Basic Information | |
---|---|
Family ID | F011497 |
Family Type | Metagenome |
Number of Sequences | 290 |
Average Sequence Length | 37 residues |
Representative Sequence | MLHTRWSAEAWSQVRVEFRRALALRSEIRRAGWFN |
Number of Associated Samples | 158 |
Number of Associated Scaffolds | 290 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 4.17 % |
% of genes near scaffold ends (potentially truncated) | 42.76 % |
% of genes from short scaffolds (< 2000 bps) | 76.21 % |
Associated GOLD sequencing projects | 144 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.52 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (88.276 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (19.655 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.276 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.552 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.10% β-sheet: 0.00% Coil/Unstructured: 61.90% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 290 Family Scaffolds |
---|---|---|
PF04392 | ABC_sub_bind | 9.31 |
PF00072 | Response_reg | 4.14 |
PF00144 | Beta-lactamase | 1.03 |
PF01068 | DNA_ligase_A_M | 1.03 |
PF10137 | TIR-like | 0.69 |
PF12836 | HHH_3 | 0.69 |
PF00128 | Alpha-amylase | 0.69 |
PF11154 | DUF2934 | 0.69 |
PF02371 | Transposase_20 | 0.69 |
PF02347 | GDC-P | 0.69 |
PF00497 | SBP_bac_3 | 0.69 |
PF07603 | DUF1566 | 0.69 |
PF13424 | TPR_12 | 0.34 |
PF07076 | DUF1344 | 0.34 |
PF13751 | DDE_Tnp_1_6 | 0.34 |
PF03352 | Adenine_glyco | 0.34 |
PF01000 | RNA_pol_A_bac | 0.34 |
PF00296 | Bac_luciferase | 0.34 |
PF04909 | Amidohydro_2 | 0.34 |
PF07589 | PEP-CTERM | 0.34 |
PF13384 | HTH_23 | 0.34 |
PF00158 | Sigma54_activat | 0.34 |
PF13754 | Big_3_4 | 0.34 |
PF13175 | AAA_15 | 0.34 |
PF14317 | YcxB | 0.34 |
PF01957 | NfeD | 0.34 |
PF00300 | His_Phos_1 | 0.34 |
PF13450 | NAD_binding_8 | 0.34 |
PF10282 | Lactonase | 0.34 |
PF01345 | DUF11 | 0.34 |
PF02518 | HATPase_c | 0.34 |
PF00753 | Lactamase_B | 0.34 |
PF03972 | MmgE_PrpD | 0.34 |
PF07883 | Cupin_2 | 0.34 |
PF13676 | TIR_2 | 0.34 |
PF00291 | PALP | 0.34 |
PF07690 | MFS_1 | 0.34 |
PF10263 | SprT-like | 0.34 |
PF07452 | CHRD | 0.34 |
PF10771 | DUF2582 | 0.34 |
PF13282 | DUF4070 | 0.34 |
PF01844 | HNH | 0.34 |
PF05598 | DUF772 | 0.34 |
PF00106 | adh_short | 0.34 |
PF03724 | META | 0.34 |
PF00501 | AMP-binding | 0.34 |
PF00143 | Interferon | 0.34 |
PF13561 | adh_short_C2 | 0.34 |
PF02985 | HEAT | 0.34 |
PF05866 | RusA | 0.34 |
PF14833 | NAD_binding_11 | 0.34 |
PF14350 | Beta_protein | 0.34 |
PF01734 | Patatin | 0.34 |
PF13474 | SnoaL_3 | 0.34 |
PF12071 | DUF3551 | 0.34 |
PF13379 | NMT1_2 | 0.34 |
PF14437 | MafB19-deam | 0.34 |
PF00496 | SBP_bac_5 | 0.34 |
PF15639 | Tox-MPTase3 | 0.34 |
PF07859 | Abhydrolase_3 | 0.34 |
PF00578 | AhpC-TSA | 0.34 |
PF13646 | HEAT_2 | 0.34 |
PF13302 | Acetyltransf_3 | 0.34 |
PF01609 | DDE_Tnp_1 | 0.34 |
PF01494 | FAD_binding_3 | 0.34 |
PF00665 | rve | 0.34 |
PF01406 | tRNA-synt_1e | 0.34 |
PF00270 | DEAD | 0.34 |
PF02954 | HTH_8 | 0.34 |
PF09335 | SNARE_assoc | 0.34 |
PF06537 | DHOR | 0.34 |
PF00872 | Transposase_mut | 0.34 |
PF00589 | Phage_integrase | 0.34 |
COG ID | Name | Functional Category | % Frequency in 290 Family Scaffolds |
---|---|---|---|
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 9.31 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.03 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 1.03 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.03 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.03 |
COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 1.03 |
COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.69 |
COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.69 |
COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.69 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.69 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.69 |
COG0403 | Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain | Amino acid transport and metabolism [E] | 0.69 |
COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.69 |
COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.69 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.34 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.34 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.34 |
COG3187 | Heat shock protein HslJ | Posttranslational modification, protein turnover, chaperones [O] | 0.34 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.34 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.34 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.34 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.34 |
COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.34 |
COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.34 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.34 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.34 |
COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.34 |
COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.34 |
COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.34 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.34 |
COG2818 | 3-methyladenine DNA glycosylase Tag | Replication, recombination and repair [L] | 0.34 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.34 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.34 |
COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.34 |
COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.34 |
COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.34 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.34 |
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.34 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.34 |
COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.34 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.34 |
COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.34 |
COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.34 |
COG0202 | DNA-directed RNA polymerase, alpha subunit/40 kD subunit | Transcription [K] | 0.34 |
COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.34 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 88.62 % |
Unclassified | root | N/A | 11.38 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2040502001|FACENC_GAMC6GA01B5XUP | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 507 | Open in IMG/M |
3300000559|F14TC_100058520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29 | 1109 | Open in IMG/M |
3300000559|F14TC_100592412 | All Organisms → cellular organisms → Bacteria | 2290 | Open in IMG/M |
3300000559|F14TC_101160072 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
3300000955|JGI1027J12803_100275502 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 722 | Open in IMG/M |
3300000955|JGI1027J12803_102507406 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
3300000955|JGI1027J12803_103862994 | Not Available | 851 | Open in IMG/M |
3300000955|JGI1027J12803_105864472 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 945 | Open in IMG/M |
3300000955|JGI1027J12803_109320238 | Not Available | 1495 | Open in IMG/M |
3300000956|JGI10216J12902_107201543 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2360 | Open in IMG/M |
3300000956|JGI10216J12902_110447819 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 664 | Open in IMG/M |
3300000956|JGI10216J12902_110559428 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 992 | Open in IMG/M |
3300001431|F14TB_102212829 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 685 | Open in IMG/M |
3300005167|Ga0066672_10266309 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1106 | Open in IMG/M |
3300005186|Ga0066676_10559792 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300005294|Ga0065705_10424396 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
3300005294|Ga0065705_10947740 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 562 | Open in IMG/M |
3300005295|Ga0065707_10273957 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1064 | Open in IMG/M |
3300005295|Ga0065707_10379728 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 879 | Open in IMG/M |
3300005332|Ga0066388_101042602 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
3300005332|Ga0066388_104736058 | Not Available | 692 | Open in IMG/M |
3300005446|Ga0066686_11083951 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300005468|Ga0070707_100971075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas azotifigens | 815 | Open in IMG/M |
3300005471|Ga0070698_100102043 | All Organisms → cellular organisms → Bacteria | 2840 | Open in IMG/M |
3300005536|Ga0070697_101854737 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 539 | Open in IMG/M |
3300005540|Ga0066697_10009960 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 4863 | Open in IMG/M |
3300005552|Ga0066701_10163451 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1348 | Open in IMG/M |
3300005552|Ga0066701_10173374 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
3300005552|Ga0066701_10514752 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 739 | Open in IMG/M |
3300005552|Ga0066701_10626298 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 653 | Open in IMG/M |
3300005555|Ga0066692_10172818 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1339 | Open in IMG/M |
3300005557|Ga0066704_10288673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1111 | Open in IMG/M |
3300005557|Ga0066704_10536804 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 764 | Open in IMG/M |
3300005558|Ga0066698_10104228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Marinimicrobium → Marinimicrobium alkaliphilum | 1875 | Open in IMG/M |
3300005560|Ga0066670_10098886 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
3300005561|Ga0066699_11013081 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 575 | Open in IMG/M |
3300005713|Ga0066905_100966777 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300005764|Ga0066903_100208093 | Not Available | 2941 | Open in IMG/M |
3300005764|Ga0066903_100744092 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1739 | Open in IMG/M |
3300005764|Ga0066903_106880483 | Not Available | 590 | Open in IMG/M |
3300006032|Ga0066696_10862212 | Not Available | 577 | Open in IMG/M |
3300006034|Ga0066656_10971212 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 545 | Open in IMG/M |
3300006034|Ga0066656_11029651 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300006194|Ga0075427_10049845 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300006796|Ga0066665_10884905 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 693 | Open in IMG/M |
3300006797|Ga0066659_10615551 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 882 | Open in IMG/M |
3300006800|Ga0066660_10377721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1161 | Open in IMG/M |
3300006800|Ga0066660_10979006 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 682 | Open in IMG/M |
3300006844|Ga0075428_100184401 | All Organisms → cellular organisms → Bacteria | 2258 | Open in IMG/M |
3300006844|Ga0075428_100232543 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1989 | Open in IMG/M |
3300006844|Ga0075428_100493341 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1310 | Open in IMG/M |
3300006844|Ga0075428_100840262 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
3300006844|Ga0075428_100884120 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
3300006844|Ga0075428_101075807 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 850 | Open in IMG/M |
3300006844|Ga0075428_102126022 | Not Available | 580 | Open in IMG/M |
3300006845|Ga0075421_101486858 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 741 | Open in IMG/M |
3300006845|Ga0075421_101650407 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300006846|Ga0075430_100225585 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 1554 | Open in IMG/M |
3300006847|Ga0075431_100357000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. SMC-2 | 1469 | Open in IMG/M |
3300006847|Ga0075431_102165597 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300006852|Ga0075433_10008134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8352 | Open in IMG/M |
3300006852|Ga0075433_10032430 | All Organisms → cellular organisms → Bacteria | 4474 | Open in IMG/M |
3300006852|Ga0075433_10116405 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2371 | Open in IMG/M |
3300006852|Ga0075433_10143464 | All Organisms → cellular organisms → Bacteria | 2123 | Open in IMG/M |
3300006852|Ga0075433_10763633 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 845 | Open in IMG/M |
3300006854|Ga0075425_100010720 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 9785 | Open in IMG/M |
3300006854|Ga0075425_100024301 | All Organisms → cellular organisms → Bacteria | 6669 | Open in IMG/M |
3300006854|Ga0075425_100046032 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4875 | Open in IMG/M |
3300006854|Ga0075425_100660454 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1201 | Open in IMG/M |
3300006854|Ga0075425_102522857 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 569 | Open in IMG/M |
3300006854|Ga0075425_102531967 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 568 | Open in IMG/M |
3300006871|Ga0075434_100041661 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 4549 | Open in IMG/M |
3300006871|Ga0075434_100589888 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
3300006871|Ga0075434_101006165 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 847 | Open in IMG/M |
3300006871|Ga0075434_101938461 | Not Available | 595 | Open in IMG/M |
3300006871|Ga0075434_102364437 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 534 | Open in IMG/M |
3300006880|Ga0075429_101018180 | Not Available | 724 | Open in IMG/M |
3300006881|Ga0068865_102046297 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 520 | Open in IMG/M |
3300006904|Ga0075424_102825295 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 505 | Open in IMG/M |
3300006969|Ga0075419_10342149 | Not Available | 1016 | Open in IMG/M |
3300006969|Ga0075419_10765922 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 689 | Open in IMG/M |
3300006969|Ga0075419_11236420 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 552 | Open in IMG/M |
3300007255|Ga0099791_10215282 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 907 | Open in IMG/M |
3300007265|Ga0099794_10024931 | All Organisms → cellular organisms → Bacteria | 2749 | Open in IMG/M |
3300007265|Ga0099794_10480796 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 653 | Open in IMG/M |
3300009012|Ga0066710_100131080 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3442 | Open in IMG/M |
3300009012|Ga0066710_100831711 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1417 | Open in IMG/M |
3300009012|Ga0066710_100976181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1307 | Open in IMG/M |
3300009012|Ga0066710_101104965 | Not Available | 1226 | Open in IMG/M |
3300009012|Ga0066710_101679525 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 968 | Open in IMG/M |
3300009012|Ga0066710_101714728 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 955 | Open in IMG/M |
3300009012|Ga0066710_104514576 | Not Available | 520 | Open in IMG/M |
3300009012|Ga0066710_104772151 | Not Available | 507 | Open in IMG/M |
3300009038|Ga0099829_10065856 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2734 | Open in IMG/M |
3300009088|Ga0099830_10836519 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 760 | Open in IMG/M |
3300009089|Ga0099828_10569624 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1020 | Open in IMG/M |
3300009090|Ga0099827_10002614 | All Organisms → cellular organisms → Bacteria | 10008 | Open in IMG/M |
3300009090|Ga0099827_10212510 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1613 | Open in IMG/M |
3300009094|Ga0111539_13321190 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 518 | Open in IMG/M |
3300009100|Ga0075418_10106697 | All Organisms → cellular organisms → Bacteria | 2974 | Open in IMG/M |
3300009100|Ga0075418_10881316 | Not Available | 967 | Open in IMG/M |
3300009100|Ga0075418_12006437 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 630 | Open in IMG/M |
3300009137|Ga0066709_101493227 | Not Available | 976 | Open in IMG/M |
3300009137|Ga0066709_101561944 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
3300009137|Ga0066709_102384913 | Not Available | 720 | Open in IMG/M |
3300009137|Ga0066709_103293087 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 588 | Open in IMG/M |
3300009137|Ga0066709_103526844 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 568 | Open in IMG/M |
3300009137|Ga0066709_103589800 | Not Available | 563 | Open in IMG/M |
3300009147|Ga0114129_12394093 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 632 | Open in IMG/M |
3300009156|Ga0111538_10882962 | Not Available | 1132 | Open in IMG/M |
3300009162|Ga0075423_10192272 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2141 | Open in IMG/M |
3300009162|Ga0075423_10953608 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 910 | Open in IMG/M |
3300009162|Ga0075423_12453868 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 569 | Open in IMG/M |
3300009162|Ga0075423_12519328 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 562 | Open in IMG/M |
3300009162|Ga0075423_12892400 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300009553|Ga0105249_10611191 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1145 | Open in IMG/M |
3300009553|Ga0105249_11285623 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 803 | Open in IMG/M |
3300009792|Ga0126374_11840315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 507 | Open in IMG/M |
3300009810|Ga0105088_1114890 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300009814|Ga0105082_1023992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 939 | Open in IMG/M |
3300009822|Ga0105066_1091049 | Not Available | 668 | Open in IMG/M |
3300010046|Ga0126384_10028458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3687 | Open in IMG/M |
3300010335|Ga0134063_10228500 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 881 | Open in IMG/M |
3300010336|Ga0134071_10113116 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
3300010336|Ga0134071_10322949 | Not Available | 777 | Open in IMG/M |
3300010359|Ga0126376_11741021 | Not Available | 659 | Open in IMG/M |
3300010360|Ga0126372_11973204 | Not Available | 630 | Open in IMG/M |
3300010361|Ga0126378_12909756 | Not Available | 546 | Open in IMG/M |
3300010362|Ga0126377_11017244 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 895 | Open in IMG/M |
3300010376|Ga0126381_103653569 | Not Available | 603 | Open in IMG/M |
3300010398|Ga0126383_12806332 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 569 | Open in IMG/M |
3300012096|Ga0137389_10054098 | All Organisms → cellular organisms → Bacteria | 3044 | Open in IMG/M |
3300012096|Ga0137389_10057931 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2952 | Open in IMG/M |
3300012096|Ga0137389_10125990 | All Organisms → cellular organisms → Bacteria | 2070 | Open in IMG/M |
3300012189|Ga0137388_10644763 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 984 | Open in IMG/M |
3300012189|Ga0137388_11978112 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300012199|Ga0137383_10689049 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300012199|Ga0137383_10882488 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 653 | Open in IMG/M |
3300012201|Ga0137365_10489653 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 904 | Open in IMG/M |
3300012202|Ga0137363_11374692 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 596 | Open in IMG/M |
3300012203|Ga0137399_10666957 | Not Available | 875 | Open in IMG/M |
3300012204|Ga0137374_10017690 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 8150 | Open in IMG/M |
3300012204|Ga0137374_10177175 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1866 | Open in IMG/M |
3300012204|Ga0137374_11000742 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 604 | Open in IMG/M |
3300012205|Ga0137362_10082427 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2684 | Open in IMG/M |
3300012205|Ga0137362_10412928 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1169 | Open in IMG/M |
3300012205|Ga0137362_10865987 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 772 | Open in IMG/M |
3300012205|Ga0137362_10916479 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 748 | Open in IMG/M |
3300012205|Ga0137362_11234283 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 632 | Open in IMG/M |
3300012206|Ga0137380_10858700 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 781 | Open in IMG/M |
3300012207|Ga0137381_10357783 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
3300012209|Ga0137379_10703193 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
3300012210|Ga0137378_10231155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1 | 1722 | Open in IMG/M |
3300012211|Ga0137377_10233177 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1768 | Open in IMG/M |
3300012211|Ga0137377_11860829 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 520 | Open in IMG/M |
3300012353|Ga0137367_10326428 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1095 | Open in IMG/M |
3300012355|Ga0137369_10107572 | All Organisms → cellular organisms → Bacteria | 2276 | Open in IMG/M |
3300012355|Ga0137369_10150763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1846 | Open in IMG/M |
3300012355|Ga0137369_10273680 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
3300012359|Ga0137385_11311257 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 587 | Open in IMG/M |
3300012360|Ga0137375_10067813 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3783 | Open in IMG/M |
3300012360|Ga0137375_10747788 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 793 | Open in IMG/M |
3300012360|Ga0137375_10863585 | Not Available | 722 | Open in IMG/M |
3300012360|Ga0137375_10933007 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 687 | Open in IMG/M |
3300012362|Ga0137361_10123402 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2284 | Open in IMG/M |
3300012362|Ga0137361_10575763 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1032 | Open in IMG/M |
3300012362|Ga0137361_11645239 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 562 | Open in IMG/M |
3300012362|Ga0137361_11769544 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → unclassified Methanosarcinales → Methanosarcinales archaeon ANME-2c ERB4 | 536 | Open in IMG/M |
3300012363|Ga0137390_10475955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1224 | Open in IMG/M |
3300012685|Ga0137397_11258263 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 529 | Open in IMG/M |
3300012685|Ga0137397_11305573 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 516 | Open in IMG/M |
3300012917|Ga0137395_10989604 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 603 | Open in IMG/M |
3300012917|Ga0137395_11184738 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 536 | Open in IMG/M |
3300012929|Ga0137404_11670963 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 591 | Open in IMG/M |
3300012930|Ga0137407_10199643 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1793 | Open in IMG/M |
3300012948|Ga0126375_11105293 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 653 | Open in IMG/M |
3300012948|Ga0126375_11136006 | Not Available | 646 | Open in IMG/M |
3300012972|Ga0134077_10298033 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 676 | Open in IMG/M |
3300012976|Ga0134076_10177192 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
3300013297|Ga0157378_11610048 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300013306|Ga0163162_11682321 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 725 | Open in IMG/M |
3300015357|Ga0134072_10392256 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300015371|Ga0132258_10182645 | All Organisms → cellular organisms → Bacteria | 5071 | Open in IMG/M |
3300015371|Ga0132258_10702289 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2546 | Open in IMG/M |
3300016357|Ga0182032_10116347 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1919 | Open in IMG/M |
3300016387|Ga0182040_10467344 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1003 | Open in IMG/M |
3300017656|Ga0134112_10101201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Marinimicrobium → Marinimicrobium alkaliphilum | 1082 | Open in IMG/M |
3300017656|Ga0134112_10278085 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300017792|Ga0163161_11944582 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 523 | Open in IMG/M |
3300017997|Ga0184610_1000732 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 7513 | Open in IMG/M |
3300017997|Ga0184610_1000952 | All Organisms → cellular organisms → Bacteria | 6487 | Open in IMG/M |
3300017997|Ga0184610_1002804 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3962 | Open in IMG/M |
3300017997|Ga0184610_1004649 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3224 | Open in IMG/M |
3300017997|Ga0184610_1030658 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
3300018052|Ga0184638_1002932 | All Organisms → cellular organisms → Bacteria | 5344 | Open in IMG/M |
3300018052|Ga0184638_1003940 | All Organisms → cellular organisms → Bacteria | 4721 | Open in IMG/M |
3300018052|Ga0184638_1010921 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3072 | Open in IMG/M |
3300018052|Ga0184638_1012691 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2885 | Open in IMG/M |
3300018052|Ga0184638_1013126 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera → Rubinisphaera margarita | 2844 | Open in IMG/M |
3300018053|Ga0184626_10035836 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2054 | Open in IMG/M |
3300018056|Ga0184623_10007114 | All Organisms → cellular organisms → Bacteria | 4770 | Open in IMG/M |
3300018056|Ga0184623_10022475 | All Organisms → cellular organisms → Bacteria | 2809 | Open in IMG/M |
3300018056|Ga0184623_10042841 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2055 | Open in IMG/M |
3300018063|Ga0184637_10006077 | All Organisms → cellular organisms → Bacteria | 7349 | Open in IMG/M |
3300018063|Ga0184637_10594138 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300018075|Ga0184632_10001553 | All Organisms → cellular organisms → Bacteria | 9420 | Open in IMG/M |
3300018075|Ga0184632_10002416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 7767 | Open in IMG/M |
3300018076|Ga0184609_10292960 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300018076|Ga0184609_10313884 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 733 | Open in IMG/M |
3300018077|Ga0184633_10007807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 5023 | Open in IMG/M |
3300018078|Ga0184612_10027391 | All Organisms → cellular organisms → Bacteria | 2940 | Open in IMG/M |
3300018078|Ga0184612_10480509 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_40CM_2_68_8 | 611 | Open in IMG/M |
3300018433|Ga0066667_10344840 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
3300018468|Ga0066662_10012497 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 4487 | Open in IMG/M |
3300018468|Ga0066662_10032044 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3132 | Open in IMG/M |
3300018468|Ga0066662_10120996 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1910 | Open in IMG/M |
3300018468|Ga0066662_10726093 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 952 | Open in IMG/M |
3300018468|Ga0066662_12417090 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 553 | Open in IMG/M |
3300018468|Ga0066662_12839663 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 514 | Open in IMG/M |
3300021073|Ga0210378_10005247 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 5959 | Open in IMG/M |
3300021073|Ga0210378_10026766 | All Organisms → cellular organisms → Bacteria | 2312 | Open in IMG/M |
3300021073|Ga0210378_10144270 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
3300025160|Ga0209109_10039806 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2520 | Open in IMG/M |
3300025165|Ga0209108_10027518 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3207 | Open in IMG/M |
3300025899|Ga0207642_10256361 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
3300025899|Ga0207642_10768187 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 611 | Open in IMG/M |
3300025910|Ga0207684_10182947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1807 | Open in IMG/M |
3300025910|Ga0207684_10279597 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1439 | Open in IMG/M |
3300025910|Ga0207684_10290008 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1411 | Open in IMG/M |
3300025910|Ga0207684_10816106 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 788 | Open in IMG/M |
3300025910|Ga0207684_11124381 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 653 | Open in IMG/M |
3300025910|Ga0207684_11238731 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 616 | Open in IMG/M |
3300025922|Ga0207646_10433647 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
3300025922|Ga0207646_10963294 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 755 | Open in IMG/M |
3300025930|Ga0207701_10071543 | All Organisms → cellular organisms → Bacteria | 3148 | Open in IMG/M |
3300025961|Ga0207712_10213901 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1537 | Open in IMG/M |
3300025961|Ga0207712_11094342 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 709 | Open in IMG/M |
3300026297|Ga0209237_1128249 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1047 | Open in IMG/M |
3300026309|Ga0209055_1016516 | All Organisms → cellular organisms → Bacteria | 3660 | Open in IMG/M |
3300026313|Ga0209761_1306955 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 549 | Open in IMG/M |
3300026328|Ga0209802_1042872 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2291 | Open in IMG/M |
3300026328|Ga0209802_1113501 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1201 | Open in IMG/M |
3300026332|Ga0209803_1048972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1879 | Open in IMG/M |
3300026351|Ga0257170_1006576 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1378 | Open in IMG/M |
3300026529|Ga0209806_1180720 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 765 | Open in IMG/M |
3300026532|Ga0209160_1339072 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 515 | Open in IMG/M |
3300026538|Ga0209056_10217375 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
3300026540|Ga0209376_1214040 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 862 | Open in IMG/M |
3300026550|Ga0209474_10437800 | Not Available | 667 | Open in IMG/M |
3300027277|Ga0209846_1002963 | All Organisms → cellular organisms → Bacteria | 2980 | Open in IMG/M |
3300027846|Ga0209180_10016781 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3839 | Open in IMG/M |
3300027862|Ga0209701_10145712 | Not Available | 1449 | Open in IMG/M |
3300027862|Ga0209701_10263653 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1003 | Open in IMG/M |
3300027880|Ga0209481_10231385 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 928 | Open in IMG/M |
3300027882|Ga0209590_10002266 | All Organisms → cellular organisms → Bacteria | 7672 | Open in IMG/M |
3300027903|Ga0209488_10093691 | All Organisms → cellular organisms → Bacteria | 2246 | Open in IMG/M |
3300027907|Ga0207428_10000727 | All Organisms → cellular organisms → Bacteria | 38034 | Open in IMG/M |
3300027909|Ga0209382_10000905 | All Organisms → cellular organisms → Bacteria | 47919 | Open in IMG/M |
3300027909|Ga0209382_10353453 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1645 | Open in IMG/M |
3300028792|Ga0307504_10283682 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 618 | Open in IMG/M |
3300031544|Ga0318534_10606766 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 622 | Open in IMG/M |
3300031545|Ga0318541_10166807 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1212 | Open in IMG/M |
3300031545|Ga0318541_10447791 | Not Available | 722 | Open in IMG/M |
3300031720|Ga0307469_10314169 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1297 | Open in IMG/M |
3300031720|Ga0307469_10837054 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 847 | Open in IMG/M |
3300031736|Ga0318501_10170886 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1127 | Open in IMG/M |
3300031740|Ga0307468_100148204 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
3300031747|Ga0318502_10811136 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 567 | Open in IMG/M |
3300031770|Ga0318521_10785966 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 580 | Open in IMG/M |
3300031793|Ga0318548_10345337 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 731 | Open in IMG/M |
3300031797|Ga0318550_10395449 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 669 | Open in IMG/M |
3300031820|Ga0307473_10083588 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1645 | Open in IMG/M |
3300031820|Ga0307473_10518378 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 808 | Open in IMG/M |
3300031820|Ga0307473_10838814 | Not Available | 659 | Open in IMG/M |
3300031820|Ga0307473_10898984 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 639 | Open in IMG/M |
3300031890|Ga0306925_10875914 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 925 | Open in IMG/M |
3300031946|Ga0310910_11391371 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 540 | Open in IMG/M |
3300031981|Ga0318531_10009648 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3577 | Open in IMG/M |
3300032035|Ga0310911_10920034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 504 | Open in IMG/M |
3300032174|Ga0307470_10014115 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3414 | Open in IMG/M |
3300032180|Ga0307471_100052998 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3363 | Open in IMG/M |
3300032180|Ga0307471_101857225 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 753 | Open in IMG/M |
3300032180|Ga0307471_101882996 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 748 | Open in IMG/M |
3300032180|Ga0307471_102147522 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 703 | Open in IMG/M |
3300032180|Ga0307471_102848670 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 614 | Open in IMG/M |
3300032205|Ga0307472_100536483 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1018 | Open in IMG/M |
3300032205|Ga0307472_101108189 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 750 | Open in IMG/M |
3300032205|Ga0307472_102092072 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 569 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.66% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 17.24% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.10% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 7.93% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.93% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.48% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.79% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.45% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.76% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.07% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.38% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.38% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.38% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.38% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.03% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.03% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.03% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.03% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.69% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.34% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.34% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.34% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2040502001 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2+ | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FACENCE_6099170 | 2040502001 | Soil | DRVLRVMLHERWSAEAWPQVKAEFKKALACRSEIRRAG |
F14TC_1000585203 | 3300000559 | Soil | LRVMLHTRWNTEAWSVVRVEFRRALAVRSEIRRAGRFN* |
F14TC_1005924124 | 3300000559 | Soil | RVLRVMLQTRWSAEAWSQVRIEFKRALALRSEIRRAG* |
F14TC_1011600723 | 3300000559 | Soil | LRVMLQTRWSAEAWAQIRVEFTKTLELKSQIRRARWFN* |
JGI1027J12803_1002755021 | 3300000955 | Soil | VLRVMLHTRWSAEAWSQVRVEFKRAVALRSEIRRAGWFS* |
JGI1027J12803_1025074062 | 3300000955 | Soil | INRVLRVMLHTRWSAETWLIARVEFGRALAVRSEIRRAGWFN* |
JGI1027J12803_1038629941 | 3300000955 | Soil | RVMLHTRWSAEQWSVVRVEFRRALVVTSEIRRAGWFN* |
JGI1027J12803_1058644722 | 3300000955 | Soil | LRVMLHTRWSAEAWSVIRVEFRRALALRSEIRRAGWFN* |
JGI1027J12803_1093202381 | 3300000955 | Soil | MLVMLHTRGSAEAWSVVRLEFRKAVALRSESRRAG* |
JGI10216J12902_1072015433 | 3300000956 | Soil | MLHERWSAEAWPQVKAEFKKALTLRSQIRRAGWFN* |
JGI10216J12902_1104478192 | 3300000956 | Soil | MLHTRWSAEAWLVVRVEFRRALALRSEIRRAGWFN* |
JGI10216J12902_1105594282 | 3300000956 | Soil | MLHRRWSAETWPQVRVEFRKALALRTEIRRVGWFN* |
F14TB_1022128292 | 3300001431 | Soil | RVLRVMLHTRWSAEAWAQVRVEFRKALALRGEIRRAGWFN* |
Ga0066672_102663091 | 3300005167 | Soil | VLRVMLHTRWSAEAWPQVKAEFKKALARRSQIRRAGWFN* |
Ga0066676_105597923 | 3300005186 | Soil | INRALRVMLQTRWSTEAWAQVRLEFRRAFALRSEIRRAGWFN* |
Ga0065705_104243961 | 3300005294 | Switchgrass Rhizosphere | LRINRVMRVMLHTRWSAEAWAQVMVEFRKAVPLRSEIRRAGWFN* |
Ga0065705_109477402 | 3300005294 | Switchgrass Rhizosphere | RVLRVMLHTRWSAEAWAQVRVEFRRALALRSEIRRAGCFN* |
Ga0065707_102739573 | 3300005295 | Switchgrass Rhizosphere | VLRVMLQTRWSAEAWSQIRVEFKRALALRSEMRRAGWFS* |
Ga0065707_103797282 | 3300005295 | Switchgrass Rhizosphere | VLRLMLHTRWSAEAWLVVRVEFRRTLALRSEIWRAGWFN* |
Ga0066388_1010426025 | 3300005332 | Tropical Forest Soil | RINRVLRVMLHTRWSTEQWSVIRVEFRKALAVRSEIRRAGWFN* |
Ga0066388_1047360581 | 3300005332 | Tropical Forest Soil | NRVLRVMLQTRSSPEAWSVVRVQFRRAVALRSEIRRAGWFH* |
Ga0066686_110839513 | 3300005446 | Soil | LRINCLSRAMLHERWSAEAWPQVKAEFKKALALRSEIRRAG |
Ga0070707_1009710751 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRPPHLRAMLHTRWSVEAWLVVRVEFRRALALRSEIRRAGW |
Ga0070698_1001020431 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | RINRVLRVMLHTRWSADAWTQVRVEFRRAVARRSEISHAGWFK* |
Ga0070697_1018547372 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LRFGAVAPHRVLRVMLQTRWSAEAWSQVRVEFRKALALRGEIRRAGWFN* |
Ga0066697_100099603 | 3300005540 | Soil | MLQTRWSAVAWAQVRIEFRKALALRSEIRGAGWFN* |
Ga0066701_101634513 | 3300005552 | Soil | MLHERWSAEAWPQVKAEFKKALALRSQIRRAGWFN* |
Ga0066701_101733742 | 3300005552 | Soil | MLQTRWSTEAWSQVRIEFRRALALRSEIRRAGWFN* |
Ga0066701_105147521 | 3300005552 | Soil | LRVMLHTRWSAEAWLVVRVEFRWALALRREIRRAAWLNRPGG* |
Ga0066701_106262983 | 3300005552 | Soil | LRAMLHTRWSAEAWSQVRVEFKRALALRSEIRRAGWFNEENN* |
Ga0066692_101728183 | 3300005555 | Soil | MLHTRWSAEARAEVRVEFRKALALRSQIRRAGWFN* |
Ga0066704_102886732 | 3300005557 | Soil | VMRQTRWSAEAWAPVRVEFKKALALRSEIRRAGWFN* |
Ga0066704_105368041 | 3300005557 | Soil | LRAMLHEHWSAEAWPQVKAEFTKALALRSQIRRAGWFN* |
Ga0066698_101042281 | 3300005558 | Soil | MLHTRWSAEAWAQVRVEFKKALALRSQIRRAGWFN* |
Ga0066670_100988861 | 3300005560 | Soil | INRVLRVMLQTRWSAEARPRVKAEFTKALALRSQIRRAGRFN* |
Ga0066699_110130811 | 3300005561 | Soil | INRVLRVMLHTHFSAEAWSQVRVEFRKALALRGEIRRAGWFN* |
Ga0066905_1009667771 | 3300005713 | Tropical Forest Soil | MNCVVRVMLHMRWSVEAWSVGRVEFRRALVLRSEIRR |
Ga0066903_1002080933 | 3300005764 | Tropical Forest Soil | MLQTRWSAEAWSVVRVEFRLAPAPRREIRLRRWFN* |
Ga0066903_1007440925 | 3300005764 | Tropical Forest Soil | MRVMLHTRWSAEAWSVVRIEFRRAVALRSEIRRAGWFN* |
Ga0066903_1068804832 | 3300005764 | Tropical Forest Soil | MLQTRWSAEARAVVWVEQAGLAPRSHIRPAGWFN* |
Ga0066696_108622122 | 3300006032 | Soil | NRFLRAMVQERWNAEAWPQVKAAFKTTLAMRSQIRRAGWFN* |
Ga0066656_109712122 | 3300006034 | Soil | LHERWSAEAWPQVKAEFKKALALRSQIRRAGWFN* |
Ga0066656_110296512 | 3300006034 | Soil | RINRVLRVMLHTRWSAEAWSQVRVEFRKALALRSEISR* |
Ga0075427_100498452 | 3300006194 | Populus Rhizosphere | INRVLRVMLHTHWSPEAQVRVEFKRAIALRSEIRRVGRFN* |
Ga0066665_108849052 | 3300006796 | Soil | RVMLQTRWSAEAWPQVKAEFEKALALRSQIRRAGWFN* |
Ga0066659_106155511 | 3300006797 | Soil | RVMLHTRGSAEAWSQVRAEFTKALALRSEIRRAGWFN* |
Ga0066660_103777212 | 3300006800 | Soil | MMQTRWSAEAWSQVRVEFRKALALRSEIRRTGWFN* |
Ga0066660_109790063 | 3300006800 | Soil | LRVMLHTHFSAEPWSQVRVEFRKALALRGEIRRAGWFN* |
Ga0075428_1001844013 | 3300006844 | Populus Rhizosphere | MLHTRWSTEAWSQVRVEFRKALALRSEIRRAGWFN* |
Ga0075428_1002325433 | 3300006844 | Populus Rhizosphere | MLHQRWSAEAWSQVRVEFRRALALRSEIRRAGWFIN* |
Ga0075428_1004933411 | 3300006844 | Populus Rhizosphere | LPINRVLRVMLHTRWSADAWLVVRVEFRRALALRSAIRRAGWFN* |
Ga0075428_1008402621 | 3300006844 | Populus Rhizosphere | RINRVLRVMLHTHWSAEAWSQVRAEQEGAPLRSEIQRAGWFN* |
Ga0075428_1008841202 | 3300006844 | Populus Rhizosphere | MLHTRWSADASPEVKAEFKKALALRSQIRRARWFN* |
Ga0075428_1010758072 | 3300006844 | Populus Rhizosphere | MLGARWDAETWPRVRAEFKKALALKSQIRRAGWFNEVGN* |
Ga0075428_1021260221 | 3300006844 | Populus Rhizosphere | NRVLRVMLHTRWSAEASSEVRVEFRKALALRTEIRRAGWVN* |
Ga0075421_1014868581 | 3300006845 | Populus Rhizosphere | MLHERWRAEAWAKVRAEFKGALARRSEIGRAGWFS* |
Ga0075421_1016504072 | 3300006845 | Populus Rhizosphere | MLHTRWNAEAWSVVRVEFRKAFALRSQIWRAGWFN* |
Ga0075430_1002255851 | 3300006846 | Populus Rhizosphere | RVMLQTRWSAEAWSDVRVEFRRALALRSEIRRAGWFN* |
Ga0075431_1003570003 | 3300006847 | Populus Rhizosphere | MLHTHWSAEAWSQVRVEFRRALALRSEIRRAGWFN |
Ga0075431_1021655973 | 3300006847 | Populus Rhizosphere | VLRMMLHMHWSAEGWSRVRVEFKRGLALRSQIRRADWFD* |
Ga0075433_100081345 | 3300006852 | Populus Rhizosphere | MLHTRWSVEAWSVVRVEFRKAIALRTEIGAWGGSTSR* |
Ga0075433_100324306 | 3300006852 | Populus Rhizosphere | MLQRRWTADAWSVVRVEFNRALALRSGIRRAGWVN* |
Ga0075433_101164052 | 3300006852 | Populus Rhizosphere | MLKTNCSAEAWSPIRVEFKRALALLSEIRRAGWFN* |
Ga0075433_101434642 | 3300006852 | Populus Rhizosphere | MRVMLHTQWSAEAWAVVRVEFRRALALRSEIQRVG* |
Ga0075433_107636333 | 3300006852 | Populus Rhizosphere | INRVLRVMLQTRWCAEAWSVVRVEFRRAVALRSEIRRAGWFN* |
Ga0075425_1000107201 | 3300006854 | Populus Rhizosphere | VLQTRWSAEAWAIVRVEFRRAVALRSEIRRAGWFN* |
Ga0075425_1000243016 | 3300006854 | Populus Rhizosphere | RINRVLRAMLHTRWSAEARSVVRVEFRKALALRSEIRR* |
Ga0075425_1000460328 | 3300006854 | Populus Rhizosphere | MLHTRWSAEAWSVVRVEFRRALAVRSEIRRAGWFN* |
Ga0075425_1006604542 | 3300006854 | Populus Rhizosphere | MLKTNCSAEAWSPIRVEFKRALALWSEIRRAGWFN* |
Ga0075425_1025228572 | 3300006854 | Populus Rhizosphere | MLHTRWSAEAWSQVRVEFKRALAPLSEIRRAGWFN* |
Ga0075425_1025319672 | 3300006854 | Populus Rhizosphere | VKLQTRWSAEAWAQIRVEFRRALALRSEIRRAGWFIN* |
Ga0075434_1000416611 | 3300006871 | Populus Rhizosphere | INRVLRAMLHTRWSAEARSVVRVEFRKALALRSEIRR* |
Ga0075434_1005898884 | 3300006871 | Populus Rhizosphere | MAPINRVLRAMLHTRWSAEARSVVRVEFRKALALRSEIRR* |
Ga0075434_1010061652 | 3300006871 | Populus Rhizosphere | MLHTRWSAEAWSVVRVEFRRALALRSESRRAGWFS* |
Ga0075434_1019384612 | 3300006871 | Populus Rhizosphere | PQTRGSTEARSHVRVEFRRVLALRSEIRRAGWFN* |
Ga0075434_1023644373 | 3300006871 | Populus Rhizosphere | MLQTRRGAEAWPQVKAEFEKALALRSQIRRAGWFD* |
Ga0075429_1010181801 | 3300006880 | Populus Rhizosphere | HTRWSAEAWSVVRVEFQRRALALRSEIRRAGWFQLV* |
Ga0068865_1020462971 | 3300006881 | Miscanthus Rhizosphere | MLHTRWSAEAWSVVRVEFRKALAVRSEIRRAGWFN* |
Ga0075424_1028252951 | 3300006904 | Populus Rhizosphere | MLHTRWSVEAWSVVRVEFRKAIALRTEIRCVGWFN* |
Ga0075419_103421491 | 3300006969 | Populus Rhizosphere | NRVPRVRLHTRWSAEAWLVVRVEFRRAVAVRSEIRRAG* |
Ga0075419_107659223 | 3300006969 | Populus Rhizosphere | VMLQTRWCAEAWSVVRVEFRRAVALRSEIRRAGWFN* |
Ga0075419_112364201 | 3300006969 | Populus Rhizosphere | MHTRWSAEAWSVVRVEFQRRALALRSEIRRAGWFQLV* |
Ga0099791_102152821 | 3300007255 | Vadose Zone Soil | MLHERWSAEAWPQVKAEFKKALALKSQIRRAGWFN* |
Ga0099794_100249311 | 3300007265 | Vadose Zone Soil | RAMLHERWSAEAWPQVKAEFKKALALKSQIRRAGWFN* |
Ga0099794_104807962 | 3300007265 | Vadose Zone Soil | MLHTRWSATEWPQVKAEFKKAPALKSQIRRAGWFN* |
Ga0066710_1001310804 | 3300009012 | Grasslands Soil | VRITLHTRWSADDWPQVKAEFTKALALKSQIRRAGWFN |
Ga0066710_1008317111 | 3300009012 | Grasslands Soil | WLRINRVLRVMLQTRGSAEAWSVVKVEFRRALALRGEIRRTGWLN |
Ga0066710_1009761813 | 3300009012 | Grasslands Soil | MLHMRWSAEAWAQVRVEFKKALALRSKIRRAGWFN |
Ga0066710_1011049653 | 3300009012 | Grasslands Soil | MLHTRWSAEARPEVKAEFKRALALRSQIRRAGRFN |
Ga0066710_1016795251 | 3300009012 | Grasslands Soil | AMVHERWSAETWPQVKAAFKKTLAMRSQIRRAGWFN |
Ga0066710_1017147281 | 3300009012 | Grasslands Soil | MLHTRWSAEAWPQVRVEFRKALALESQIRRAGWFN |
Ga0066710_1045145762 | 3300009012 | Grasslands Soil | MLHTRWSAEAWPQVKAEFTKALALRSQIRRAGCFK |
Ga0066710_1047721511 | 3300009012 | Grasslands Soil | MLQTSWNAEAWPQVKAEFKKALALKSQIRRAGWFN |
Ga0099829_100658562 | 3300009038 | Vadose Zone Soil | MLHERWNAEAWAQVRVEFRKALALRSQIRRAGWFN* |
Ga0099830_108365191 | 3300009088 | Vadose Zone Soil | RAMLHERWSAEAWPQVKAEFKKALALRSQIRRAGWFT* |
Ga0099828_105696242 | 3300009089 | Vadose Zone Soil | MLHTRRSAEAWPQVKAEFKKALALRSQIRRAGWFN* |
Ga0099827_100026142 | 3300009090 | Vadose Zone Soil | MLHERWSAEAWPQVRAEFTKALALKSQIRRAGWFN* |
Ga0099827_102125104 | 3300009090 | Vadose Zone Soil | LADVTLHTRWGEEAWPQVKAEFKKALALRSQIRRAGWFN* |
Ga0111539_133211901 | 3300009094 | Populus Rhizosphere | VLRVMLHTRWSTEQWSVMRVEFKRALALRSEIRRAGWFN* |
Ga0075418_101066973 | 3300009100 | Populus Rhizosphere | MLYTHWSAEAWSQVRAEFKKALTLRSDIRRVGWFN* |
Ga0075418_108813161 | 3300009100 | Populus Rhizosphere | MRVMLHTRWSVEAWLIVRVEFRRALALRSEIRRAG |
Ga0075418_120064372 | 3300009100 | Populus Rhizosphere | MLHTRWNAEAWAVVRVEFKKALALRSEMRRAGWFN* |
Ga0075418_127583681 | 3300009100 | Populus Rhizosphere | INRVLRVMLHTRWSAEAWPQVRVEFKRALALRSEIRRWVVQLN* |
Ga0066709_1014932272 | 3300009137 | Grasslands Soil | VRITLHTRWSADDWPQVKAEFTKALALKSQIRRAGWFN* |
Ga0066709_1015619442 | 3300009137 | Grasslands Soil | MLHTRWSAEAWAEVCVEFKKALALRSQIRRAGWFN* |
Ga0066709_1023849131 | 3300009137 | Grasslands Soil | MLHTRWSAEDWQKIKAEFKKALALKSQIRRAGWFN* |
Ga0066709_1032930871 | 3300009137 | Grasslands Soil | LRAMLHEHWSAEAWPQVKAEFTKALALRSEIRRAGWFN* |
Ga0066709_1035268442 | 3300009137 | Grasslands Soil | MLGTRWDAETWPQVKAEFKQALALRSQISRAGWFN* |
Ga0066709_1035898001 | 3300009137 | Grasslands Soil | MLTERWSAEAWPNVRAEFKKALTVRSAIRRAGWFN* |
Ga0114129_123940932 | 3300009147 | Populus Rhizosphere | MLHTRWSAEAWAEVRAEFRKALALRSEIRRAGWFN* |
Ga0111538_108829621 | 3300009156 | Populus Rhizosphere | MLHTRWSAEQWSIVRVEFRRALALRSQIRRAGWFN |
Ga0075423_101922723 | 3300009162 | Populus Rhizosphere | VMLQRRWTADAWSVVRVEFNRALALRSGIRRAGWVN* |
Ga0075423_109536083 | 3300009162 | Populus Rhizosphere | MLQRRWTADAWSVVRVEFNRALALRSGIRRAGWVIN* |
Ga0075423_124538682 | 3300009162 | Populus Rhizosphere | MLQTRWSAEAWSVVRVEFRKALAQRSEIRRAGWFN* |
Ga0075423_125193281 | 3300009162 | Populus Rhizosphere | RAMLHERWSTEAWPQVKAAFKKALALRSEIRRAGWFN* |
Ga0075423_128924003 | 3300009162 | Populus Rhizosphere | MLHTRWSAEAWSVVRVDFRRALALRSEIRRGLIN* |
Ga0105249_106111913 | 3300009553 | Switchgrass Rhizosphere | MLQTRWSAEAWSQVRVEFRRAPALRSEIRRAGWFNG |
Ga0105249_112856232 | 3300009553 | Switchgrass Rhizosphere | MRVMLHTRWSAEAWAQVMVEFRKALAVRSEIRRAGWFN* |
Ga0126374_118403152 | 3300009792 | Tropical Forest Soil | MLLTRWSTEQWSVIRVEFRKALAVRSEIRRAGWFN* |
Ga0105088_11148902 | 3300009810 | Groundwater Sand | MLHERWSAEAWLQVKAEFKKALVLRSQLRRAGCFN* |
Ga0105082_10239922 | 3300009814 | Groundwater Sand | MLHERWSAEAWPQVKAEFTKALALRSQIRRAGWFN* |
Ga0105066_10910492 | 3300009822 | Groundwater Sand | LHTRWSAEAWPQVKAEFVKALALRSQIRCAGWFN* |
Ga0126384_100284586 | 3300010046 | Tropical Forest Soil | LQTRWSAEAWLVVRVEFRRPLAVRSEIRRAGWFS* |
Ga0134063_102285002 | 3300010335 | Grasslands Soil | MMQTRWSAEAWSQVRVEFRKALALRGEIRRAGWFN* |
Ga0134071_101131161 | 3300010336 | Grasslands Soil | MLTTRWSAEAWPQVKAEFKKALALRSEIRRAGWFN* |
Ga0134071_103229491 | 3300010336 | Grasslands Soil | TAAAERRASAEAWPQVKAEFKKALAPKSQIRRAGWFN* |
Ga0126376_117410211 | 3300010359 | Tropical Forest Soil | INRVVRVMLHTRWSADAWSVVRVEFKRALAVLSEIQSAGWFN* |
Ga0126372_119732042 | 3300010360 | Tropical Forest Soil | LHTRWSAEARLVVRVKFRRALALRSEIRRSGWFN* |
Ga0126378_129097562 | 3300010361 | Tropical Forest Soil | RVLRVMLQTRWSAETGLVVGVDFRRALALRSEIRRAGWFN* |
Ga0126377_110172442 | 3300010362 | Tropical Forest Soil | MLHTRWSAEAWLVVRVEFRRALALRVEIRRAVWFN* |
Ga0126381_1036535693 | 3300010376 | Tropical Forest Soil | MRVMLQTGWSAEAWLIVRVEFKRGVALRSEIRRAGWFN* |
Ga0126383_128063321 | 3300010398 | Tropical Forest Soil | MLHTRWSAEAWLIVRVEFRRALTLRSEIRRAGWFN* |
Ga0137389_100540986 | 3300012096 | Vadose Zone Soil | MALPRPRRRSAAAWAEVRVEFKKALALRSEMRGAGWFN* |
Ga0137389_100579315 | 3300012096 | Vadose Zone Soil | MLQTRWSAEAWPQVKAEFKKALALRSQIRRAGWFN* |
Ga0137389_101259904 | 3300012096 | Vadose Zone Soil | MLHTRWSAEAWPQVKAEFKKALALRSQIRRAGWFN* |
Ga0137388_106447632 | 3300012189 | Vadose Zone Soil | MLTERWSAEAWPQVKAEFIKALALRSEIRRAGWFN* |
Ga0137388_119781122 | 3300012189 | Vadose Zone Soil | MLTERWSAEAWPKVRAEFKKALTLRSVIRQAGWFN* |
Ga0137383_106890492 | 3300012199 | Vadose Zone Soil | MLHTHWSAEAWAIVRVEFERALALRSEIRRAGWVNETCVEA |
Ga0137383_108824882 | 3300012199 | Vadose Zone Soil | VLRAMLQERWNAEAWPQVKDEFTKARALRSQIRRAGWLN* |
Ga0137365_104896531 | 3300012201 | Vadose Zone Soil | PQLRINRVPRVMLHTTWSAEAWAEVRVEFRRALALRSEIRRAGWFIN* |
Ga0137363_113746921 | 3300012202 | Vadose Zone Soil | MLTTRCSAEAWPQVQAEFKKALALRSEIRRAGWFN* |
Ga0137399_106669571 | 3300012203 | Vadose Zone Soil | RRSTEAWSQVRVEFRRALALRSEIRWAGGSSTRTKFI* |
Ga0137374_1001769013 | 3300012204 | Vadose Zone Soil | MLHTRWSAEAWQQVRVEFKKALALRSEIRLAGWFN* |
Ga0137374_101771753 | 3300012204 | Vadose Zone Soil | MLHERWSAEAWAQVRVEFKKALALRSQIQRAGWFN* |
Ga0137374_110007423 | 3300012204 | Vadose Zone Soil | MLTTRWSAEAWPQVKAEFKKALALRSQIRRAGWFN* |
Ga0137362_100824277 | 3300012205 | Vadose Zone Soil | MRVMLHKRWSTDAWSQVRVEFKKALALRSAIRRAGWFN* |
Ga0137362_104129281 | 3300012205 | Vadose Zone Soil | MRLMLHTHWSAEAWSQIRVEFKRALALRSEIRRA* |
Ga0137362_108659872 | 3300012205 | Vadose Zone Soil | MLHERWSAEAWPQVKAEFKKALALRSQIRRAGWFT* |
Ga0137362_109164792 | 3300012205 | Vadose Zone Soil | INRVMRMMLHTRWSAEAWAQVRVEFRKAVALRSEIRGAGWFN* |
Ga0137362_112342832 | 3300012205 | Vadose Zone Soil | RISRVLRVMLHTRWSAEAWSQVRVEFSRALALRSEIPRAGWFN* |
Ga0137380_108587001 | 3300012206 | Vadose Zone Soil | LRLMLHTRWSVQAWSQVRVEFKKALALRSQIRRAGWFN* |
Ga0137381_103577834 | 3300012207 | Vadose Zone Soil | VMLHTRWSAEAWAEVRVEFRRALALRSEIRRAGWFIN* |
Ga0137379_107031933 | 3300012209 | Vadose Zone Soil | PWLRINRVLRVMLHTRWSAEAWAEVRVEFRRAVALRSEIRRAG* |
Ga0137378_102311554 | 3300012210 | Vadose Zone Soil | MLHTHWSAEAWSIVRVEFERALALRSEIRRAGWFN* |
Ga0137377_102331774 | 3300012211 | Vadose Zone Soil | MLHTHWSAEAWSIVRVEFERALALRSEIRRAGWLN* |
Ga0137377_118608292 | 3300012211 | Vadose Zone Soil | MLHTHRSAKDWVQVRVEFKRALALRSEIRRAGWFIN |
Ga0137367_103264281 | 3300012353 | Vadose Zone Soil | NRVLRVMLHTRWSTEAWAEVRVEFKKALAVKSEIRRAGGSISP* |
Ga0137369_101075726 | 3300012355 | Vadose Zone Soil | MLQTRWSAAAWAEVRVEFRKALALRSEIRRAGWFN* |
Ga0137369_101507632 | 3300012355 | Vadose Zone Soil | MLHERRSAEAWPQVKVEFTKALALRSQIRRAGWFN* |
Ga0137369_102736804 | 3300012355 | Vadose Zone Soil | MLHERWSAEAWAQVRVEFKKALALRSQIRRAGWFN* |
Ga0137385_113112571 | 3300012359 | Vadose Zone Soil | MLHSWSAEAWAQVGVEFRRALALRSEIRRAGWFN* |
Ga0137375_100678133 | 3300012360 | Vadose Zone Soil | MLHTRWSAEAWQHVRVEFRKALALRSKIQRAGWSN* |
Ga0137375_107477882 | 3300012360 | Vadose Zone Soil | MLHERWSAEAWPQVKAEFKKALGLRSKIRRAGWFN* |
Ga0137375_108635852 | 3300012360 | Vadose Zone Soil | MLQTRWSAEVWPQVKAEFTKALVLRSEIRRAGWFN* |
Ga0137375_109330072 | 3300012360 | Vadose Zone Soil | MLHTHWSAKAWPQVKAEFKKALALKSQIRRAGWFN* |
Ga0137361_101234023 | 3300012362 | Vadose Zone Soil | MRVMLHTRWSTDAWSQVRVEFKKALALRSAIRRAGWFN* |
Ga0137361_105757631 | 3300012362 | Vadose Zone Soil | VMLHTRWSAEAWSQVRVEFSRALALRSEIPRAGWFN* |
Ga0137361_116452392 | 3300012362 | Vadose Zone Soil | MLHTRWSAEAWPQVKAEFTKALALKSQIRRAGWFN* |
Ga0137361_117695441 | 3300012362 | Vadose Zone Soil | MLHTRWSAEAWSVVRIGFRKALALRSEIRRAGWFN* |
Ga0137390_104759551 | 3300012363 | Vadose Zone Soil | VLRAMLHERWSAEAWPQVKAEFKKALALRSQIRRAGWFT* |
Ga0137397_112582631 | 3300012685 | Vadose Zone Soil | RFFPVMLHTRWSAEAWSEIRVEFRRALALRSEIRRAGWFN* |
Ga0137397_113055731 | 3300012685 | Vadose Zone Soil | VLRVMLQTPWSAEAWSQVRVEFKRALALRSAIRRAGWFN* |
Ga0137395_109896041 | 3300012917 | Vadose Zone Soil | RAMLHERWSAEAWPQVRAEFTKALALKSQIRRAGWFN* |
Ga0137395_111847381 | 3300012917 | Vadose Zone Soil | PWLRINRVLRVMLHTRWSAEALVEFKRALALRSEIRRAGWFIN* |
Ga0137404_116709631 | 3300012929 | Vadose Zone Soil | MLHTHWSAEAWSQIRVEFKRALALRSEIRRAGWFN* |
Ga0137407_101996431 | 3300012930 | Vadose Zone Soil | MLYTRWSGEAWSQVRVEFKRALALRSEIRRAGWFN |
Ga0126375_111052931 | 3300012948 | Tropical Forest Soil | ALHPRVLRVMLLTRWSAEAWAQVSVESRKAFALRSEIRRAEWFN* |
Ga0126375_111360061 | 3300012948 | Tropical Forest Soil | NPVLRVMLHMRWSAEAWQVVRIAFRRALALRSEIRRAGWFN* |
Ga0134077_102980331 | 3300012972 | Grasslands Soil | MLLHERWSAEAWPEVKAEFTKALALRSQIRRAGWFN* |
Ga0134076_101771921 | 3300012976 | Grasslands Soil | NRLLRSMLHERWSAEAWPQVKAEFRKALALRSQIRCAGWLN* |
Ga0157378_116100481 | 3300013297 | Miscanthus Rhizosphere | LRTRWSAEAWAQVRVEFRKALALRSEIRRAGSTSRD* |
Ga0163162_116823211 | 3300013306 | Switchgrass Rhizosphere | MLHTRWSAEAWAVVRVEFRKALALRSEIRRAGWFN* |
Ga0134072_103922561 | 3300015357 | Grasslands Soil | RINRVLRVMRQTRWSTEVWSRVRVEFKRAVALRSEIRRAGWFN* |
Ga0132258_101826457 | 3300015371 | Arabidopsis Rhizosphere | MLQTRWSAEAWLVVRVEFRWALALRSVMRRAGWFN* |
Ga0132258_107022895 | 3300015371 | Arabidopsis Rhizosphere | MSVMLHTHWSGEQWSVVMVEFRKAVALRSEIWRAGWFN* |
Ga0182032_101163471 | 3300016357 | Soil | VMLQTRWSEEAWSVGRVEFRRALALRSEIRRAGWFN |
Ga0182040_104673442 | 3300016387 | Soil | LRINRVLLQTRWSEEAWSVIRVEFRRALALRSEIRRAGWFN |
Ga0134112_101012012 | 3300017656 | Grasslands Soil | MLHTRWSAEAWAQVRVEFKKALALRSQIRRAGWFN |
Ga0134112_102780852 | 3300017656 | Grasslands Soil | MLHTRWSAEAWQHVRVEFTKALALKSKIRRARWFN |
Ga0163161_119445821 | 3300017792 | Switchgrass Rhizosphere | RINRVPRVMLRTRWSAEAWAQVRVEFRKALALRSEIRRAGSTSRD |
Ga0184610_100073210 | 3300017997 | Groundwater Sediment | MLHERWSAEAWPQVKAEFKKALALKSQIRRAGWFN |
Ga0184610_10009523 | 3300017997 | Groundwater Sediment | MLHERWSAEAWPQVKAEFKKSLALKSEIRRAGWFN |
Ga0184610_10028043 | 3300017997 | Groundwater Sediment | MLHERWSAEAWPQVKAEFTKALALRSKIQRAGWFN |
Ga0184610_10046494 | 3300017997 | Groundwater Sediment | MLTTRWSAEAWPQVKAEFKEALALKSQIRRAGWFN |
Ga0184610_10306581 | 3300017997 | Groundwater Sediment | MLHERWSAEAWPQVKAEFTKALALRSQIRRAGRFN |
Ga0184638_10029323 | 3300018052 | Groundwater Sediment | MLQTRWSTEAWPQVKAEFAKTLALRSQIRRAGWFN |
Ga0184638_10039405 | 3300018052 | Groundwater Sediment | MLHERWSAEACSQVKGEFKKALALRSQIRRAGWFN |
Ga0184638_10109213 | 3300018052 | Groundwater Sediment | MPHERWSADAWPQVKAEFTKALALRSEIRRAGWFN |
Ga0184638_10126914 | 3300018052 | Groundwater Sediment | MLHERWSAEAWPEVKAEFKKALALRSEIWRAAWFN |
Ga0184638_10131262 | 3300018052 | Groundwater Sediment | MLHERWSAEAWPQVKAEFKKWLALKSEIRRAGWFN |
Ga0184626_100358363 | 3300018053 | Groundwater Sediment | MLHERWSAEAWSEIRVEFKRALALRSEIRRAGWFN |
Ga0184623_100071147 | 3300018056 | Groundwater Sediment | MLTTRWSAEAWPQVKAEFKEALARKSQIRRAGWFN |
Ga0184623_100224754 | 3300018056 | Groundwater Sediment | MLHTRWSAEAWTQVRVEFREALALRSQIRRAGWFN |
Ga0184623_100428414 | 3300018056 | Groundwater Sediment | MLHERWSAEAWPQVKAEFKKALALRSEIRRAGWFN |
Ga0184637_100060778 | 3300018063 | Groundwater Sediment | VRINRVLRAMPHARWSAEEWPQVKAEFKKALALRSEIRRKGWFN |
Ga0184637_105941381 | 3300018063 | Groundwater Sediment | AMLTTRWSAEAWPQVKAEFKEALARKSQIRRAGWFN |
Ga0184632_1000155313 | 3300018075 | Groundwater Sediment | MLHTRWSAEAWQHVRVEFRKVLALRSQIRRAGWFN |
Ga0184632_100024162 | 3300018075 | Groundwater Sediment | MSLTLWSADAWPQVRVEFRRALALKSQIRRAGWFN |
Ga0184609_102929602 | 3300018076 | Groundwater Sediment | MLHERWSAEAWPQVKAEFKKALALRSQIRRAGWFN |
Ga0184609_103138842 | 3300018076 | Groundwater Sediment | MLHERWSAEAWPQIKAEFKKALALKSQIRRAGWFN |
Ga0184633_100078077 | 3300018077 | Groundwater Sediment | VRINRVLRAMPHARWSAEEWPQVKAEFKKALALKSQIRRAGWFN |
Ga0184612_100273916 | 3300018078 | Groundwater Sediment | MLHERWSAEAWPQVKIEFKKALALRSQIRRAGWFN |
Ga0184612_104805092 | 3300018078 | Groundwater Sediment | NLVLRERWSAEAWPQVKAEFTKALALRSQIRRAAWFN |
Ga0066667_103448401 | 3300018433 | Grasslands Soil | MLHTRWSAEAWPQVKAEFKRALALRSQIRRAGWFN |
Ga0066662_100124972 | 3300018468 | Grasslands Soil | MLQTRWSAVAWAQVRIEFRKALALRSEIRGAGWFN |
Ga0066662_100320441 | 3300018468 | Grasslands Soil | RVLRVMLHTRWSAEAWLVVRVEFRWALALRREIRRAAWLNRPGG |
Ga0066662_101209965 | 3300018468 | Grasslands Soil | MLHTHFSAEAWSQVRVEFRKALALRGEIRRAGWFN |
Ga0066662_107260933 | 3300018468 | Grasslands Soil | LRAMLHTRWSAEAWSQVRVEFKRALALRSEIRRAGWFNEENN |
Ga0066662_124170902 | 3300018468 | Grasslands Soil | MLQTRWSTEAWSQVRIEFRRALALRSEIRRAGWFN |
Ga0066662_128396632 | 3300018468 | Grasslands Soil | MLHTRWSAEAWSQVRVEFRRALALRSEIRRAGWFN |
Ga0210378_1000524710 | 3300021073 | Groundwater Sediment | MLHERWSAEAWPRVKAEFKKALALRSEIRRAGWVN |
Ga0210378_100267663 | 3300021073 | Groundwater Sediment | MLHERWSAEAWPLVKAEFTKALALGSQIRRAGWFN |
Ga0210378_101442701 | 3300021073 | Groundwater Sediment | MLHERWSAEAWPQVKAEFKKALALRSRIRRSGWFN |
Ga0209109_100398062 | 3300025160 | Soil | MLQTRWDAETWPHVKAEFKEALALRSRIERAGWFN |
Ga0209108_100275182 | 3300025165 | Soil | MLQTRWDAEPWPHVKAEFKEALALRSRIERAGWFN |
Ga0207642_102563611 | 3300025899 | Miscanthus Rhizosphere | MLHTRWSAEAWAVVRVEFRKALALRSEIRRAGWFN |
Ga0207642_107681871 | 3300025899 | Miscanthus Rhizosphere | NRVLRVMLHTRWSAEAWAVVRVEFRKALALRSEIRRAGWFN |
Ga0207684_101829471 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VMLHTHWSADAWAQVRVEFKRALALRSEIRRAGWFN |
Ga0207684_102795973 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | RVLRVMLQRRWSTEAWSQVRVEFRKALALRSEIRRAGWFN |
Ga0207684_102900083 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | RVMLQTHWSAEAWSQVRVEFRRPLALRSEIQRAGWLN |
Ga0207684_108161061 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLHTRWSAEAWPQVKAEFTKALALRSEIRRAGWFN |
Ga0207684_111243811 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LRINRVLRVMQQTRWSAEAWSQARVEFRKALVLRSEIRRAWWFN |
Ga0207684_112387312 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LVLHERWSAEAWSQVRVEFKRALALRSEIRRAGWFN |
Ga0207646_104336472 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MLHTRWSVEAWLVVRVEFRRALALRSEIRRAGWFN |
Ga0207646_109632941 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MLQTRWGEEAWPQVKAEFEKALALRSQIRRAGWCN |
Ga0207701_100715431 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MLHTRWSAEAWSVVRVEFRKALAVRSEIRRAGWFN |
Ga0207712_102139012 | 3300025961 | Switchgrass Rhizosphere | MLQTRWSAEAWSQVRVEFKSVLTLRSEIRRAGWFN |
Ga0207712_110943422 | 3300025961 | Switchgrass Rhizosphere | MRVMLHTRWSAEAWAQVMVEFRKALAVRSEIRRAGWFN |
Ga0209237_11282491 | 3300026297 | Grasslands Soil | MLHERWSAEAWPQVKAEFKNALELKSQIRRAGWFN |
Ga0209055_10165162 | 3300026309 | Soil | VLRVMLHTRWSAEAWPQVKAEFKKALARRSQIRRAGWFN |
Ga0209761_13069552 | 3300026313 | Grasslands Soil | RVLRAMLHTHWSAEACSVVMIEFRKAVALRTEIRRAGWFN |
Ga0209802_10428721 | 3300026328 | Soil | LRVMLRTRRSAEAWSVVRVEFRRALALRSEIRRAGWFHQLFPRFSA |
Ga0209802_11135012 | 3300026328 | Soil | MLHTRWSAEARAEVRVEFRKALALRSQIRRAGWFN |
Ga0209803_10489722 | 3300026332 | Soil | MLHTRWSAEAWPQVKAEFKKALARRSQIRRAGWFN |
Ga0257170_10065766 | 3300026351 | Soil | TLHTRWGEEAWPQVKAEFKKALALRSQIRRAGWFN |
Ga0209806_11807202 | 3300026529 | Soil | MRVMLQTRWSAEAWSQVRVEFKRAIALRSEIRRAGWFN |
Ga0209160_13390722 | 3300026532 | Soil | MLHTRWSAEAWAEVRVEFRKALALRSQIRRAGWFN |
Ga0209056_102173752 | 3300026538 | Soil | ARDAAQRWNQEAWPQVKAEFTKALALRSQIRRAGWFN |
Ga0209376_12140402 | 3300026540 | Soil | MLHTHFSAEPWSQVRVEFRKALALRGEIRRAGWFN |
Ga0209474_104378001 | 3300026550 | Soil | RTNRFLRAMVQERWNAEAWPQVKAAFKTTLAMRSQIRRAGWFN |
Ga0209846_10029633 | 3300027277 | Groundwater Sand | MLHERWSAEAWPQVKAEFTKALALRSQIRRAGGFN |
Ga0209180_100167817 | 3300027846 | Vadose Zone Soil | MSCLSPHELMLQTRWSAEAWPQVKAEFKKALALRSQIRRAGWFN |
Ga0209701_101457123 | 3300027862 | Vadose Zone Soil | RINRLLRAMLHERWSAEACPKVKAEFKKALALRSKIRRAEWFN |
Ga0209701_102636532 | 3300027862 | Vadose Zone Soil | MLQTRWSAEAWPQVKAEFKKALALRSQIRRAGWFN |
Ga0209481_102313851 | 3300027880 | Populus Rhizosphere | INRALRVMLHTCWSAEAWAQVRVEFRKALALRSEIRRAGWFN |
Ga0209590_100022662 | 3300027882 | Vadose Zone Soil | MLHERWSAEAWPQVRAEFTKALALKSQIRRAGWFN |
Ga0209488_100936912 | 3300027903 | Vadose Zone Soil | MLHTRRSAEAWPQVKAEFTKMLALRSQIRRAGWFN |
Ga0207428_1000072728 | 3300027907 | Populus Rhizosphere | MLHTRWNAEAWSVVRVEFRKAFALRSQIWRAGWFN |
Ga0209382_100009057 | 3300027909 | Populus Rhizosphere | MLHTHWSPEAWAQVRVEFKRAIALRSEIRRVGRFN |
Ga0209382_103534534 | 3300027909 | Populus Rhizosphere | MLYTHWSAEAWSQVRAEFKKALTLRSDIRRVGWFN |
Ga0307504_102836821 | 3300028792 | Soil | MLPTHWSAEAWPQIKAEFAKALALRSQIRRAGVVSTEC |
Ga0318534_106067663 | 3300031544 | Soil | MLQTESSAEAWSEVRVEFRRALALRREIRRAGWFN |
Ga0318541_101668072 | 3300031545 | Soil | MPQTEWSAEAWSEVRVEFRRALALRREIRRAGWFN |
Ga0318541_104477913 | 3300031545 | Soil | MLQTRWSAEAWSVVRVEFRRALALRSEIRRARSFNQLF |
Ga0307469_103141693 | 3300031720 | Hardwood Forest Soil | VMLQTRWSAEAWSQVKAEFKKTLALRSQILSRATAS |
Ga0307469_108370541 | 3300031720 | Hardwood Forest Soil | MLHTRWSVEAWSVVRVEFRKAIALRTEIRCVGWFN |
Ga0318501_101708864 | 3300031736 | Soil | VMLQTRWSAEAWAQVRVEFRKALALRSEIRRAALVRLAAS |
Ga0307468_1001482042 | 3300031740 | Hardwood Forest Soil | MLHTCWSAEEWSVVRVEFTLALVLRSEIRRVERFN |
Ga0318502_108111362 | 3300031747 | Soil | LLVMLQTRWSAEAWLVVRVEFRRALALRSEIRRAGWFN |
Ga0318521_107859661 | 3300031770 | Soil | INCILHMMLQTRWSAEAWAVVRVEFRRAVAVRSEIRRAGWFN |
Ga0318548_103453372 | 3300031793 | Soil | MPQTEWSAEAWSEVRVEFRRALALRSEIRRAGWFN |
Ga0318550_103954493 | 3300031797 | Soil | RVMLHTRWSAEAWAQVRVEFRRAIVLRSQILRGFN |
Ga0307473_100835884 | 3300031820 | Hardwood Forest Soil | MLHTRWSAEAWSQVRVEFTKALALRSEIRRAGLVQLAS |
Ga0307473_105183783 | 3300031820 | Hardwood Forest Soil | HTRWSAEAWAQVRVEFRKALALTSQIRRASCFNRLGGSEFSGLR |
Ga0307473_108388142 | 3300031820 | Hardwood Forest Soil | MLQTRWSAEAWFQVHVEFKRAIALQSEIRRAGWFN |
Ga0307473_108989843 | 3300031820 | Hardwood Forest Soil | LRLMLHTRWSVEAWSVVRVEFRKAIALRTEIRCVGWFN |
Ga0306925_108759141 | 3300031890 | Soil | RVLRVMLQTRWSAEAWAQVRVEFRKALALRSEIRRAALVRLAAS |
Ga0310910_113913712 | 3300031946 | Soil | MLQTESSAEAWSEVRVEFKRALALRSEIRRAGWFN |
Ga0318531_100096481 | 3300031981 | Soil | VMLQTRWSAEAWLVVRVEFRRALALRSEIRRAGWFN |
Ga0310911_109200341 | 3300032035 | Soil | VLHTRWSAEAWSEVRVEFRQALALLSEIRRAGRFGK |
Ga0318513_104332081 | 3300032065 | Soil | RINRVLRVMLHTRWSAEAWAQVRVEFRRAIVLRSQILRGFN |
Ga0307470_100141158 | 3300032174 | Hardwood Forest Soil | MLHTCWSAEEWSVVRVEFTLALVLRSEIRRVERFD |
Ga0307471_1000529985 | 3300032180 | Hardwood Forest Soil | MLQTRWSAEAWSQVRVEFRRALALRSEIRRAGWFN |
Ga0307471_1018572252 | 3300032180 | Hardwood Forest Soil | MLQRRWTADAWSVVRVEFNRALALRSGIRRAGWVN |
Ga0307471_1018829961 | 3300032180 | Hardwood Forest Soil | MLHTHWSVEAWPQVKAEFKKALALRSQIRRAGWFN |
Ga0307471_1021475221 | 3300032180 | Hardwood Forest Soil | RVMLHERWSAEAWARVRVEFKKALALRSEIRRAGWFH |
Ga0307471_1028486702 | 3300032180 | Hardwood Forest Soil | MLHTRWSADASPEVKAEFRKALALRSQIRRARWFN |
Ga0307472_1005364831 | 3300032205 | Hardwood Forest Soil | MLHTRWSVEAWSVVRVEFRKAIALRTEIRRVGWFN |
Ga0307472_1011081891 | 3300032205 | Hardwood Forest Soil | RINRVLRVMLHTRRIAEAWSVVRVEFRRALALRSEIRRAGWFN |
Ga0307472_1020920722 | 3300032205 | Hardwood Forest Soil | MLHTRWSTEAWAQVRVEFRKALALRSEIRRAGWFNYS |
⦗Top⦘ |