |
3300020445|Ga0211564_10203628 | Not Available | 981 | Open in IMG/M |
3300020445|Ga0211564_10209905 | Not Available | 965 | Open in IMG/M |
3300020445|Ga0211564_10418109 | Not Available | 658 | Open in IMG/M |
3300020445|Ga0211564_10615477 | Not Available | 527 | Open in IMG/M |
3300020446|Ga0211574_10436323 | Not Available | 565 | Open in IMG/M |
3300020451|Ga0211473_10419677 | Not Available | 684 | Open in IMG/M |
3300020453|Ga0211550_10227882 | Not Available | 874 | Open in IMG/M |
3300020454|Ga0211548_10220658 | Not Available | 921 | Open in IMG/M |
3300020455|Ga0211664_10143469 | Not Available | 1117 | Open in IMG/M |
3300020456|Ga0211551_10043941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2085 | Open in IMG/M |
3300020456|Ga0211551_10220166 | Not Available | 901 | Open in IMG/M |
3300020457|Ga0211643_10141615 | Not Available | 1185 | Open in IMG/M |
3300020459|Ga0211514_10150213 | Not Available | 1155 | Open in IMG/M |
3300020459|Ga0211514_10175136 | Not Available | 1060 | Open in IMG/M |
3300020461|Ga0211535_10256868 | Not Available | 775 | Open in IMG/M |
3300020463|Ga0211676_10349837 | Not Available | 825 | Open in IMG/M |
3300020465|Ga0211640_10130776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1434 | Open in IMG/M |
3300020466|Ga0211714_10310054 | Not Available | 753 | Open in IMG/M |
3300020468|Ga0211475_10082334 | Not Available | 1696 | Open in IMG/M |
3300020471|Ga0211614_10097981 | Not Available | 1243 | Open in IMG/M |
3300020476|Ga0211715_10394684 | Not Available | 679 | Open in IMG/M |
3300020477|Ga0211585_10126469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1705 | Open in IMG/M |
3300020477|Ga0211585_10574072 | Not Available | 625 | Open in IMG/M |
3300021068|Ga0206684_1192261 | Not Available | 662 | Open in IMG/M |
3300021089|Ga0206679_10313140 | Not Available | 850 | Open in IMG/M |
3300021791|Ga0226832_10196540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1164 | Open in IMG/M |
(restricted) 3300022920|Ga0233426_10281696 | Not Available | 650 | Open in IMG/M |
3300022925|Ga0255773_10209011 | Not Available | 873 | Open in IMG/M |
3300023119|Ga0255762_10314909 | Not Available | 807 | Open in IMG/M |
3300023119|Ga0255762_10424474 | Not Available | 647 | Open in IMG/M |
3300023175|Ga0255777_10261107 | Not Available | 1001 | Open in IMG/M |
3300024235|Ga0228665_1045381 | Not Available | 907 | Open in IMG/M |
(restricted) 3300024257|Ga0233442_1077015 | Not Available | 952 | Open in IMG/M |
(restricted) 3300024324|Ga0233443_1188947 | Not Available | 729 | Open in IMG/M |
3300024343|Ga0244777_10714213 | Not Available | 599 | Open in IMG/M |
3300025438|Ga0208770_1072661 | Not Available | 618 | Open in IMG/M |
3300025658|Ga0209659_1013195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3650 | Open in IMG/M |
3300025662|Ga0209664_1072262 | Not Available | 1014 | Open in IMG/M |
3300025685|Ga0209095_1157982 | Not Available | 655 | Open in IMG/M |
3300025700|Ga0209661_1228661 | Not Available | 524 | Open in IMG/M |
3300025707|Ga0209667_1126191 | Not Available | 783 | Open in IMG/M |
3300025722|Ga0209660_1190028 | Not Available | 660 | Open in IMG/M |
3300025876|Ga0209223_10024344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 4175 | Open in IMG/M |
3300025886|Ga0209632_10005588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 10867 | Open in IMG/M |
3300025897|Ga0209425_10343088 | Not Available | 732 | Open in IMG/M |
3300026076|Ga0208261_1023143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1832 | Open in IMG/M |
3300026077|Ga0208749_1123291 | Not Available | 536 | Open in IMG/M |
3300026257|Ga0208407_1181929 | Not Available | 624 | Open in IMG/M |
3300026265|Ga0208765_1038485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1449 | Open in IMG/M |
3300026267|Ga0208278_1003620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 5743 | Open in IMG/M |
3300026292|Ga0208277_1118450 | Not Available | 931 | Open in IMG/M |
3300026321|Ga0208764_10123738 | Not Available | 1321 | Open in IMG/M |
3300026321|Ga0208764_10335896 | Not Available | 720 | Open in IMG/M |
3300027572|Ga0208964_1052414 | Not Available | 958 | Open in IMG/M |
3300027687|Ga0209710_1002961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 11609 | Open in IMG/M |
3300027687|Ga0209710_1186329 | Not Available | 719 | Open in IMG/M |
3300027702|Ga0209036_1159674 | Not Available | 650 | Open in IMG/M |
3300027752|Ga0209192_10149111 | Not Available | 925 | Open in IMG/M |
3300027779|Ga0209709_10071854 | Not Available | 1905 | Open in IMG/M |
3300027779|Ga0209709_10201370 | Not Available | 925 | Open in IMG/M |
3300027779|Ga0209709_10277800 | Not Available | 726 | Open in IMG/M |
3300027779|Ga0209709_10391535 | Not Available | 553 | Open in IMG/M |
3300027780|Ga0209502_10032072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3044 | Open in IMG/M |
3300027780|Ga0209502_10315104 | Not Available | 669 | Open in IMG/M |
3300027791|Ga0209830_10365679 | Not Available | 623 | Open in IMG/M |
3300027801|Ga0209091_10063992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2071 | Open in IMG/M |
3300027801|Ga0209091_10303345 | Not Available | 755 | Open in IMG/M |
3300027801|Ga0209091_10435752 | Not Available | 585 | Open in IMG/M |
3300027801|Ga0209091_10494683 | Not Available | 532 | Open in IMG/M |
3300027813|Ga0209090_10194876 | Not Available | 1047 | Open in IMG/M |
3300027813|Ga0209090_10285178 | Not Available | 824 | Open in IMG/M |
3300027813|Ga0209090_10380730 | Not Available | 682 | Open in IMG/M |
3300027827|Ga0209035_10132960 | Not Available | 1239 | Open in IMG/M |
3300027838|Ga0209089_10593763 | Not Available | 584 | Open in IMG/M |
3300027883|Ga0209713_10442348 | Not Available | 854 | Open in IMG/M |
3300028115|Ga0233450_10108043 | Not Available | 1468 | Open in IMG/M |
3300028194|Ga0257106_1090330 | Not Available | 1112 | Open in IMG/M |
3300028535|Ga0257111_1064168 | Not Available | 1193 | Open in IMG/M |
3300031510|Ga0308010_1012290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3817 | Open in IMG/M |
3300031510|Ga0308010_1051388 | All Organisms → cellular organisms → Bacteria | 1689 | Open in IMG/M |
3300031510|Ga0308010_1058821 | Not Available | 1558 | Open in IMG/M |
3300031510|Ga0308010_1164740 | Not Available | 820 | Open in IMG/M |
3300031510|Ga0308010_1283877 | Not Available | 572 | Open in IMG/M |
3300031598|Ga0308019_10056468 | Not Available | 1667 | Open in IMG/M |
3300031599|Ga0308007_10125011 | Not Available | 932 | Open in IMG/M |
3300031599|Ga0308007_10290845 | Not Available | 544 | Open in IMG/M |
3300031630|Ga0308004_10072753 | Not Available | 1486 | Open in IMG/M |
3300031630|Ga0308004_10130644 | Not Available | 1059 | Open in IMG/M |
3300031630|Ga0308004_10290816 | Not Available | 634 | Open in IMG/M |
3300031644|Ga0308001_10130221 | Not Available | 1040 | Open in IMG/M |
3300031644|Ga0308001_10236623 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 710 | Open in IMG/M |
3300031659|Ga0307986_10317647 | Not Available | 647 | Open in IMG/M |
3300031659|Ga0307986_10346252 | Not Available | 609 | Open in IMG/M |
3300031695|Ga0308016_10332393 | Not Available | 551 | Open in IMG/M |
3300031696|Ga0307995_1267913 | Not Available | 579 | Open in IMG/M |
3300031696|Ga0307995_1314295 | Not Available | 517 | Open in IMG/M |
3300031721|Ga0308013_10096875 | Not Available | 1159 | Open in IMG/M |
3300031721|Ga0308013_10119276 | Not Available | 1021 | Open in IMG/M |
3300031766|Ga0315322_10829568 | Not Available | 568 | Open in IMG/M |
3300031774|Ga0315331_11209696 | Not Available | 502 | Open in IMG/M |
3300031775|Ga0315326_10331439 | Not Available | 994 | Open in IMG/M |
3300031775|Ga0315326_10411784 | Not Available | 877 | Open in IMG/M |
3300031775|Ga0315326_10601377 | Not Available | 699 | Open in IMG/M |
3300031785|Ga0310343_10524897 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 874 | Open in IMG/M |
3300031785|Ga0310343_10766350 | Not Available | 724 | Open in IMG/M |
3300031801|Ga0310121_10271900 | Not Available | 1003 | Open in IMG/M |
3300032006|Ga0310344_10042857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3627 | Open in IMG/M |
3300032006|Ga0310344_10313097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1343 | Open in IMG/M |
3300032006|Ga0310344_10495646 | Not Available | 1048 | Open in IMG/M |
3300032006|Ga0310344_10974733 | Not Available | 712 | Open in IMG/M |
3300032011|Ga0315316_10767921 | Not Available | 797 | Open in IMG/M |
3300032047|Ga0315330_10513298 | Not Available | 722 | Open in IMG/M |
3300032047|Ga0315330_10859205 | Not Available | 516 | Open in IMG/M |
3300032073|Ga0315315_10353785 | Not Available | 1367 | Open in IMG/M |
3300032073|Ga0315315_10571104 | Not Available | 1045 | Open in IMG/M |
3300032278|Ga0310345_11208852 | Not Available | 739 | Open in IMG/M |
3300032360|Ga0315334_10462532 | Not Available | 1082 | Open in IMG/M |
3300032360|Ga0315334_10671914 | Not Available | 895 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 31.38% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 23.10% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 7.24% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 6.90% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 4.83% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 3.45% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 3.45% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 2.41% |
Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 2.07% |
Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 1.72% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.72% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.72% |
Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 1.38% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.38% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.03% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.03% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.69% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.34% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.34% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.34% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.34% |
Methane Seep Mesocosm | Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm | 0.34% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.34% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.34% |
Estuarine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine | 0.34% |
Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.34% |
Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vent Plume | 0.34% |
Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.34% |
Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.34% |
Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.34% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
3300000181 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2008 P4 500m | Environmental | Open in IMG/M |
3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
3300001522 | Hydrothermal vent plume microbial communities from Mariner/Tui Malila, Pacific Ocean, of black smokers | Environmental | Open in IMG/M |
3300001748 | Saline surface water microbial communities from Etoliko Lagoon, Greece - surface water (0 m) | Environmental | Open in IMG/M |
3300001972 | Marine microbial communities from the Sargasso Sea - GS000d | Environmental | Open in IMG/M |
3300001974 | Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031 | Environmental | Open in IMG/M |
3300002040 | GS000c - Sargasso Station 3 | Environmental | Open in IMG/M |
3300003476 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 2 | Environmental | Open in IMG/M |
3300004273 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_135m | Environmental | Open in IMG/M |
3300005398 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV201 | Environmental | Open in IMG/M |
3300005404 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 | Environmental | Open in IMG/M |
3300005430 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 | Environmental | Open in IMG/M |
3300005521 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 | Environmental | Open in IMG/M |
3300005522 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257 | Environmental | Open in IMG/M |
3300005596 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF43B | Environmental | Open in IMG/M |
3300005605 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 | Environmental | Open in IMG/M |
3300005606 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 | Environmental | Open in IMG/M |
3300005838 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNA | Environmental | Open in IMG/M |
3300005945 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_AAIW_ad_876m_LV_B | Environmental | Open in IMG/M |
3300005951 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_250_ad_251m_LV_A | Environmental | Open in IMG/M |
3300006019 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_NADW_ad_2500m_LV_A | Environmental | Open in IMG/M |
3300006024 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B | Environmental | Open in IMG/M |
3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
3300006305 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0025m | Environmental | Open in IMG/M |
3300006310 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500m | Environmental | Open in IMG/M |
3300006313 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0770m | Environmental | Open in IMG/M |
3300006337 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT237_3_0025m | Environmental | Open in IMG/M |
3300006338 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_0770m | Environmental | Open in IMG/M |
3300006339 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_3_0500m | Environmental | Open in IMG/M |
3300006341 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT236_2_0770m | Environmental | Open in IMG/M |
3300006344 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0500m | Environmental | Open in IMG/M |
3300006902 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_A | Environmental | Open in IMG/M |
3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
3300008225 | Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN8B Hudson Canyon | Environmental | Open in IMG/M |
3300008735 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 2.7-0.2um | Environmental | Open in IMG/M |
3300009055 | Estuarine microbial communities from the Columbia River estuary - metaG 1556B-3 | Environmental | Open in IMG/M |
3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
3300009104 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um | Environmental | Open in IMG/M |
3300009109 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
3300009126 | Combined Assembly of Gp0139357, Gp0139356 | Environmental | Open in IMG/M |
3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
3300009445 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 | Environmental | Open in IMG/M |
3300009447 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 | Environmental | Open in IMG/M |
3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
3300009497 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 | Environmental | Open in IMG/M |
3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300020053 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly) | Environmental | Open in IMG/M |
3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
3300020238 | Marine microbial communities from Tara Oceans - TARA_B000000475 (ERX556004-ERR599068) | Environmental | Open in IMG/M |
3300020265 | Marine microbial communities from Tara Oceans - TARA_B100000401 (ERX556012-ERR599088) | Environmental | Open in IMG/M |
3300020292 | Marine microbial communities from Tara Oceans - TARA_B100000965 (ERX555930-ERR599113) | Environmental | Open in IMG/M |
3300020295 | Marine microbial communities from Tara Oceans - TARA_B100000071 (ERX555980-ERR599109) | Environmental | Open in IMG/M |
3300020317 | Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555998-ERR599027) | Environmental | Open in IMG/M |
3300020324 | Marine microbial communities from Tara Oceans - TARA_B100000678 (ERX555936-ERR599033) | Environmental | Open in IMG/M |
3300020358 | Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX555925-ERR599009) | Environmental | Open in IMG/M |
3300020361 | Marine microbial communities from Tara Oceans - TARA_B100000071 (ERX556078-ERR599167) | Environmental | Open in IMG/M |
3300020370 | Marine microbial communities from Tara Oceans - TARA_B100001029 (ERX556065-ERR599079) | Environmental | Open in IMG/M |
3300020372 | Marine microbial communities from Tara Oceans - TARA_B100000787 (ERX556133-ERR599090) | Environmental | Open in IMG/M |
3300020376 | Marine microbial communities from Tara Oceans - TARA_B100000795 (ERX555997-ERR599121) | Environmental | Open in IMG/M |
3300020382 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059) | Environmental | Open in IMG/M |
3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
3300020391 | Marine microbial communities from Tara Oceans - TARA_B100000989 (ERX556130-ERR598967) | Environmental | Open in IMG/M |
3300020396 | Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122) | Environmental | Open in IMG/M |
3300020397 | Marine microbial communities from Tara Oceans - TARA_B100000123 (ERX556052-ERR599075) | Environmental | Open in IMG/M |
3300020411 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130) | Environmental | Open in IMG/M |
3300020412 | Marine microbial communities from Tara Oceans - TARA_B100001167 (ERX556053-ERR599047) | Environmental | Open in IMG/M |
3300020413 | Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092) | Environmental | Open in IMG/M |
3300020431 | Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983) | Environmental | Open in IMG/M |
3300020432 | Marine microbial communities from Tara Oceans - TARA_B100002052 (ERX556103-ERR599100) | Environmental | Open in IMG/M |
3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
3300020441 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX556088-ERR599006) | Environmental | Open in IMG/M |
3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
3300020445 | Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087) | Environmental | Open in IMG/M |
3300020446 | Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989) | Environmental | Open in IMG/M |
3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
3300020453 | Marine microbial communities from Tara Oceans - TARA_B100001758 (ERX556003-ERR598963) | Environmental | Open in IMG/M |
3300020454 | Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170) | Environmental | Open in IMG/M |
3300020455 | Marine microbial communities from Tara Oceans - TARA_B100000965 (ERX555917-ERR599081) | Environmental | Open in IMG/M |
3300020456 | Marine microbial communities from Tara Oceans - TARA_B100001741 (ERX555984-ERR599123) | Environmental | Open in IMG/M |
3300020457 | Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014) | Environmental | Open in IMG/M |
3300020459 | Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095) | Environmental | Open in IMG/M |
3300020461 | Marine microbial communities from Tara Oceans - TARA_B100000401 (ERX556127-ERR599150) | Environmental | Open in IMG/M |
3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
3300020465 | Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961) | Environmental | Open in IMG/M |
3300020466 | Marine microbial communities from Tara Oceans - TARA_B100001540 (ERX556059-ERR598968) | Environmental | Open in IMG/M |
3300020468 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993) | Environmental | Open in IMG/M |
3300020471 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002) | Environmental | Open in IMG/M |
3300020476 | Marine microbial communities from Tara Oceans - TARA_B100001750 (ERX556108-ERR598958) | Environmental | Open in IMG/M |
3300020477 | Marine microbial communities from Tara Oceans - TARA_B100001123 (ERX555935-ERR599156) | Environmental | Open in IMG/M |
3300021068 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015 | Environmental | Open in IMG/M |
3300021089 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 | Environmental | Open in IMG/M |
3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
3300022920 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MG | Environmental | Open in IMG/M |
3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
3300023110 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG | Environmental | Open in IMG/M |
3300023119 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG | Environmental | Open in IMG/M |
3300023175 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG | Environmental | Open in IMG/M |
3300024235 | Seawater microbial communities from Monterey Bay, California, United States - 79D | Environmental | Open in IMG/M |
3300024257 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_150_MG | Environmental | Open in IMG/M |
3300024324 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_200_MG | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300025438 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 (SPAdes) | Environmental | Open in IMG/M |
3300025658 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025662 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_150m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025685 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes) | Environmental | Open in IMG/M |
3300025700 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025707 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_165m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025722 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025876 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes) | Environmental | Open in IMG/M |
3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
3300026076 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (SPAdes) | Environmental | Open in IMG/M |
3300026077 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B (SPAdes) | Environmental | Open in IMG/M |
3300026257 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 (SPAdes) | Environmental | Open in IMG/M |
3300026265 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV203 (SPAdes) | Environmental | Open in IMG/M |
3300026267 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV259 (SPAdes) | Environmental | Open in IMG/M |
3300026292 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 (SPAdes) | Environmental | Open in IMG/M |
3300026321 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 (SPAdes) | Environmental | Open in IMG/M |
3300027572 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_08_M0_20 (SPAdes) | Environmental | Open in IMG/M |
3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
3300027702 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - DCM_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
3300027780 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes) | Environmental | Open in IMG/M |
3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
3300027827 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
3300027883 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300028115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (spades assembly) | Environmental | Open in IMG/M |
3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
3300028535 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_500m | Environmental | Open in IMG/M |
3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
3300031598 | Marine microbial communities from water near the shore, Antarctic Ocean - #284 | Environmental | Open in IMG/M |
3300031599 | Marine microbial communities from water near the shore, Antarctic Ocean - #71 | Environmental | Open in IMG/M |
3300031630 | Marine microbial communities from water near the shore, Antarctic Ocean - #38 | Environmental | Open in IMG/M |
3300031644 | Marine microbial communities from water near the shore, Antarctic Ocean - #5 | Environmental | Open in IMG/M |
3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
3300031695 | Marine microbial communities from water near the shore, Antarctic Ocean - #233 | Environmental | Open in IMG/M |
3300031696 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262 | Environmental | Open in IMG/M |
3300031721 | Marine microbial communities from water near the shore, Antarctic Ocean - #181 | Environmental | Open in IMG/M |
3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
3300031785 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MG | Environmental | Open in IMG/M |
3300031801 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986 | Environmental | Open in IMG/M |
3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOWin2010_101410843 | 3300000117 | Marine | VKKLNVPVDLRRFINHISLKFASIVYLITKNEKN* |
LPjun08P4500mDRAFT_10484331 | 3300000181 | Marine | ILLIIVKKLNVVVDLNKFINHTSLKIASIVHFITLNEKN* |
JGI20151J14362_100400621 | 3300001346 | Pelagic Marine | LLIIVKKLKVPVDLIKFINHISLNFTPFVHLIYINEKNKD* |
Mariner_10805742 | 3300001522 | Hydrothermal Vent Plume | ILLIIVKKLNVVVDLNRFINHISLKIASIVHFITLNEKN* |
JGI11772J19994_10123631 | 3300001748 | Saline Water And Sediment | LIIVKKLNVPVDLIKFINHISLNFTLFVHLITKNEKNKS* |
GOS2216_100380852 | 3300001972 | Marine | INVKKLNVDVDLIRFINHISLKFALFVYLITHNEKK* |
GOS2246_101437713 | 3300001974 | Marine | LLIIVKKLNVVVDLNRFINHISLKIASIVYLITLNEKN* |
GOScombined01_1007239312 | 3300002040 | Marine | NLLIIVKKLNVLVDLIRFINHISLKFAPFVYLININEKN* |
GOScombined01_1018611031 | 3300002040 | Marine | TSLKYPSILLIKVKKLNVLVDLIRFINHISLKFALFVYLITENEKK* |
NAP2_11202811 | 3300003476 | Estuarine | DILLNTVKKLNVPVDLIKFINHISLNLVLFVHINTENEKNKS* |
Ga0066608_11797922 | 3300004273 | Marine | PSNLLIIVKKPNVPVDLTMFINHISLNFTLIVYLIIKNEKN* |
Ga0066858_101845742 | 3300005398 | Marine | SLKYPSILLIKVKKLNVPVDLIRFINHISLKFALFVYLIT* |
Ga0066856_100292121 | 3300005404 | Marine | ILLIIVKKLNVVVDLNKFINHISLKIASIVYLITLNEKN* |
Ga0066849_103984042 | 3300005430 | Marine | SLKYPSILLIKVKKPNVLVDLIRFINHISLKFALFVYLFTQNEEK* |
Ga0066862_100628001 | 3300005521 | Marine | IIVKKLNVVVDLNKFINHIGLKIASIVYLITLNEKN* |
Ga0066861_102014052 | 3300005522 | Marine | VNLLIKVKKLNVPVDLIRFINHISLKFAPFVYLIT* |
Ga0066861_102806652 | 3300005522 | Marine | ISLIYPRILLIIVKKLNVVVDLNKFINHISLKIASIVYLIYIK* |
Ga0066834_101218072 | 3300005596 | Marine | RYPVNLLIKVKKLNVPVDLIRFINHISLKFAPFVYLIT* |
Ga0066850_100548171 | 3300005605 | Marine | LLIIVKKLNVPVDLIRFINHISLKIALFVYLIIINEKNKN* |
Ga0066850_101484331 | 3300005605 | Marine | IAINISLRYPVNLLIKVKKLNVPVDLIRFINHISLKFAPFVYLIT* |
Ga0066850_103347962 | 3300005605 | Marine | IIVKKLNVVVDLNKFINHISLKIASIVYLITLNEKN* |
Ga0066835_101703742 | 3300005606 | Marine | PNVPVDLSKFINHISLNYTLIVYLINPNEKNKD*SLH** |
Ga0008649_102212471 | 3300005838 | Marine | NLLIIVKKPNVPVDLTKFINHISLNFTLFVYLIIINEKN* |
Ga0066381_100748502 | 3300005945 | Marine | IIVKKLNVVVDLNRFINHISLKIASIVYLITLNEKN* |
Ga0066381_101010261 | 3300005945 | Marine | PSILLIIVKKLNVVVDLNRFINHISLKIASIVYLIALNEKN* |
Ga0066379_101461702 | 3300005951 | Marine | NTSLKYPRILLIKVKKLNVPVDLIRFIKHTSHKFALFVYLFTQNEEK* |
Ga0066375_101072301 | 3300006019 | Marine | LIIVKKLNVVVDLNKFINHTSLKIASIVHIITLNEKN* |
Ga0066371_102812831 | 3300006024 | Marine | IKVKKLNVLVDLIKFINHISLKFASIVYLITLNEKN* |
Ga0075462_102119431 | 3300006027 | Aqueous | IVKKPNVPVDLTMFINHISLNFTLIVYLIIKNEKN* |
Ga0066836_101405311 | 3300006166 | Marine | IAIKRSLKYPSILLIIVKKLNVLVDLIRFINHISLKFALFVYLIAQNEKK* |
Ga0066836_109389011 | 3300006166 | Marine | VKKLNVVVDLNKFINHISLKIASIVYIININEKI* |
Ga0075446_100565271 | 3300006190 | Marine | LIIVKKLNVPVDLIRFINHISHKLAPFVYLITINEKN* |
Ga0075445_100074205 | 3300006193 | Marine | IVKKLNVPVDLIRFINHISHKLAPFVYLITINEKN* |
Ga0075445_101709271 | 3300006193 | Marine | IMVKKLNVPVDLIKFINHISLKFTAFVYLIDINEKN* |
Ga0068468_11130881 | 3300006305 | Marine | DPKNIAINKSRKYPRTLLNKVKKLNVPVDLIRFINHISLNLALFVYLIVLNEKK* |
Ga0068471_11470652 | 3300006310 | Marine | VKKLNVVVDLNKFINHTSLKIASIVHFITLNEKN* |
Ga0068472_111280472 | 3300006313 | Marine | KVKKLNVPVDLIRFINHISLKFAPIVYIIIINEKI* |
Ga0068495_13458221 | 3300006337 | Marine | STLLIKTKKLNVPVDLIMFINHISLNLDLIVYLNIQNEES* |
Ga0068482_12733271 | 3300006338 | Marine | YPRILLIRVKKLNVVVDLNKFINHIGLKFASIIYIIIINEKI* |
Ga0068481_11475102 | 3300006339 | Marine | IIVKKPNVVVDLIKFINHISLKFAPIVYIIIINEKI* |
Ga0068493_106099721 | 3300006341 | Marine | IIVKKLNVVVDLNKFINHTSLKNASIVHFITLNEKN* |
Ga0099695_12026101 | 3300006344 | Marine | RTKKLNVLVDLIRFINHISLNLALFVYLIIKNEKK* |
Ga0066372_104057522 | 3300006902 | Marine | IIVKKPNVVVDLIKFINHISLKFAPIVYIIIVNEKI* |
Ga0066372_104825572 | 3300006902 | Marine | IVKKLNVVVDLNKFINHISLKIASIVYLITLNEKNQNRSLHR* |
Ga0075444_103595271 | 3300006947 | Marine | LLIMVKKLNVPVDLIKFINHISLKFAPFVYLININEKN* |
Ga0105352_10424851 | 3300008225 | Methane Seep Mesocosm | LLIIVKKLNVVVDLNRFINHISFKIASIVYLITLNEKN* |
Ga0115657_10223306 | 3300008735 | Marine | VKKLNVPVDLIRFINHISLKIAPFVYLIIINEKNKN* |
Ga0102905_10650582 | 3300009055 | Estuarine | VKKLNVPVDLIKFINHISLKFTPFVYLININEKN* |
Ga0115552_11273061 | 3300009077 | Pelagic Marine | KPKVPVDLTKFINHISLNFTPFVHLINVNEKNKN* |
Ga0117902_13576271 | 3300009104 | Marine | KKLNVPVDLIRFINHISLKIAPFVYLIIINEKNKN* |
Ga0117902_16858732 | 3300009104 | Marine | VKKLNVPVDLIRFIKHTSHKFALFVYLFTQNEEK* |
Ga0117922_11667681 | 3300009109 | Marine | KLNVPVDLIRFINHISLKIAPFVYLITINEKNKN* |
Ga0118723_10695062 | 3300009126 | Marine | VKKLNVPVDLIRFINHISLKIAPFVYLIIINEKN* |
Ga0114995_100077188 | 3300009172 | Marine | LLIIVKKLNVPVDLIRFINHISLKFAAFVYLININEKN* |
Ga0114996_110523331 | 3300009173 | Marine | IRVKKLNVPVDLIRFINHISLKIAPFVYLININEKNKS* |
Ga0115551_13692942 | 3300009193 | Pelagic Marine | NLLTMVKKLNVPVDLIKFINHISLKFAPFVYLININEKN* |
Ga0115551_15212041 | 3300009193 | Pelagic Marine | KLKVPVDLIKFINHISLNFTPFVHLINRNEKNKD* |
Ga0114993_101812752 | 3300009409 | Marine | MVKKLNVPVDLRRFINHISLKFAAFVKLIIYNEKNKN* |
Ga0114993_105296802 | 3300009409 | Marine | IIVKKLNVPVDLIRFINHISLKFAPFVYLININEKNKN* |
Ga0114994_103210031 | 3300009420 | Marine | PSNLLIIVKKLNVPVDLIRFINHISHKLASFVYLITINEKN* |
Ga0114994_104670052 | 3300009420 | Marine | IVKKLNVPVDLIRFINHISHKFALFVYLININEKN* |
Ga0114994_105606501 | 3300009420 | Marine | PNSLLIIVKKLNVPVDLIRFINHISPKFVAFVYLININEKN* |
Ga0114994_105696082 | 3300009420 | Marine | IIVKKLNVPVDLIKFINHISLKFDPFVYLINLNEKN* |
Ga0114994_106861922 | 3300009420 | Marine | IVKKLNVLVDLIRFINHISLKFAPFVYLININEKNNS* |
Ga0114994_108262051 | 3300009420 | Marine | VKKPNVPVDLIRFINHISLKFAPFVYLININEKN* |
Ga0114994_110910152 | 3300009420 | Marine | IIVKKLNVPVDLIRFINHISLKIAPFVYLININEKN* |
Ga0114997_100101504 | 3300009425 | Marine | MVKKLNVPVDLRRFINHISLKFAVFVKLIIYNEKNKN* |
Ga0114997_100103401 | 3300009425 | Marine | IIVKKLNVPVDLIRFINHISHKLTPFVYLITINEKN* |
Ga0114997_100839312 | 3300009425 | Marine | IIVKKLNVPVDLIRFINHISLKFAPFVYLINLNEKN* |
Ga0114997_103665932 | 3300009425 | Marine | IIVKKLNVPVDLIRFINHISLKFAPFVYLININEKN* |
Ga0114997_106727992 | 3300009425 | Marine | VKKLNVPVDLIRFINHISLKIAPFVYLIIIYEKNKN* |
Ga0115559_12923172 | 3300009438 | Pelagic Marine | LLIIVKKPNVPVDLTMFINHISLNFTLIVYLIIKNEKN* |
Ga0115557_13338131 | 3300009443 | Pelagic Marine | ISLIYPSNLLITVKKLNVPVDLIRFINHISLKFAPFVYLITLYEKNKN* |
Ga0115553_11110711 | 3300009445 | Pelagic Marine | NLLIIVKKPNVPVDLTKFINHISLNFTPFVHLISLNEKN* |
Ga0115553_11155141 | 3300009445 | Pelagic Marine | LLIIVKKLNVPVDLIRFINHISLKFAPIVYLININEKN* |
Ga0115560_11480992 | 3300009447 | Pelagic Marine | VKKLNVPVDLIRFINHISLKFVPFVYLININEKN* |
Ga0115558_13431222 | 3300009449 | Pelagic Marine | NLLIIVKKLNVPVDLIKFINHISLKFAPFVYLITINEKN* |
Ga0115565_102964081 | 3300009467 | Pelagic Marine | PNNLLIMVKKLNVPVDLIKFINHISLKFALFVYLININEKN* |
Ga0114932_102392641 | 3300009481 | Deep Subsurface | DNLLIKVKKLNVPVDLIRFINHISLKFAPFVYLIT* |
Ga0115569_100098271 | 3300009497 | Pelagic Marine | LLIIVKKLNVPVDLIRFINHISLKFAPFVYLININEKN* |
Ga0115569_100670592 | 3300009497 | Pelagic Marine | LIIVKKLNVPVDLIRLINHISLKFVPFVYLININEKN* |
Ga0115569_101701251 | 3300009497 | Pelagic Marine | PSNLLIIVKKPNVPVDLTIFINHISLNFTLIVYLIIKNEKN* |
Ga0115568_102563621 | 3300009498 | Pelagic Marine | IVKKLNVPVDLIRFINHISLKFVPFVYLININEKN* |
Ga0115564_101781391 | 3300009505 | Pelagic Marine | LIIVKKLNVPVDLIKFINHISLKFTPFVYLININEKN* |
Ga0115564_102616992 | 3300009505 | Pelagic Marine | LLIIVKKLNVPVDLINFINHISLKFTPFVYLININEKN* |
Ga0115567_100328041 | 3300009508 | Pelagic Marine | NLLIIVKKLNVPVDLIRFINHISLKFALFVYLININEKN* |
Ga0115567_105347292 | 3300009508 | Pelagic Marine | NLLIIVKKLKVPVDLIKFINHISLNFTPFVHLINLNEKNKD* |
Ga0115567_105994562 | 3300009508 | Pelagic Marine | NNLLIVVKKLNVPVDLIKFINHISLKFTPFVYLININEKN* |
Ga0115567_106883341 | 3300009508 | Pelagic Marine | LIIVKKLNVPVDLIRFINHISLKFAPFVYLININEKN* |
Ga0115004_100574561 | 3300009526 | Marine | IIVKKLNVPVDLIRFINHISHKFVPFVYLITINEKN* |
Ga0115004_102219212 | 3300009526 | Marine | VKKLNVPVDLIRFINHISLKFTPFVYLININEKN* |
Ga0115004_106643341 | 3300009526 | Marine | VKKLNVPVDLIRFINHISLKFATFVYLININEKN* |
Ga0115004_106806671 | 3300009526 | Marine | NLLIIVKKLNVLVDLIRFINHISHKLAPFVYLITINEKN* |
Ga0115004_106820831 | 3300009526 | Marine | IIVKKLNVLVDLIRFINHISLKFAPFVYLININEKN* |
Ga0115004_106955481 | 3300009526 | Marine | VKKLNVPVDLIKFINHISLKFVPFVYLININEKN* |
Ga0115013_105830571 | 3300009550 | Marine | SILLIKVKNPNVPVDLSKFINHISLNYTLIVYLINPNEKNKD* |
Ga0115011_100574743 | 3300009593 | Marine | LKYPVILLNKVKKLNVLVDLIKFINHISLKFASIVYFITLNEKN* |
Ga0115011_114067031 | 3300009593 | Marine | KPKVPVDLTKFINHISLNFTPFVHLININEKNKN* |
Ga0115000_105097432 | 3300009705 | Marine | PSNLLIIVKKLNVPVDLIKFINHISLKFDPFVYLIDLNEKN* |
Ga0115000_107046861 | 3300009705 | Marine | NNLLINVKKLNVPVDLIRFINHISHKFAPIVYLININEKN* |
Ga0115000_107953171 | 3300009705 | Marine | LIIVKKLNVPVDLIRFINHISLKFAVFVYLININEKN* |
Ga0115000_108002751 | 3300009705 | Marine | LIMVKKLNVPVDLIRFINHISLKFAPFVYLININEKN* |
Ga0115002_102795681 | 3300009706 | Marine | KLNVPVDLIRFINHISLKIAPFVYLININEKNKS* |
Ga0115002_108841681 | 3300009706 | Marine | LITVKKLNVPVDLIRFINHISLKFVPFVYLIINNEKNKN* |
Ga0115001_100112691 | 3300009785 | Marine | LINVKKLNVPVDLIRFINHISHKFAPIVYLININEKN* |
Ga0115001_100645762 | 3300009785 | Marine | VKKLNVPVDLIRFINHISLKFAAFVYLINKYEKN* |
Ga0115001_100863552 | 3300009785 | Marine | NLLIIVKKLNVPVDLIRFINHISHKLASFVYLITINEKN* |
Ga0115001_106182561 | 3300009785 | Marine | VKKLNVPVDLMRFINHISHKFAPFVYLININEKN* |
Ga0114999_110956551 | 3300009786 | Marine | VKKLNVPVDLIRFINHISLKFVPFVYLIINNEKNKN* |
Ga0133547_102050625 | 3300010883 | Marine | VPRNTAINISLKYPNILLIIVKKLNVPVDLMRFINHISLKFAPFVYLININEKN* |
Ga0133547_104773073 | 3300010883 | Marine | IRISLTYPNSLLIIVKKLNVPVDLIRFINHISLKFAAFVYLININEKN* |
Ga0133547_107262721 | 3300010883 | Marine | PNNLLIIVKKLNVPVDLIRFINHISLKFVPFVYLININEKN* |
Ga0133547_117045321 | 3300010883 | Marine | LIIVKKLNVPVDLIRFINHISLKIAPFVYLININEKN* |
Ga0133547_119537912 | 3300010883 | Marine | LIIVKKLNVPVDLIRFINHISHKFAPFVYLITINEKN* |
Ga0133547_120744101 | 3300010883 | Marine | NNLLIIVKKLNVPVDLIRFINHISHKLAPFVYLIIINEKN* |
Ga0160422_109516121 | 3300012919 | Seawater | KPKVPVDLTKFINHISLKFTSFVHLINLNEKNKN* |
Ga0163110_103907892 | 3300012928 | Surface Seawater | LNKVKNPNVPVDLSKFINHISLNYTLIVYLINLNEKNKD* |
Ga0163109_104383162 | 3300012936 | Surface Seawater | VKNPNVPVDLSKFINHISLNYTLIVYLINLNEKNKD* |
Ga0163111_100985661 | 3300012954 | Surface Seawater | NPNVPVDLSKFINHISLNYTLIVYLINLNEKNKD* |
Ga0163111_102297011 | 3300012954 | Surface Seawater | NNLLIIVKKPKVPVDLIKFINHISLNFTPFVHLINKNEKN* |
Ga0163111_114948511 | 3300012954 | Surface Seawater | VKKLNVPVDLIRFINHISLNLALFVYLITKNEKK* |
Ga0163111_123877451 | 3300012954 | Surface Seawater | LNKVKNPNVPVDLSRFINHISLNYTLIVYLINPNEKNKD* |
Ga0180120_100594102 | 3300017697 | Freshwater To Marine Saline Gradient | MVKKLNVPVDLIKFINHISLKFAPFVYLININEKN |
Ga0181408_11402821 | 3300017760 | Seawater | PSNLLIIVKKPNVPVDLTMFINHISLNFTLIVYLIIKNEKN |
Ga0181424_100265881 | 3300017786 | Seawater | TVKKLNVPVDLIRFINHISLKFAPFVYLITLYEKNKNXSLHX |
Ga0181424_103841901 | 3300017786 | Seawater | NVPVDLIRFINHISLKFAPFVQLITLNEKNKNRSLY |
Ga0181424_103925961 | 3300017786 | Seawater | LIIVKKLNVPVDLTIFINHISLNFTRIVYLIIKNEKN |
Ga0181424_104251002 | 3300017786 | Seawater | TVKKPKVPVDLIKFINHISLNFTPFVHLININEKNKN |
Ga0181552_103465251 | 3300017824 | Salt Marsh | LLIIVKKPNVPVDLTMFINHISLNFTLIVYLIIKNEKN |
Ga0181581_106513321 | 3300017962 | Salt Marsh | SNLLIIVKKPNVPVDLTMFINHISLNFTLIVYLIIENEKN |
Ga0181562_105852532 | 3300019459 | Salt Marsh | IVKKPNVPVDLTMFINHISLNFTLIVYLIIKNEKN |
Ga0181595_102616651 | 3300020053 | Salt Marsh | LIIVKKPNVPVDLTMFINHISLNFTLIVYLIIKNEKN |
Ga0206131_101696542 | 3300020185 | Seawater | PSSLLIIVKKLNVPVDLIKFINHISLKLVPFVYLININEKN |
Ga0211492_10702672 | 3300020238 | Marine | NNLLIIVKKLNVPVDLIRFINHISLKFAPFVYLIT |
Ga0211533_10574172 | 3300020265 | Marine | ILLIIVKKLNVPVDLIRFINHISLKIALFVYLIIVNEKNKN |
Ga0211663_10231881 | 3300020292 | Marine | KIAINISLKYPVNLLIKVKKLNVPVDLIRFINHISLKFAPFVYLIT |
Ga0211530_10172242 | 3300020295 | Marine | ILLIKVKKLNVLVDLIKFINHISLKIAPFVYLITQNEKK |
Ga0211688_10619541 | 3300020317 | Marine | NLLIMVKKLNVPVDLIKFINHISLKFAPFVYLININEKN |
Ga0211630_10531211 | 3300020324 | Marine | PSILLIIVKKLNVVVDLNRFINHISLKIASIVYLIALNEKN |
Ga0211689_10538412 | 3300020358 | Marine | LLIIVKKLNVPVDLIRFINHISLKFAPFVYLININEKN |
Ga0211531_10158981 | 3300020361 | Marine | ILLIKVKKLNVLVDLIKFINHISLKIALFVYLITQNEKK |
Ga0211672_101706492 | 3300020370 | Marine | DPRFIAIKTSLKYPRILLISVKKLNVDVDLIRFINHISLKFALIVYLIT |
Ga0211683_100967502 | 3300020372 | Marine | LIIVKKLNVPVDLIRFINHISHKLALFVYLITINEKN |
Ga0211683_101255951 | 3300020372 | Marine | IIVKKLNVPVDLIKFINHIGLKIAPFVYLININEKN |
Ga0211683_102399102 | 3300020372 | Marine | LIIVKKLNVPVDLIRFINHISHKLASFVYLITINEKN |
Ga0211683_102503642 | 3300020372 | Marine | IIVKKLKVPVDLIRFINHIGHKFAPFVYLITINEKN |
Ga0211682_103177881 | 3300020376 | Marine | SNLLIIVKKLNVPVDLIRFINHISLIIAPFVYLININEKN |
Ga0211686_100399001 | 3300020382 | Marine | LIIVKKLNVPVDLIRFINHISHKFAPFVYLININEKN |
Ga0211686_100672832 | 3300020382 | Marine | PSNLLIIVKKLNVPVDLIRFINHISHKLTPFVYLITIDEKK |
Ga0211686_102585172 | 3300020382 | Marine | PSNLLIIVKKLNVPVDLIRFINHISLKFAPFVYLININEKN |
Ga0211686_102909491 | 3300020382 | Marine | PSNLLIIVKKLNVPVDLIRFINHISIIFAPFVYLININEKN |
Ga0211686_103545662 | 3300020382 | Marine | LIIVKKLNVPVDLIRFINHISLKFAAFVYLININEKN |
Ga0211686_104115181 | 3300020382 | Marine | PSNLLIIVKKLNVPVDLIRFINHISHKLTPFVYIIFINEKN |
Ga0211677_102270091 | 3300020385 | Marine | IIVKKLNVPVDLIRFINHISLKFVPFVYLININEKN |
Ga0211677_102738572 | 3300020385 | Marine | PNVPVDLSKFINHISLNYTLIVYLINPNEKNKDXSLHR |
Ga0211675_100209041 | 3300020391 | Marine | PVDLSKFINHISLIFTLIVHIIVTNEKNKDXSLHR |
Ga0211687_103421292 | 3300020396 | Marine | NNLLIIVKKLNVPVDLIRFINHISLKFAPFVYLININEKN |
Ga0211583_100400441 | 3300020397 | Marine | KVPVDLIKFINHISLNLTPFVHLIDINEKNKSXSLHX |
Ga0211587_102607062 | 3300020411 | Marine | SILLIKVKKPNVLVDLIRFINHISLKFALIVYLFTKNEEK |
Ga0211552_102253252 | 3300020412 | Marine | PSILLIIVKKLNVVVDLIKFINHIDLGIAPIVYLTTLNEKKQK |
Ga0211516_103290232 | 3300020413 | Marine | VKKLKVPVDLIKFINHISLNFIPFVHLIAKNEKNKN |
Ga0211516_103408202 | 3300020413 | Marine | IIVKKLNVPVDLIRFINHISLKIAPFVYLIIINEKNKN |
Ga0211554_101868522 | 3300020431 | Marine | KISLKYPSILLTIVKKLNVPVDLIRFINHISLKIALFVYLIIVNEKNKN |
Ga0211556_100698532 | 3300020432 | Marine | VNLLIKVKKLNVPVDLIRFINHISLKFAPFVYLIT |
Ga0211556_101431201 | 3300020432 | Marine | INTSLKYPSILLIIVKKLNVPVDLIRFINHISLKIAPFVYLII |
Ga0211576_101670311 | 3300020438 | Marine | IIVKKLNVPVDLIRFINHISLKFAPFVYLINNNEKNKNXSLHR |
Ga0211518_102121011 | 3300020440 | Marine | VKKLNVPVDLIRFINHTSLKFAPFVYLIIINEKNKNKSLH |
Ga0211695_100115971 | 3300020441 | Marine | LIKVKKLNVPVDLIRFINHISLKFTLFVYLIVINEKK |
Ga0211559_100189121 | 3300020442 | Marine | PSTLLRITKILNVPVDLIMFINHISLNLALIVYFITLNEKK |
Ga0211559_102663172 | 3300020442 | Marine | TLLIKTKKLNVPVDLIMFINHISLNLDLIVYLNIQNEES |
Ga0211564_102036281 | 3300020445 | Marine | KVKKLNVLVDLIKFINHISLKFASIVYFIALNEKN |
Ga0211564_102099052 | 3300020445 | Marine | IKVKKPNVLVDLIRFINHISLKFALFVYLFTQNEEK |
Ga0211564_104181091 | 3300020445 | Marine | YPSILLTKVKKLNVVVDLIRFINHISLKFALFVYLFTQNEEK |
Ga0211564_106154772 | 3300020445 | Marine | LIIVKKPNVVVDLNRFINHISLKIASIVYLITLNEKK |
Ga0211574_104363232 | 3300020446 | Marine | KVKNPNVPVDLSKFINHISLNYTLIVYLINLNEKNKDXSLYR |
Ga0211473_104196771 | 3300020451 | Marine | NKSLKYPSILLIKVKKPNVLVDLIKFINHISLKFALIVYLFTLNEEK |
Ga0211550_102278822 | 3300020453 | Marine | LRYPVNLLIKVKKLNVPVDLIRFINHISLKFAPFVYLNTQNEKK |
Ga0211548_102206582 | 3300020454 | Marine | PSILLIIVKKLNVPVDLIRFINHISLKIAPFVYLIIINEKNKN |
Ga0211548_104697471 | 3300020454 | Marine | PDILLNKVKNPNAPVDLIKFINHISLNFNLFVYLNKKNEKNKDTSLF |
Ga0211664_101434691 | 3300020455 | Marine | KTLLISVKKLNVPVDLIRFINHISLNLALFVYLITKNEKKQNSTLFR |
Ga0211551_100439412 | 3300020456 | Marine | LLIKVKKLKVPVDLIRFINHISLKFAPFVYLISKNEKK |
Ga0211551_102201662 | 3300020456 | Marine | IVKKLNVVVDLNKFINHISLKIASFVYLITLNEKN |
Ga0211643_101416151 | 3300020457 | Marine | NVPVDLSKFINHISLNYTLIVYLINPNEKNKDRSLHR |
Ga0211514_101502131 | 3300020459 | Marine | LIIVKKLNVPVDLIRFINHISLKIAPFVYLIIINEKNKN |
Ga0211514_101751361 | 3300020459 | Marine | NTLLTKVKKPNAPVDLIKFINHISLNFNLLVYLNKKNEKI |
Ga0211535_102568682 | 3300020461 | Marine | RTLLIRVKKPKAPVDLIKFINHISLNFDLFVYLNIKNEKI |
Ga0211676_103498371 | 3300020463 | Marine | NVPVDLSKFINHISLNYTLIVYLINLNEKNKDXSLHR |
Ga0211640_101307761 | 3300020465 | Marine | NILLIVVKKLNVPVDLIRFINHISLKIALFVYLININEKNKN |
Ga0211714_103100541 | 3300020466 | Marine | ILLIKVKTLKVPVDLIRFINHISLKFAPFVYLISKNEKK |
Ga0211475_100823342 | 3300020468 | Marine | KPNVPVDLSKFINHISLKFTLIVHIIKINEKNKDXPLHRQRSLSFP |
Ga0211614_100979811 | 3300020471 | Marine | PSSLLIIVKKPKVPVDLIKFINHISLNLTPFVHLISINEKNKD |
Ga0211715_103946841 | 3300020476 | Marine | AIKISLIYPRILLIIVKKLNVVVDLNKFINHISLKIASIVYLYYINEKNKN |
Ga0211585_101264691 | 3300020477 | Marine | LIKVKKLNVLVDLIKFINHISLKIALFVYLISKNEKK |
Ga0211585_105740721 | 3300020477 | Marine | IVKKLNVPVDLIRFINHISLKIAPFVYLIIINEKNKN |
Ga0206684_11922612 | 3300021068 | Seawater | LIIVKKPNVPVDLTKFINHISLNFTLFVYLIIINEKN |
Ga0206679_103131402 | 3300021089 | Seawater | KRSLKYPSILLIRTKKLNVLVDLIRFINHISLNLALFVYLINNNEKK |
Ga0226832_101965401 | 3300021791 | Hydrothermal Vent Fluids | IIVKKLNVVVDLNRFINHISLKIALIVHFITLNLLH |
(restricted) Ga0233426_102816961 | 3300022920 | Seawater | NLLIIVKKLNVLVDLIKFINHISLKFAPFVYLININEKN |
Ga0255773_102090111 | 3300022925 | Salt Marsh | IIVKKPNVPVDLTMFINHISLNFTLIVYLIIKNEKN |
Ga0255743_101430921 | 3300023110 | Salt Marsh | LNTVKKLNVPVDLIKFINHISLNLVLFVHINTENEKNKSXSLHX |
Ga0255762_103149091 | 3300023119 | Salt Marsh | IAIKTSLKYPRILLIKVKKLNVVVDLIRFINHISLNLALFVYLIT |
Ga0255762_104244741 | 3300023119 | Salt Marsh | KISLIYPDILLNTVKKLNVPVDLIKFINHISLNLVLFVHINTENEKNKS |
Ga0255777_102611072 | 3300023175 | Salt Marsh | LIYPDILLNTVKKLNVPVDLIKFINHISLNLVLFVHINTENEKNKS |
Ga0228665_10453811 | 3300024235 | Seawater | LLIIVKKPNVPVDLTMFINHISLNFTLIVYLIIQNEKN |
(restricted) Ga0233442_10770152 | 3300024257 | Seawater | IIVKKLNVPVDLRRFINHISLKFASIVYLITKNEKN |
(restricted) Ga0233443_11889472 | 3300024324 | Seawater | IIVKKPNVLVDLTKFINHISLNFTLFVYLIIINEKN |
Ga0244777_107142131 | 3300024343 | Estuarine | IIVKKLNVPVDLTMFINHISLNFTLIVYLIIKNEKN |
Ga0208770_10726612 | 3300025438 | Saline Lake | VPRKIAIKISLKYPDNLLINVKKLNVPVDLRRFINHISLKFAPFVYLININEKN |
Ga0209659_10131951 | 3300025658 | Marine | IVKKLNVPVDLIRFINHISLKFVPFVYLININEKN |
Ga0209664_10722622 | 3300025662 | Marine | IMVKKLNVPVDLIKFINHISLKFAPFVYLININEKN |
Ga0209095_11579821 | 3300025685 | Pelagic Marine | LIIVKKLNVPVDLIRFINHISLKFAPFVYLININEKN |
Ga0209661_12286611 | 3300025700 | Marine | IIVKKPNVPVDLTKFINHISLNFTLFVYLIIINEKN |
Ga0209667_11261911 | 3300025707 | Marine | LLIIVKKPNVPVDLTKFINHISLNFTLFVYLIIINEKN |
Ga0209660_11900281 | 3300025722 | Marine | PNNLLIIVKKLNVPVDLIKFINHISLKFVPFVYLININEKN |
Ga0209223_100243441 | 3300025876 | Pelagic Marine | SLLIIVKKLKVPVDLIKFINHISLNFTVFVDLININEKNKD |
Ga0209632_1000558811 | 3300025886 | Pelagic Marine | IVKKLNVPVDLIRFINHISLKFAPFVYLININEKN |
Ga0209425_103430881 | 3300025897 | Pelagic Marine | LITVKKLNVPVDLIRFINHISLKIALFVYLININEKN |
Ga0208261_10231432 | 3300026076 | Marine | LKYPSILLIKVKKPNVLVDLIRFINHISLKFALIVYLFTKNEEK |
Ga0208749_11232912 | 3300026077 | Marine | TLTYPVNLLIKVKKLNVPVDLIRFINHISLKFAPFVYLIT |
Ga0208407_11819292 | 3300026257 | Marine | KTSLKYPVILLIKVKKLNVLVDLIKFINHISLKFASIVYFIALNEKN |
Ga0208765_10384852 | 3300026265 | Marine | IVKKLNVVVDLNRFINHISFKIASIVYLITLNEKN |
Ga0208278_10036207 | 3300026267 | Marine | TSLKYPSILLIKVKKLNVLVDLIKFINHISLKIALFVYLITQNEKK |
Ga0208277_11184501 | 3300026292 | Marine | IIVKKLNVVVDLNKFINHISLKIASIVYLITLNEKN |
Ga0208764_101237382 | 3300026321 | Marine | PSNLLIIVKKLNVPVDLTKFINHINLNFTLFVYLIVINEKNKNKSLHR |
Ga0208764_103358961 | 3300026321 | Marine | NISLRYPVNLLIKVKKLNVPVDLIRFINHISLKFAPFVYLIT |
Ga0208964_10524142 | 3300027572 | Marine | LIIVKKLNVPVDLTMFINHISLNFTLIVYLIIKNEKN |
Ga0209710_10029611 | 3300027687 | Marine | PSNLLIIVKKLNVPVDLIRFINHISHKLTAFVYVIFINEKN |
Ga0209710_11863291 | 3300027687 | Marine | LIVVKKLNVPVDLIRFINHISLIFTPFVYLININEKN |
Ga0209036_11596741 | 3300027702 | Marine | PKILLSRVKKPNVPVDLIKFINHISLNLALFVYLINKNEKK |
Ga0209192_101491112 | 3300027752 | Marine | NLLIIVKKLNVPVDLIRFINHISHKLAPFVYLITINEKN |
Ga0209709_100718541 | 3300027779 | Marine | IIVKKLNVPVDLIRFINHISLKFAPFVYLINLNEKN |
Ga0209709_102013701 | 3300027779 | Marine | PSNRLIIVKKLNVLVDLIRFINHISLKFAPFVYLINNNEKNKN |
Ga0209709_102778002 | 3300027779 | Marine | PSNLLTIVKKLNVLVDLIRFINHISLKFAPFVYLININEKNNS |
Ga0209709_103915352 | 3300027779 | Marine | MVKKLNVPVDLIKFINHISLKFAPFVYLININEKNQNRPLHX |
Ga0209502_100320723 | 3300027780 | Marine | NSLLIIVKKLNVPVDLIRFINHISLKFAPFVYLININEKN |
Ga0209502_103151041 | 3300027780 | Marine | KNLLIIVKKLNVPVDLIRFINHISLKFAPFVYLININEKN |
Ga0209830_103656792 | 3300027791 | Marine | NLLIIVKKLNVPVDLIRFINHISHKLTAFVYVIFINEKN |
Ga0209091_100639921 | 3300027801 | Marine | LLINVKKLNVPVDLIRFINHISHKFAPIVYLININEKN |
Ga0209091_103033451 | 3300027801 | Marine | PSNLLIIVKKLNVPVDLIRFINHISHKLTPFVYLITINEKN |
Ga0209091_104357522 | 3300027801 | Marine | LLIMVKKLNVPVDLIRFINHISLKFAPFVYLININEKN |
Ga0209091_104946831 | 3300027801 | Marine | LIIVKKLNVPVDLIRFINHISLKFAVFVYLININEKN |
Ga0209090_101948762 | 3300027813 | Marine | TYPSNLLIIVKKLNVPVDLIRFINHISHKLASFVYLITINEKN |
Ga0209090_102851781 | 3300027813 | Marine | IIVKKLNVPVDLIRFINHISLKIAPFVYLININEKN |
Ga0209090_103807301 | 3300027813 | Marine | SNLVIIVKKLNVPVDLIKFINHISLKFDPFVYLINLNEKN |
Ga0209035_101329601 | 3300027827 | Marine | PSILLIIVKKLNVVVDLNRFINHISLKNASIVYLITLNEKN |
Ga0209089_105937631 | 3300027838 | Marine | RTSLIYPNNLLTKVKKLKVPVDLIRFINHISLKSAPFVYLIT |
Ga0209713_104423482 | 3300027883 | Marine | TYPNNLLIIVKKPNVPVDLIRFINHISLKFAPFVYLININEKN |
Ga0233450_101080432 | 3300028115 | Salt Marsh | IIVKKPNVPVDLTMFINHISLNLTLIVYLIIKNEKN |
Ga0257106_10903302 | 3300028194 | Marine | PSNLLIIVKKLNVPVDLIRFINHISLKFASFVYLININEKN |
Ga0257111_10641682 | 3300028535 | Marine | PSTLLIRVKKLNVPVDLIRFINHISLKIAPFVYLINVNEKNKS |
Ga0308010_10122901 | 3300031510 | Marine | SSLLIIVKKLNVPVDLIRFINHISLNFTPFVHLIKINEKNKN |
Ga0308010_10513882 | 3300031510 | Marine | MVKKLNVPVDLRRFINHISLKFAAFVKLIIYNEKNKN |
Ga0308010_10588212 | 3300031510 | Marine | AINISLRYPNNLLIIVKKLNVPVDLIRFINHISHKLAPFVYLITINEKN |
Ga0308010_11647401 | 3300031510 | Marine | NLLIIVKKLNVPVDLIRFINHISHKLTPFVYLITINEKN |
Ga0308010_12838772 | 3300031510 | Marine | LIIVKKLNVPVDLIRFINHISHKFAQFVYLIIINEKN |
Ga0308019_100564682 | 3300031598 | Marine | TYPSNLLIIVKKLNVPVDLIRFINHISHKLTPFVYIIFINEKN |
Ga0308007_101250111 | 3300031599 | Marine | PSNLLIIVKKLNVPVDLIRFINHISLKFAAFVYLIIINEKI |
Ga0308007_102908451 | 3300031599 | Marine | LLIIVKKLNVLVDLIRFINHTSLKFAPFVYLININEKN |
Ga0308004_100727532 | 3300031630 | Marine | NLLIIVKKLNVLVDLIRFINHISHKFAPFVYLININEKN |
Ga0308004_101306441 | 3300031630 | Marine | PSNLLIMVKKLNVPVDLIRFINHISLKFAPFVSLININEKN |
Ga0308004_102908161 | 3300031630 | Marine | LLNIVKKLNVPVDLIRFINHISRKLTPFVYLITINEKN |
Ga0308001_101302211 | 3300031644 | Marine | NLLIMVKKLNVPVDLIRFINHISHKLAPFVYLITINEKN |
Ga0308001_102366232 | 3300031644 | Marine | IVKKLKVPVDLIKFINHISLNFIPFVHLIIKNEKNKD |
Ga0307986_103176472 | 3300031659 | Marine | LIIVKKLKVPVDLIRFINHISHKFAPFVYLITINEKN |
Ga0307986_103462522 | 3300031659 | Marine | LIMVKKLNVPVDLIKFINHISLKFTPFVYLININEKN |
Ga0308016_103323931 | 3300031695 | Marine | LIMVKKLNVPVDLIRFINHISHKLAPFVYLIIINEKN |
Ga0307995_12679131 | 3300031696 | Marine | LLIIVKKLNVPVDLIRFINHISYKLTPFVYLITINEKN |
Ga0307995_13142952 | 3300031696 | Marine | LIIVKKLNVPVDLIRFINHISHKLTPFVYLITINEKN |
Ga0308013_100968752 | 3300031721 | Marine | LIIVKKLNVAVDLIRFINHISLKIAPFVYLININEKN |
Ga0308013_101192761 | 3300031721 | Marine | IIVKKLNVPVDLIKFINHISLKFVPFVYLININEKN |
Ga0315322_108295681 | 3300031766 | Seawater | NNLLIMVKKLNVPVDLIKFINHISLKFAPFVYLININEKN |
Ga0315331_112096962 | 3300031774 | Seawater | LIKVKNPNVPVDLSKFINHISLNYTLIVYLINPNEKNKDXSLHR |
Ga0315326_103314392 | 3300031775 | Seawater | SNLLIIVKKPNVPVDLTMFINHISLNFTLIVYLIIKNEKN |
Ga0315326_104117842 | 3300031775 | Seawater | IAINKSLKYPSILLIKVKKPNVLVDLIRFINHISLKFALFVYLFTQNEEK |
Ga0315326_106013771 | 3300031775 | Seawater | NVKKLNVPVDLIRFINHISLKIAPFVYLIIINEKNKNXSLHR |
Ga0310343_105248972 | 3300031785 | Seawater | IKVKKPNVLVDLIRFINHISLKFALIVYLFTKNEEK |
Ga0310343_107663501 | 3300031785 | Seawater | NVPVDLIRFINHISLKIALFVYLIIVNEKNKNXPLHR |
Ga0310121_102719001 | 3300031801 | Marine | LLIIVKKLNVVVDLSRFINHISLKIASIVYLITLNEKN |
Ga0310344_100428574 | 3300032006 | Seawater | RTSLKYPSILLIKVKKLNVPVDLIRFINHISLKIALFVYLITLNEEK |
Ga0310344_103130972 | 3300032006 | Seawater | IKVKKPNVLVDLIKFINHISLKFALIVYLFTLNEEK |
Ga0310344_104956461 | 3300032006 | Seawater | VILLIKVKKLNVLVDLIKFINHISLKFASIVYFITLNEKN |
Ga0310344_109747332 | 3300032006 | Seawater | RKIAIKISLIYPKILLIIVKKPKVVVDLNKFINHISLKIASIVYLYYIK |
Ga0315316_107679211 | 3300032011 | Seawater | LIIVKKLNVVVDLNKFINHISLKIASIVYLITLNEKN |
Ga0315330_105132981 | 3300032047 | Seawater | KVKNPNVPVDLSKFINHISLNYTLIVYLINPNEKNKDXSLHR |
Ga0315330_108592051 | 3300032047 | Seawater | PNVPVDLSKFINHISLNYTLIVYLINPNEKNKDRSLHR |
Ga0315315_103537851 | 3300032073 | Seawater | PNVPVDLSKFINHISLNYTLIVYLFNLNEKNKDXSLHR |
Ga0315315_105711042 | 3300032073 | Seawater | SNLLITVKKLNVPVDLIRFINHISLKFAPFVYLINNNEKNKN |
Ga0310345_112088521 | 3300032278 | Seawater | ISLIYPRILLIRVKKLNVVVDLNKFINHIGLKFASIIYIIIINEKI |
Ga0315334_104625322 | 3300032360 | Seawater | LLIIVKKLNVVVDLSRFINHISLKIAPIVYLITLNEKN |
Ga0315334_106719142 | 3300032360 | Seawater | LLIIVKKPNVVVDLIKFINHISLKFAPIVYIIIIDEKI |
⦗Top⦘ |