| Basic Information | |
|---|---|
| Family ID | F011432 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 291 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MSENRELTMDDYLAMLRRRLKVILIPALLAPLAGFLVSYAFP |
| Number of Associated Samples | 247 |
| Number of Associated Scaffolds | 291 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 90.72 % |
| % of genes near scaffold ends (potentially truncated) | 98.63 % |
| % of genes from short scaffolds (< 2000 bps) | 90.03 % |
| Associated GOLD sequencing projects | 233 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.969 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.997 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.962 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.141 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.71% β-sheet: 0.00% Coil/Unstructured: 54.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 291 Family Scaffolds |
|---|---|---|
| PF02563 | Poly_export | 3.78 |
| PF10531 | SLBB | 3.09 |
| PF02706 | Wzz | 2.06 |
| PF09721 | Exosortase_EpsH | 1.37 |
| PF14532 | Sigma54_activ_2 | 0.69 |
| PF02954 | HTH_8 | 0.69 |
| PF11984 | DUF3485 | 0.69 |
| PF14559 | TPR_19 | 0.34 |
| PF02518 | HATPase_c | 0.34 |
| COG ID | Name | Functional Category | % Frequency in 291 Family Scaffolds |
|---|---|---|---|
| COG1596 | Periplasmic protein Wza involved in polysaccharide export, contains SLBB domain of the beta-grasp fold | Cell wall/membrane/envelope biogenesis [M] | 3.78 |
| COG3206 | Exopolysaccharide export protein/domain GumC/Wzc1 | Cell wall/membrane/envelope biogenesis [M] | 2.06 |
| COG3524 | Capsule polysaccharide export protein KpsE/RkpR | Cell wall/membrane/envelope biogenesis [M] | 2.06 |
| COG3765 | LPS O-antigen chain length determinant protein, WzzB/FepE family | Cell wall/membrane/envelope biogenesis [M] | 2.06 |
| COG3944 | Capsular polysaccharide biosynthesis protein YveK | Cell wall/membrane/envelope biogenesis [M] | 2.06 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.97 % |
| Unclassified | root | N/A | 1.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000579|AP72_2010_repI_A01DRAFT_1030868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300001100|JGI12703J13194_103431 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300001661|JGI12053J15887_10128131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1351 | Open in IMG/M |
| 3300001661|JGI12053J15887_10570323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100916018 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300002562|JGI25382J37095_10130100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 847 | Open in IMG/M |
| 3300002568|C688J35102_118944481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300002568|C688J35102_119747364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
| 3300002568|C688J35102_119817992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10163666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 900 | Open in IMG/M |
| 3300004082|Ga0062384_100017904 | All Organisms → cellular organisms → Bacteria | 2934 | Open in IMG/M |
| 3300004152|Ga0062386_100566329 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300005176|Ga0066679_10314586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1020 | Open in IMG/M |
| 3300005435|Ga0070714_100505454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1153 | Open in IMG/M |
| 3300005435|Ga0070714_101514032 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300005439|Ga0070711_101104746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300005447|Ga0066689_10676414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300005518|Ga0070699_101477429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300005536|Ga0070697_100438635 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300005555|Ga0066692_10015507 | All Organisms → cellular organisms → Bacteria | 3740 | Open in IMG/M |
| 3300005556|Ga0066707_10189507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1322 | Open in IMG/M |
| 3300005557|Ga0066704_10338176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1011 | Open in IMG/M |
| 3300005557|Ga0066704_10397270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 917 | Open in IMG/M |
| 3300005561|Ga0066699_10311352 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300005561|Ga0066699_10343938 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300005568|Ga0066703_10255052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1064 | Open in IMG/M |
| 3300005574|Ga0066694_10606116 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300005576|Ga0066708_10964324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300005578|Ga0068854_101890918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300005841|Ga0068863_101342002 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300006032|Ga0066696_10278151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1085 | Open in IMG/M |
| 3300006041|Ga0075023_100201508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 768 | Open in IMG/M |
| 3300006041|Ga0075023_100487576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300006173|Ga0070716_100152956 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
| 3300006173|Ga0070716_100759005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 747 | Open in IMG/M |
| 3300006174|Ga0075014_100647122 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300006175|Ga0070712_100801686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 808 | Open in IMG/M |
| 3300006176|Ga0070765_100646564 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300006573|Ga0074055_10711642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300006797|Ga0066659_10273562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1276 | Open in IMG/M |
| 3300006800|Ga0066660_10955167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300006800|Ga0066660_11717445 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300009012|Ga0066710_100119184 | All Organisms → cellular organisms → Bacteria | 3588 | Open in IMG/M |
| 3300009088|Ga0099830_10009946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5753 | Open in IMG/M |
| 3300009089|Ga0099828_10615267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 977 | Open in IMG/M |
| 3300009090|Ga0099827_10644565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
| 3300009094|Ga0111539_12015563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300009519|Ga0116108_1080181 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300009523|Ga0116221_1180311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 917 | Open in IMG/M |
| 3300009551|Ga0105238_10539252 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300009624|Ga0116105_1111568 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300009628|Ga0116125_1096401 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300009632|Ga0116102_1122736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300009639|Ga0116122_1027532 | All Organisms → cellular organisms → Bacteria | 2004 | Open in IMG/M |
| 3300009639|Ga0116122_1030328 | All Organisms → cellular organisms → Bacteria | 1892 | Open in IMG/M |
| 3300009641|Ga0116120_1135514 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300009643|Ga0116110_1157581 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300009665|Ga0116135_1018693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2390 | Open in IMG/M |
| 3300009665|Ga0116135_1391360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300009698|Ga0116216_10718696 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300009759|Ga0116101_1055824 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300009764|Ga0116134_1159260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
| 3300009792|Ga0126374_10179001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1318 | Open in IMG/M |
| 3300009824|Ga0116219_10758498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300010043|Ga0126380_10280722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1173 | Open in IMG/M |
| 3300010048|Ga0126373_12576987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300010339|Ga0074046_10044767 | All Organisms → cellular organisms → Bacteria | 2959 | Open in IMG/M |
| 3300010360|Ga0126372_11165838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 793 | Open in IMG/M |
| 3300010360|Ga0126372_12217130 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300010361|Ga0126378_10426577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1440 | Open in IMG/M |
| 3300010366|Ga0126379_11220708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
| 3300010376|Ga0126381_100285349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2254 | Open in IMG/M |
| 3300010376|Ga0126381_101385408 | Not Available | 1016 | Open in IMG/M |
| 3300010396|Ga0134126_11197366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300010401|Ga0134121_11351994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300011269|Ga0137392_10236589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1501 | Open in IMG/M |
| 3300011270|Ga0137391_10600448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 923 | Open in IMG/M |
| 3300011270|Ga0137391_11282606 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300011271|Ga0137393_10504673 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300011332|Ga0126317_10639733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 988 | Open in IMG/M |
| 3300012096|Ga0137389_10023572 | All Organisms → cellular organisms → Bacteria | 4366 | Open in IMG/M |
| 3300012096|Ga0137389_11518621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300012189|Ga0137388_10218451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1724 | Open in IMG/M |
| 3300012205|Ga0137362_11605067 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300012208|Ga0137376_10382284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1223 | Open in IMG/M |
| 3300012212|Ga0150985_105544756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2316 | Open in IMG/M |
| 3300012351|Ga0137386_10685422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300012354|Ga0137366_10082555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2444 | Open in IMG/M |
| 3300012357|Ga0137384_10721134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
| 3300012361|Ga0137360_11491094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300012917|Ga0137395_10115827 | All Organisms → cellular organisms → Bacteria | 1798 | Open in IMG/M |
| 3300012918|Ga0137396_10763805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300012925|Ga0137419_10259613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1313 | Open in IMG/M |
| 3300013770|Ga0120123_1104423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300014154|Ga0134075_10450368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300014160|Ga0181517_10502858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300014167|Ga0181528_10064304 | All Organisms → cellular organisms → Bacteria | 2019 | Open in IMG/M |
| 3300014201|Ga0181537_10008946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7597 | Open in IMG/M |
| 3300014498|Ga0182019_11034787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300014655|Ga0181516_10698833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300015241|Ga0137418_10169889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1906 | Open in IMG/M |
| 3300015371|Ga0132258_11234713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1889 | Open in IMG/M |
| 3300016445|Ga0182038_11135220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300017656|Ga0134112_10425107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300017659|Ga0134083_10089109 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1206 | Open in IMG/M |
| 3300017823|Ga0187818_10203816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
| 3300017934|Ga0187803_10077064 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300017935|Ga0187848_10079966 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
| 3300017941|Ga0187850_10092772 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300017959|Ga0187779_10494906 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300017995|Ga0187816_10231296 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300017998|Ga0187870_1178257 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300018006|Ga0187804_10111225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1132 | Open in IMG/M |
| 3300018006|Ga0187804_10392253 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300018013|Ga0187873_1266806 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300018017|Ga0187872_10247132 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300018019|Ga0187874_10023500 | All Organisms → cellular organisms → Bacteria | 3167 | Open in IMG/M |
| 3300018019|Ga0187874_10067073 | All Organisms → cellular organisms → Bacteria | 1621 | Open in IMG/M |
| 3300018024|Ga0187881_10082197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1486 | Open in IMG/M |
| 3300018033|Ga0187867_10487898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300018034|Ga0187863_10853060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300018037|Ga0187883_10348736 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300018037|Ga0187883_10424270 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300018040|Ga0187862_10254663 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300018040|Ga0187862_10730545 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300018042|Ga0187871_10665279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300018043|Ga0187887_10120066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1579 | Open in IMG/M |
| 3300018044|Ga0187890_10852309 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300018046|Ga0187851_10487424 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300018058|Ga0187766_11146452 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300018085|Ga0187772_10567843 | Not Available | 805 | Open in IMG/M |
| 3300018086|Ga0187769_10146663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1726 | Open in IMG/M |
| 3300018090|Ga0187770_10188855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1584 | Open in IMG/M |
| 3300018433|Ga0066667_10252149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1338 | Open in IMG/M |
| 3300018468|Ga0066662_11602477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300019082|Ga0187852_1042159 | All Organisms → cellular organisms → Bacteria | 2154 | Open in IMG/M |
| 3300020002|Ga0193730_1131191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| 3300020018|Ga0193721_1064313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 959 | Open in IMG/M |
| 3300020199|Ga0179592_10454179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300020580|Ga0210403_11050014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300020583|Ga0210401_10292775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1489 | Open in IMG/M |
| 3300021088|Ga0210404_10608894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300021181|Ga0210388_10162294 | All Organisms → cellular organisms → Bacteria | 1945 | Open in IMG/M |
| 3300021377|Ga0213874_10293364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300021401|Ga0210393_10965649 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300021402|Ga0210385_11047077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300021405|Ga0210387_10635454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 948 | Open in IMG/M |
| 3300021407|Ga0210383_10192042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1745 | Open in IMG/M |
| 3300021420|Ga0210394_10457386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1123 | Open in IMG/M |
| 3300021420|Ga0210394_10545570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1020 | Open in IMG/M |
| 3300021432|Ga0210384_10855862 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300021433|Ga0210391_10640825 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300021433|Ga0210391_11294736 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300021474|Ga0210390_10072331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2850 | Open in IMG/M |
| 3300021474|Ga0210390_10240446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1532 | Open in IMG/M |
| 3300021477|Ga0210398_10639290 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300021478|Ga0210402_10534706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1088 | Open in IMG/M |
| 3300021478|Ga0210402_11664457 | Not Available | 565 | Open in IMG/M |
| 3300021559|Ga0210409_10129906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2314 | Open in IMG/M |
| 3300021560|Ga0126371_10330892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1655 | Open in IMG/M |
| 3300021560|Ga0126371_10634778 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
| 3300021560|Ga0126371_13813590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300021861|Ga0213853_10821472 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300022557|Ga0212123_10570428 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300022726|Ga0242654_10045721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1217 | Open in IMG/M |
| 3300023259|Ga0224551_1004747 | All Organisms → cellular organisms → Bacteria | 2265 | Open in IMG/M |
| 3300024295|Ga0224556_1072356 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300025404|Ga0208936_1013991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1005 | Open in IMG/M |
| 3300025414|Ga0208935_1059538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300025496|Ga0208191_1039004 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300025496|Ga0208191_1075209 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300025625|Ga0208219_1100633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300025922|Ga0207646_11835422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300025924|Ga0207694_11864983 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300025928|Ga0207700_10847168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
| 3300025929|Ga0207664_10190805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1764 | Open in IMG/M |
| 3300025942|Ga0207689_10252252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1459 | Open in IMG/M |
| 3300025949|Ga0207667_10861897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 899 | Open in IMG/M |
| 3300025986|Ga0207658_10831447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 839 | Open in IMG/M |
| 3300025986|Ga0207658_11457306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300026217|Ga0209871_1044285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 842 | Open in IMG/M |
| 3300026309|Ga0209055_1071487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1447 | Open in IMG/M |
| 3300026318|Ga0209471_1238001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300026333|Ga0209158_1072107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1360 | Open in IMG/M |
| 3300026334|Ga0209377_1322725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300026361|Ga0257176_1090397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300026482|Ga0257172_1059692 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300026502|Ga0255350_1017744 | All Organisms → cellular organisms → Bacteria | 1981 | Open in IMG/M |
| 3300026515|Ga0257158_1087324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300026542|Ga0209805_1329059 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300026551|Ga0209648_10145706 | All Organisms → cellular organisms → Bacteria | 1877 | Open in IMG/M |
| 3300026557|Ga0179587_10786250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300026984|Ga0208732_1024787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300027047|Ga0208730_1013223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
| 3300027164|Ga0208994_1044305 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300027565|Ga0209219_1172365 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300027575|Ga0209525_1037791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1187 | Open in IMG/M |
| 3300027587|Ga0209220_1105657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300027609|Ga0209221_1067160 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300027629|Ga0209422_1077618 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300027676|Ga0209333_1141304 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 649 | Open in IMG/M |
| 3300027678|Ga0209011_1171556 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300027727|Ga0209328_10121438 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300027729|Ga0209248_10050924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1271 | Open in IMG/M |
| 3300027729|Ga0209248_10133612 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300027745|Ga0209908_10230858 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300027768|Ga0209772_10295291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300027812|Ga0209656_10460115 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300027829|Ga0209773_10422434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300027853|Ga0209274_10060610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1813 | Open in IMG/M |
| 3300027854|Ga0209517_10396426 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300027874|Ga0209465_10360505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300027875|Ga0209283_10299922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1060 | Open in IMG/M |
| 3300027894|Ga0209068_10113744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1439 | Open in IMG/M |
| 3300027895|Ga0209624_10539161 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300027905|Ga0209415_10015058 | All Organisms → cellular organisms → Bacteria | 12584 | Open in IMG/M |
| 3300027910|Ga0209583_10365057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300027911|Ga0209698_10147955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1929 | Open in IMG/M |
| 3300027911|Ga0209698_11183091 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300027915|Ga0209069_10625274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300028639|Ga0302168_1052942 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300028740|Ga0302294_10156190 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300028748|Ga0302156_10278595 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300028775|Ga0302231_10196706 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300028777|Ga0302290_10049082 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300028785|Ga0302201_10209986 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300028789|Ga0302232_10212287 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300028800|Ga0265338_10514521 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300028860|Ga0302199_1104133 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300028863|Ga0302218_10155876 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300028866|Ga0302278_10081595 | All Organisms → cellular organisms → Bacteria | 1861 | Open in IMG/M |
| 3300028906|Ga0308309_10000847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 18345 | Open in IMG/M |
| 3300029636|Ga0222749_10010926 | All Organisms → cellular organisms → Bacteria | 3658 | Open in IMG/M |
| 3300029636|Ga0222749_10041744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1994 | Open in IMG/M |
| 3300029882|Ga0311368_10516508 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300029939|Ga0311328_10319810 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300029945|Ga0311330_10402887 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300029990|Ga0311336_10174960 | All Organisms → cellular organisms → Bacteria | 1740 | Open in IMG/M |
| 3300030011|Ga0302270_10349964 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300030053|Ga0302177_10705417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300030058|Ga0302179_10223916 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300030058|Ga0302179_10402227 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300030520|Ga0311372_12653742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300030618|Ga0311354_10466569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1257 | Open in IMG/M |
| 3300030741|Ga0265459_14295203 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300030850|Ga0075387_11441434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300031022|Ga0138301_1071236 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300031128|Ga0170823_12586076 | All Organisms → cellular organisms → Bacteria | 2157 | Open in IMG/M |
| 3300031231|Ga0170824_100498438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300031231|Ga0170824_120196545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1883 | Open in IMG/M |
| 3300031233|Ga0302307_10230101 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300031234|Ga0302325_10180465 | All Organisms → cellular organisms → Bacteria | 3688 | Open in IMG/M |
| 3300031236|Ga0302324_100108764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4668 | Open in IMG/M |
| 3300031236|Ga0302324_100559664 | All Organisms → cellular organisms → Bacteria | 1651 | Open in IMG/M |
| 3300031249|Ga0265339_10065968 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1939 | Open in IMG/M |
| 3300031525|Ga0302326_10916979 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300031680|Ga0318574_10763747 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300031708|Ga0310686_114543203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1619 | Open in IMG/M |
| 3300031708|Ga0310686_119715098 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300031718|Ga0307474_10561941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
| 3300031719|Ga0306917_10447130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1012 | Open in IMG/M |
| 3300031719|Ga0306917_11518934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300031754|Ga0307475_10176039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1706 | Open in IMG/M |
| 3300031754|Ga0307475_10430667 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300031754|Ga0307475_10526663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 948 | Open in IMG/M |
| 3300031754|Ga0307475_11232881 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300031768|Ga0318509_10203932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1100 | Open in IMG/M |
| 3300031820|Ga0307473_10000236 | All Organisms → cellular organisms → Bacteria | 11511 | Open in IMG/M |
| 3300031820|Ga0307473_10746102 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300031820|Ga0307473_10860405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300031823|Ga0307478_10228210 | All Organisms → cellular organisms → Bacteria | 1506 | Open in IMG/M |
| 3300031823|Ga0307478_10371478 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300031879|Ga0306919_11426598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300031910|Ga0306923_10744418 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300031912|Ga0306921_12720819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300031946|Ga0310910_10733658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 780 | Open in IMG/M |
| 3300032042|Ga0318545_10115969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 943 | Open in IMG/M |
| 3300032180|Ga0307471_100365099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1559 | Open in IMG/M |
| 3300032205|Ga0307472_100000857 | All Organisms → cellular organisms → Bacteria | 11372 | Open in IMG/M |
| 3300032205|Ga0307472_100635538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 948 | Open in IMG/M |
| 3300032205|Ga0307472_102181288 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300032783|Ga0335079_11255511 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300032828|Ga0335080_10062462 | All Organisms → cellular organisms → Bacteria | 4125 | Open in IMG/M |
| 3300032829|Ga0335070_10010807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10665 | Open in IMG/M |
| 3300032893|Ga0335069_10238378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2194 | Open in IMG/M |
| 3300032954|Ga0335083_10511538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1003 | Open in IMG/M |
| 3300032954|Ga0335083_10558042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 950 | Open in IMG/M |
| 3300033158|Ga0335077_10696163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1047 | Open in IMG/M |
| 3300033547|Ga0316212_1041867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300033982|Ga0371487_0217978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 901 | Open in IMG/M |
| 3300034091|Ga0326724_0475220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.87% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.53% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.84% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.12% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.81% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.81% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.75% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.41% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.41% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.06% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.72% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.72% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.72% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.37% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.37% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.37% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.03% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.03% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.03% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.03% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.03% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.69% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.34% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.34% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.34% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.34% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.34% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.34% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.34% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.34% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.34% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.34% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.34% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.34% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.34% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.34% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.34% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.34% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300001100 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025404 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025496 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026502 | Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r1 | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026984 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF048 (SPAdes) | Environmental | Open in IMG/M |
| 3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
| 3300027164 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028639 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_2 | Environmental | Open in IMG/M |
| 3300028740 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_3 | Environmental | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028777 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_3 | Environmental | Open in IMG/M |
| 3300028785 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028860 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030011 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300030850 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB1 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031022 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| 3300033982 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AP72_2010_repI_A01DRAFT_10308682 | 3300000579 | Forest Soil | MIENRDLTLDDYLAMLRRRMKMILIPALLAPLVGFLISY |
| JGI12703J13194_1034311 | 3300001100 | Forest Soil | MVNTMSENRELTMDDYLAMLRRRLKVILVPLLLAPLGGFAISYLF |
| JGI12053J15887_101281311 | 3300001661 | Forest Soil | MTENRELTMDDYLGMLRRRLKVIVIPALLAPLAGFLVSYAFAPKYT |
| JGI12053J15887_105703231 | 3300001661 | Forest Soil | MIENRELTMDDYLAMLRRRAKVILIPALLAPVIGWLISYAFVPKYT |
| JGIcombinedJ26739_1009160181 | 3300002245 | Forest Soil | MIANRELNLDDYLAMLRRRAWILLIPALLVPIAGWLISYAFTPK |
| JGI25382J37095_101301002 | 3300002562 | Grasslands Soil | MIENRELSIDDYLAMLRRRLKVILIPALLAPFAGFLISYAFPAKYTS |
| C688J35102_1189444812 | 3300002568 | Soil | MIENRELTMDDYLAMLRRRLKIILIPALLAPLIGFAVSFGFSPKFTS |
| C688J35102_1197473641 | 3300002568 | Soil | MHWRERPEWMLAMIENRELTVDDYLAMLRRRAPIILIPALVAPLLGFLISFAFPAKYTS |
| C688J35102_1198179921 | 3300002568 | Soil | MGTNMIENRVLTMDDYGAMLRRRLKVILIPTLLAPLAGFLISYAFSA |
| JGIcombinedJ51221_101636661 | 3300003505 | Forest Soil | MIENRELSIDDYLAMLRRRAKVLLIPAFIAPLVGFLVSYAF |
| Ga0062384_1000179041 | 3300004082 | Bog Forest Soil | MENRELTMDDYLAMLRRRMKVILIPALLAPLAGFLVSYVFPPKY |
| Ga0062386_1005663291 | 3300004152 | Bog Forest Soil | MMENRELTMDDYLAMLRRRMRVILIPALLAPLAGFLVSYVFPAKYT |
| Ga0066679_103145862 | 3300005176 | Soil | MIENRELTVDDYLAMLRRRLKVVLIPALLAPLAGFLISFAFAPKYTS |
| Ga0070714_1005054542 | 3300005435 | Agricultural Soil | MGTNMIENRVLTMDDYGAMLRRRLKVILIPTLLAPLAGFLISYAFPSKYTSQA |
| Ga0070714_1015140322 | 3300005435 | Agricultural Soil | MIANREFGMDDYLAMFRRRLTVILIPLLLAPLAGFLVSYALAPK |
| Ga0070711_1011047462 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MIENRELTINDYLAMLRRRLKVILIPTLLAPLVGFAVSFA |
| Ga0066689_106764142 | 3300005447 | Soil | MVNSMIENRELTMDDYLAMVRRRLKVILIPALLAPLAGFLVSYAFPPKYSSQ |
| Ga0070699_1014774291 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MDDYLAMLRRRARVILIPAVLAPVVGFLISYAFAPKYTSQSTIL |
| Ga0070697_1004386352 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MVNSMIENRELTMDDYLAMVRRRLKVILIPALLAPLAGFL |
| Ga0066692_100155071 | 3300005555 | Soil | MSENRELTMDDYLAMLRRRLKVILIPALLAPLAGFMVSYVFPPTYKSQ |
| Ga0066707_101895072 | 3300005556 | Soil | MIENRELSMDDYLAMLRRRLKVILIPALLAPLAGFLIS |
| Ga0066704_103381761 | 3300005557 | Soil | MIENRELTMDDYLAMLRRRLKVILIPAFLAPLAGFAVSYAFSPKYTSQS |
| Ga0066704_103972701 | 3300005557 | Soil | MIENRELSMDDYLAMLRRRLKVILIPALLAPLAGFLISFAF |
| Ga0066699_103113521 | 3300005561 | Soil | VAERNLAMIENRELTIDDYLAMLRRRLKVILIPALLAPLAGFLISFAF |
| Ga0066699_103439382 | 3300005561 | Soil | MIENRELTMDDYLAMLRRRAKVILIPALLAPLAGWLISYAFVPKYTSQ |
| Ga0066703_102550521 | 3300005568 | Soil | MIENRELSIDDYLAMLRRRLKVILIPALLAPFAGFLISYA |
| Ga0066694_106061161 | 3300005574 | Soil | MIENRELTMDDYLAMLRRRAKWILIPALLAPLAGWLI |
| Ga0066708_109643241 | 3300005576 | Soil | MIENRELTMDDYLAMVRRRLKIILIPALLAPIAGLMVS |
| Ga0068854_1018909181 | 3300005578 | Corn Rhizosphere | MIENRELTMDDYLAMLRRRLKIILIPALLAPLVGFAVSYAFSP |
| Ga0068863_1013420021 | 3300005841 | Switchgrass Rhizosphere | MIENRELTMDDYLAMLRRRIKVILIPAILAPLVGFLISFAI |
| Ga0066696_102781512 | 3300006032 | Soil | MIENRELTMDDYAAMLRRRLKIILIPALLAPIVGFAVSYAFAPKYTSQSTI |
| Ga0075023_1002015081 | 3300006041 | Watersheds | MIENRDLTIDDYLAMLQRRLKLILIPTLLAPLAGFLISYAFTAK |
| Ga0075023_1004875762 | 3300006041 | Watersheds | MIENRELSVDDYLAMLRRRLKVLLIPALVAPLVGFLVSYAFSPKYTSQ |
| Ga0070716_1001529562 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MIQNRELTMDDYVGMLRRRLWVVLIPALIAPAIGFGISYFFQPKYT |
| Ga0070716_1007590051 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MTENRELTMDDYFAMLRRRIKVIVIPALLAPIAGFAVSF |
| Ga0075014_1006471222 | 3300006174 | Watersheds | MQNRELTMDDYLAMLRCRMKVILIPLLLAPLAGFLISYVFPAKYT |
| Ga0070712_1008016862 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MIENRELTMDDYLAMLRRRLKIILIPALLAPLVGFAVSYAFSPKFTSQ |
| Ga0070765_1006465641 | 3300006176 | Soil | MIQNRELTIDDYLAMFRRRLAAILVPALLAPVAAYVLSYAFTPRFTSQSLI |
| Ga0074055_107116421 | 3300006573 | Soil | MIENRDLTLDDYLAMLRRRLKMILIPALLAPLVGFLISYAFTAKYT |
| Ga0066659_102735621 | 3300006797 | Soil | MITNRELTMQDYTAMLRRRAMVILIPALLAPLAGFLI |
| Ga0066660_109551672 | 3300006800 | Soil | MSMIENRELTMDDYLAMLRRRLKIIIIPALLAPLVGFA |
| Ga0066660_117174452 | 3300006800 | Soil | MIENRELTMDDYLAMLRRRAKVILIPALLAPLAGWLISYAFVPKY |
| Ga0066710_1001191844 | 3300009012 | Grasslands Soil | MGRPERNIGMIENRELTIDDYLAMLRRRVKVILIPALLAPVAGFLISYAFSPKYTSQS |
| Ga0099830_100099461 | 3300009088 | Vadose Zone Soil | MIENRELTIDDYLAMLRRRVKVILIPALLAPVAGFLISYAFSPKYTS |
| Ga0099828_106152672 | 3300009089 | Vadose Zone Soil | MIENRELNIDDYLAMLRRRLRVILIPALLAPLVGCLISFAFPAKDTSQSLVLVEEQ |
| Ga0099827_106445652 | 3300009090 | Vadose Zone Soil | MSENRELTMDDYLAMLRRRLKVILIPALLAPLAGFLVSYVFPPTYKS |
| Ga0111539_120155632 | 3300009094 | Populus Rhizosphere | MIDNRELGMDDYLAMLRRRLKVILIPALLAPLLGFLVSYAF |
| Ga0116108_10801812 | 3300009519 | Peatland | MENRELTMDDYLAMLRRRTKVILIPALLAPLAGFLVSYAFPAKY |
| Ga0116221_11803111 | 3300009523 | Peatlands Soil | MSDRELTTDDYLAMLRRRLKVILIPALVAPLTGFLVSY |
| Ga0105238_105392521 | 3300009551 | Corn Rhizosphere | MIQNRELTIDDYVAMLRRRLWVILIPAMIAPAIGFGISYLFPPK |
| Ga0116105_11115682 | 3300009624 | Peatland | MMENRELTMDDYLAMLRRRMKVILIPALLAPLAGFLVSYLFSPKY |
| Ga0116125_10964011 | 3300009628 | Peatland | VCEEDIGMIENRELSMDDYLAMVRRRLKIILIPALLAPLAGFL |
| Ga0116102_11227361 | 3300009632 | Peatland | MSENRELTMDDYLAMLRRRLKVILIPTLIAPLTGFMVSYV |
| Ga0116122_10275323 | 3300009639 | Peatland | MMENRELTMDDYLAMLRRRMKVILIPALLAPLAGFLVSYLFPP |
| Ga0116122_10303281 | 3300009639 | Peatland | MENRELTLDDYLAMLRRRMKVILIPALLAPLAGFL |
| Ga0116120_11355142 | 3300009641 | Peatland | MENRELTMDDYLAMLRRRMKVILIPALLAPLTGFLVSYGFP |
| Ga0116110_11575811 | 3300009643 | Peatland | MENRELTMDDYLAMLRRRMKVILIPALLAPLAGFLVSYGFPAKYTAQSEV |
| Ga0116135_10186931 | 3300009665 | Peatland | MIENRELSMDDYLAMLRRRLKIILIPALLAPLAGL |
| Ga0116135_13913601 | 3300009665 | Peatland | VGWDIGMIENRELSMDDYLAMVRRRLKIILIPALLAPLAGFLISY |
| Ga0116216_107186962 | 3300009698 | Peatlands Soil | MSENRELTMDDYLAMLRRRLKVILIPALIAPIAGFMVSFAFSP |
| Ga0116101_10558241 | 3300009759 | Peatland | MENRELTMDDYLGMLRRRMKVILVPALLAPVAGFLV |
| Ga0116134_11592601 | 3300009764 | Peatland | MSENRELTMDDYLAMLRRRLKVILIPTLVAPLTGFLVSYALP |
| Ga0126374_101790011 | 3300009792 | Tropical Forest Soil | MIENRDLTIDDYLSMLRRRVKLILIPTLLAPLVGFVVSLFVP |
| Ga0116219_107584982 | 3300009824 | Peatlands Soil | MDDYLAMLRRRLKVILIPALLAPLAGFMVSYVFPPKFTS |
| Ga0126380_102807221 | 3300010043 | Tropical Forest Soil | MITNRELTMQDYMAMLRRRVWIILIPALMAPLAGYFASYA |
| Ga0126373_125769871 | 3300010048 | Tropical Forest Soil | MIANRELTIDDYGAMLRRRAKVLLIPALLAPLAGFLVSYLFAAKYT |
| Ga0074046_100447671 | 3300010339 | Bog Forest Soil | MSDRELTMDDYLAMLLRRLRVILIPALLAPLGGFLVSYVFPPKYT |
| Ga0126372_111658382 | 3300010360 | Tropical Forest Soil | LDDEMIANRELTMDDYAAMLRRRARVLLIPALLAPLAGFLVSYVFP |
| Ga0126372_122171301 | 3300010360 | Tropical Forest Soil | MIENRDLTIDDYLSMLRRRVKLILIPTLLAPLVGFV |
| Ga0126378_104265772 | 3300010361 | Tropical Forest Soil | MIENRELTMDDYLAMLRRRLKVILIPTLLAPLVGFGVSFFFSP |
| Ga0126379_112207082 | 3300010366 | Tropical Forest Soil | MDVREMITSRELTVQDYVAMLRRRAWIILVPALVAPLAGYLVSYAFHS |
| Ga0126381_1002853491 | 3300010376 | Tropical Forest Soil | MIENRELTMDDYLAMLRRRLKVILIPTLLAPLVGFGVSFF |
| Ga0126381_1013854082 | 3300010376 | Tropical Forest Soil | MITSREQTVDDYLAILRRRLWLILIPAVVAPGIGFGVSYF |
| Ga0134126_111973661 | 3300010396 | Terrestrial Soil | MIENRVLTMDDYGAMLRRRLKIILIPTLLAPLVGFLISYAFP |
| Ga0134121_113519942 | 3300010401 | Terrestrial Soil | MIENRELSMDDYLAMLRRRLKVILIPALLAPLVGFLISYAFPAKYTAQS |
| Ga0137392_102365891 | 3300011269 | Vadose Zone Soil | MIENRELNMDDYLAMLHRRLKVILIPALLAPLAGFLIS |
| Ga0137391_106004481 | 3300011270 | Vadose Zone Soil | MSENRELTMDDYLAMLRRRLKPILTPALLAPLAGFMVSYVFPP |
| Ga0137391_112826062 | 3300011270 | Vadose Zone Soil | MWAGGMGNDMMENRELGMDDYLAMLRRRMKVILIPALLAPLAGFLVSYVFPAKYTSQSLV |
| Ga0137393_105046731 | 3300011271 | Vadose Zone Soil | MIANRELTMDDYLAMLRRRAKWILIPALLAPLAGWLI |
| Ga0126317_106397331 | 3300011332 | Soil | MIENRVLTMDDYGAMLRRRLKIILIPTLLAPLVGFLISYA |
| Ga0137389_100235724 | 3300012096 | Vadose Zone Soil | MIENRELTMDDYLAMLRRRAKVILIPALLAPLAGWLISYAFVP* |
| Ga0137389_115186212 | 3300012096 | Vadose Zone Soil | MIENRELTMDDYLAMVRRRLKIILIPALMAPLAGVLVSYAFP |
| Ga0137388_102184513 | 3300012189 | Vadose Zone Soil | MGTTMIENRELTMDDYLAMLRRRLKVILIPTLLAPLVGF |
| Ga0137362_116050671 | 3300012205 | Vadose Zone Soil | MAERELAMIENRELTIDDYLAMLRRRLKVILIPALLAPLAGFLISFAFPP |
| Ga0137376_103822841 | 3300012208 | Vadose Zone Soil | MITNREMTMQDYTAMFRRRATIILIPALLAPLAGFLI |
| Ga0150985_1055447561 | 3300012212 | Avena Fatua Rhizosphere | MENRELTINDYTAMLRRRLKIILIPALLAPLVGFA |
| Ga0137386_106854221 | 3300012351 | Vadose Zone Soil | MAGMGNGMIENRELSMDDYLAMLRRRLKVILIPALLAPLAGF |
| Ga0137366_100825551 | 3300012354 | Vadose Zone Soil | MIENRELTMDDYLAMLRRRLKVILIPAFLAPLAGFAVSYAFSPKYTS |
| Ga0137384_107211341 | 3300012357 | Vadose Zone Soil | MITARELTLDDYLAMLRRRAKVILLPAVLAPLVGFAVS |
| Ga0137360_114910941 | 3300012361 | Vadose Zone Soil | MIYNRELSMDDYLAMLRRRLKVILIPTLLAPLVGFAVS |
| Ga0137395_101158271 | 3300012917 | Vadose Zone Soil | MIANREMTMDDYLAMLRRRAKWILIPALLAPLAGWLISYAFPAKYTSQA |
| Ga0137396_107638051 | 3300012918 | Vadose Zone Soil | MSENRELTMDDYLAMLRRRLKVILIPALLAPLAGFLVS* |
| Ga0137419_102596131 | 3300012925 | Vadose Zone Soil | MSENHELTMDDYLAMLRRRLKVILIPALLAPLAGFVVSYVFPATY |
| Ga0120123_11044233 | 3300013770 | Permafrost | MIENRELTMDDYLAMLRRRLKIILIPTLLAPLVGFAVSYA |
| Ga0134075_104503682 | 3300014154 | Grasslands Soil | MIENRELNIDDYLAMLRRRTKVIVIPALLAPLLGFLVSFAFSP |
| Ga0181517_105028582 | 3300014160 | Bog | MSERELTTDDYVAMLRRRLKVILIPALVAPLTGFLVSYAPFLPARY |
| Ga0181528_100643041 | 3300014167 | Bog | MANRELSMDDYLAMLKRRMKVLLIPTVVAFVVGYLVSHAFPAKYTSQSTV |
| Ga0181537_100089468 | 3300014201 | Bog | MSENRELTMDDYLAMLRRRLRVILVPALLAPLAGFGVSYF |
| Ga0182019_110347871 | 3300014498 | Fen | MIQNRELTMDDYLAMLHRRAKVILIPALLAPIVGFAVSYAFTPKYT |
| Ga0181516_106988331 | 3300014655 | Bog | MANRELSMDDYLAMLKRRSRVLLIPTVLAFIGGYLVSHAFPAKYTSQS |
| Ga0137418_101698893 | 3300015241 | Vadose Zone Soil | MVNNMIENRELTMDDYLAMVRRRLRVILIPALLAPIAGFLV |
| Ga0132258_112347133 | 3300015371 | Arabidopsis Rhizosphere | MIENRDYTIDDYLLILRRRMKWILIPALIAPVVGFLISY |
| Ga0182038_111352202 | 3300016445 | Soil | MMENRQLTVDDYLAMFRRRIKMILIPTLLAPLVGFGASYLF |
| Ga0134112_104251071 | 3300017656 | Grasslands Soil | MIENRVLTMDDYGAMLRRRLKLILIPTILAPLVGFLIS |
| Ga0134083_100891091 | 3300017659 | Grasslands Soil | MGNGMIENRELSMDDYLAMLRRRLKVILIPALLAPLAG |
| Ga0187818_102038162 | 3300017823 | Freshwater Sediment | MSENRELTMDDYLAMLRRRLKVILIPTLIAPIAGFMVSYAFSPK |
| Ga0187803_100770641 | 3300017934 | Freshwater Sediment | LVKVMTENRELTMDDYLAMLRRRLKVILLPAVLAPLTGFLVSYAFPPKYTSQS |
| Ga0187848_100799662 | 3300017935 | Peatland | MENRELTLDDYLAMLRRRMRVILIPALLAPLAGFLVSYFFPAKYMS |
| Ga0187850_100927721 | 3300017941 | Peatland | MENRELTMDDYLAMLRRRMKVILIPALLAPLAGFLVSYGFPAKYTSQS |
| Ga0187779_104949061 | 3300017959 | Tropical Peatland | MIENRELTMDDYLAMLRRKAKVILIPALLAPLAGWLVSWAFPPKYTSQSLVMYE |
| Ga0187816_102312962 | 3300017995 | Freshwater Sediment | MENRELTMDDYLAMLRRRAKVIVIPMLLAPLVGFLISYAVPPKY |
| Ga0187870_11782572 | 3300017998 | Peatland | MDDYLAMLRRRMKVILIPALLAPLAGFLVSYGFTAKYTSQSEVLVSPPR |
| Ga0187804_101112251 | 3300018006 | Freshwater Sediment | MIENRELSVDDYLAMLRRRLKVILIPALAAPLAGFLISYA |
| Ga0187804_103922531 | 3300018006 | Freshwater Sediment | MIENRELTMDDYLAMLRRRLKVILIPALLAPLAGFLVSYVFPPKFTSQ |
| Ga0187873_12668062 | 3300018013 | Peatland | MENRELTMDDYLAMLRRRMKVILIPALLAPLAGFLVSYAF |
| Ga0187872_102471322 | 3300018017 | Peatland | MENRELTMDDYLAMLRRRMKVILIPALLAPLAGFLVSYGFPA |
| Ga0187874_100235001 | 3300018019 | Peatland | MSENRELTMDDYLAMLRRRLKVILIPTLIAPIAGFMI |
| Ga0187874_100670731 | 3300018019 | Peatland | MIENRELTMDDYLAMLRRRMKVILIPALLAPLAGFLVSYAFPAKYTSQS |
| Ga0187881_100821971 | 3300018024 | Peatland | MSENRELTMDDYLAMLRRRLKVILIPTLIAPIAGFMIS |
| Ga0187867_104878981 | 3300018033 | Peatland | MSENRELTMDDYLAMLRRRLKVILIPALMAPLTGFLVSYAPFFPPRYTSQSTVL |
| Ga0187863_108530601 | 3300018034 | Peatland | MIENRELSMDDYLAMVRRRLKIILIPALLAPLAGFLISY |
| Ga0187883_103487361 | 3300018037 | Peatland | MGTEMMENRELTMDDYLAMLRRRLKVILIPALLAPLAGF |
| Ga0187883_104242702 | 3300018037 | Peatland | MENRELTMDDYLAMFRRRAKLILIPALLAPLAGFGVSYFFP |
| Ga0187862_102546631 | 3300018040 | Peatland | MENRELTMDDYLAMLRRRMKVILIPVLLAPLAGFLVSYVFS |
| Ga0187862_107305452 | 3300018040 | Peatland | MTENRELTMDDYLAMLRRRMKVILIPVLLAPLAGFLVSYVFS |
| Ga0187871_106652791 | 3300018042 | Peatland | MSERELTTDDYLAMLRRRLKVILIPALVAPLTGFLVSY |
| Ga0187887_101200661 | 3300018043 | Peatland | MITNRELTMDDYLAMLRRRLKVILVPALFAPLVGFLVSYTFTTKWTS |
| Ga0187890_108523092 | 3300018044 | Peatland | MADAREMSMDDYLAMARRRMKIVIIPLLLAPIAGFLVSYLPMFPPKYVSQAVVLVEGQ |
| Ga0187851_104874242 | 3300018046 | Peatland | MENRELTMDDYLAMFRRRAKLILIPALLAPLAGFG |
| Ga0187766_111464522 | 3300018058 | Tropical Peatland | MVKNMTEDRDLTMDDYLAMVRRRLKVILIPALLAGIAG |
| Ga0187772_105678431 | 3300018085 | Tropical Peatland | MVENRELGMEDYLAMARRRLKIVLIPLLIAPLAGFMVSFIFPPRYTSQSMI |
| Ga0187769_101466632 | 3300018086 | Tropical Peatland | METTMIENRELKMDDYLAMLRRRAKIILIPALFAPLAGFFVSYVF |
| Ga0187770_101888552 | 3300018090 | Tropical Peatland | MAENRELTMEDYLAMARRRLNVILIPLLIAPVAGFLISYVFPPKYT |
| Ga0066667_102521491 | 3300018433 | Grasslands Soil | MGNGMIENRELSMDDYLAMLRRRLKVILIPALLAP |
| Ga0066662_116024772 | 3300018468 | Grasslands Soil | MSENRELTMDDYLAMLRRRLKVILIPALLAPLAGFMVSYVFPP |
| Ga0187852_10421591 | 3300019082 | Peatland | MENRELTMDDYLAMLRRRMKVILIPALLAPLAGFLVSY |
| Ga0193730_11311911 | 3300020002 | Soil | MIENRELTVDDYLATLRRRLKVILIPALLAPLAGFL |
| Ga0193721_10643131 | 3300020018 | Soil | MIENRELTMDDYAAMLRRRLKIILIPALLAPIVGFAVSYAFA |
| Ga0179592_104541791 | 3300020199 | Vadose Zone Soil | MSENRELTMDDYLAMLRRRLKVILIPALLAPLAGYMVSY |
| Ga0210403_110500142 | 3300020580 | Soil | MIENRDLTLDDYLAMLRRRMKMILIPALLAPLVGFLI |
| Ga0210401_102927751 | 3300020583 | Soil | MIENRELSMDDYLAMLRRRLKIILIPALLATLAGFL |
| Ga0210404_106088942 | 3300021088 | Soil | MRAAARRNMSMIQNRELTMDDYLAMLRRRAKMIVIPALLAPLAGFLVSYAF |
| Ga0210388_101622941 | 3300021181 | Soil | MENRELTMDDYLAMARRRMKMILIPALLAPLAGFAVSYLFSSKYTSQSLVL |
| Ga0213874_102933642 | 3300021377 | Plant Roots | MIENRELGLDDYLAMLRRRLKTILIPALVAPLAGFA |
| Ga0210393_109656492 | 3300021401 | Soil | MENRELTMDDYLAMLRRRMKVILIPALLAPLAGFLVSYAFPPK |
| Ga0210385_110470771 | 3300021402 | Soil | MADTRELTMDDYLAMARRRLKVVIVPLLIAPIAGFLVSYA |
| Ga0210387_106354541 | 3300021405 | Soil | MIQNRELTMDDYLAMLRRRAKVILIPALIAPLVGFLVSYAFTPAYKSE |
| Ga0210383_101920421 | 3300021407 | Soil | MSENRELTMDDYLAMLRRRLKVILIPALLAPLAGYMVSFVFP |
| Ga0210394_104573862 | 3300021420 | Soil | MSETRELTMDDYLAMLRRRLKVILVPALVAPLSGFLISYAL |
| Ga0210394_105455701 | 3300021420 | Soil | MIENRVLTMDDYAAMLRRRLKIIIVPTLLAPLVGFLISYAFPAKYTSQAL |
| Ga0210384_108558622 | 3300021432 | Soil | MENREFTMDDYLAMLRRRIKVILIPALVAPLAGFLVSYFF |
| Ga0210391_106408251 | 3300021433 | Soil | MENREFTMDDYLAMLRRRIKVILIPALVAPLAGFLISYF |
| Ga0210391_112947362 | 3300021433 | Soil | MENRELTMDDYLAMLRRRMKVILIPALLAPLAGFL |
| Ga0210390_100723311 | 3300021474 | Soil | MIENRVLSMDDYLVMLRRRLKIILIPVLLAGLVGFLISYAFPPR |
| Ga0210390_102404462 | 3300021474 | Soil | VIENRELSMDDYLAMLRRRLTMILIPALAAPLAGFLISYAFA |
| Ga0210398_106392902 | 3300021477 | Soil | MQNRELTMDDYLAMFRRRMKVILVPTLLATLAGFLVSYGFSPKYKSQSLV |
| Ga0210402_105347063 | 3300021478 | Soil | MIENRELTMDDYLAMLRRRALVIAIPALVAPLAGFLI |
| Ga0210402_116644572 | 3300021478 | Soil | MADTQLTMDDYLAMVRRRLKVVIVPILIAPIAGFLVSYGFTPVYKSTSEVLVE |
| Ga0210409_101299063 | 3300021559 | Soil | MIENRELSMDDYLAMLRRRLKVILIPALVAPLAGFLISYAFAPRY |
| Ga0126371_103308923 | 3300021560 | Tropical Forest Soil | MIDNRDLTIDDYLAMLRRRVKLILIPTLLAPIAGFLISW |
| Ga0126371_106347782 | 3300021560 | Tropical Forest Soil | MIQNRELTMDDYLAIVRRRLKVVLVPLLIAPLAGYLVSH |
| Ga0126371_138135902 | 3300021560 | Tropical Forest Soil | MIANRELTIDDYGAMLRRRAKVLLIPALLAPLAGFLVSYLFAAKYTSQS |
| Ga0213853_108214721 | 3300021861 | Watersheds | MVNSMIENRELTMDDYLAMVRRRLKVILIPALLAPLAG |
| Ga0212123_105704281 | 3300022557 | Iron-Sulfur Acid Spring | MIENRELSVDDYLAMLRRRLKVILIPALLAALAGFLISYA |
| Ga0242654_100457211 | 3300022726 | Soil | MITNRELTMQDYAAMLRRRAMVILIPALLAPLAGF |
| Ga0224551_10047471 | 3300023259 | Soil | MSENRELTMDDYLAMLRRRLGVILIPALLAPITGFGV |
| Ga0224556_10723562 | 3300024295 | Soil | MENRELTMDDYLAMLRRRMKVILIPVLLAPLAGFLVSYVFSAKYTS |
| Ga0208936_10139913 | 3300025404 | Peatland | MITNRELAIEDYLAIARRRLTWVLIPALAAPLLGFLISFALT |
| Ga0208935_10595381 | 3300025414 | Peatland | MGTEMMENRELTMDDYLAMLRRRLKVILIPALLAPLAGFAVSYVFP |
| Ga0208191_10390042 | 3300025496 | Peatland | MMENRELTMDDYLAMLRRRIKVILIPALLAPLAGFLVSYLFSP |
| Ga0208191_10752091 | 3300025496 | Peatland | MENRELTLDDYLAMLRRRMKVILIPALLAPLAGFLV |
| Ga0208219_11006331 | 3300025625 | Arctic Peat Soil | MIANRELSLDDYLAMLRRRLKLILIPALLAPIAGFLVSY |
| Ga0207646_118354222 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MIENRELTMDDYLAMLRRRLKVILLPALLAPLAGFLISF |
| Ga0207694_118649832 | 3300025924 | Corn Rhizosphere | MGTNMIENRVLTMDDYGAMLRRRLKIIVIPTLLAPI |
| Ga0207700_108471681 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MIENRVLTMDDYGAMLRRRLKVILIPTLLAPLAGFLISYAF |
| Ga0207664_101908053 | 3300025929 | Agricultural Soil | MIENRVLTMDDYAAMLRRRLKIILIPTLLAPLVGFLISYAF |
| Ga0207689_102522521 | 3300025942 | Miscanthus Rhizosphere | MIENRELSMDDYLAMLRRRLKVILIPALLAPLVGFLISYAFPAK |
| Ga0207667_108618972 | 3300025949 | Corn Rhizosphere | MIENRELTMDDYLAMLRRRLKIILIPALLAPLVGFA |
| Ga0207658_108314472 | 3300025986 | Switchgrass Rhizosphere | MIENRELSMDDYLAMLRRRLKVILIPALLAPLVGFLISYAFPA |
| Ga0207658_114573062 | 3300025986 | Switchgrass Rhizosphere | MIQNREMTVDDYLAMLRRRLWVILLPTVLAPAVGFGVSYAFTP |
| Ga0209871_10442851 | 3300026217 | Permafrost Soil | MTQNRELTMDDYLAMLRRRAKVILIPALLAPLVGFLVSYAFAPK |
| Ga0209055_10714872 | 3300026309 | Soil | MGRPERNIGMIENRELTIDDYLAMLRRRVKVILIPALLAPVAGFLISY |
| Ga0209471_12380011 | 3300026318 | Soil | MGNGMIENRELSMDDYLAMLRRRLKVILIPALLAPL |
| Ga0209158_10721071 | 3300026333 | Soil | MGRPERNIGMIENRELTIDDYLAMLRRRVKVILIPALLAPVAG |
| Ga0209377_13227252 | 3300026334 | Soil | MIENRDLTLDDYLAMFRRRLKLILIPALLAPLVGFLISYAFTA |
| Ga0257176_10903972 | 3300026361 | Soil | MSENRELTMDDYLAMLRRRLKVILIPALLAPLAGYMVSYV |
| Ga0257172_10596922 | 3300026482 | Soil | MIENRELTMDDYLAMLRRRLKLILIPVLLAPLAGWLISYAFPAKYTSQAL |
| Ga0255350_10177443 | 3300026502 | Soil | MADRELTMEDYLAMAKRRLRVVLIPALVAPLGGFLASRILPPRYTT |
| Ga0257158_10873241 | 3300026515 | Soil | MSENRELTMDDYLAMLRRRLKVILIPALLSPLAGFMVSYVFSPKY |
| Ga0209805_13290591 | 3300026542 | Soil | MIENRELTIDDYLAMLRRRLKVILIPALLAPLAGFLISFAFAPK |
| Ga0209648_101457061 | 3300026551 | Grasslands Soil | MENRELTMDDYLAMFRRRMRVILIPALLAPLAGFLVSYAF |
| Ga0179587_107862501 | 3300026557 | Vadose Zone Soil | MSENRELTMDDYLAMLRRRLKVILIPALLAPLAGFMVSYVFPPPY |
| Ga0208732_10247871 | 3300026984 | Forest Soil | MQDYMAMLRRRATIILIPALLAPLAGFLISYAFPAKYTSQS |
| Ga0208730_10132232 | 3300027047 | Forest Soil | MIENRDLTLDDYLAMFRRRLKMILIPALLAPLVGFLIS |
| Ga0208994_10443052 | 3300027164 | Forest Soil | MIANREYTIDDYKVMLRRRLKMILIPALLAPLPAFLV |
| Ga0209219_11723651 | 3300027565 | Forest Soil | MIENRELTMDDYLAMLRRRAKWILIPALLAPLAGWLISYAFPAKYTSQ |
| Ga0209525_10377911 | 3300027575 | Forest Soil | MIENRELTMDDYLAMLRRRAKVILIPALLAPLAAWMASYAFPAK |
| Ga0209220_11056571 | 3300027587 | Forest Soil | MSENRELTMDDYLAMLRRRLKVILIPALLSPLAGFLVSYVFPP |
| Ga0209221_10671601 | 3300027609 | Forest Soil | MMQNRELSMDDYLAMLRRRLKIILIPALLAPLAGFAVSYFFAAKYT |
| Ga0209422_10776181 | 3300027629 | Forest Soil | MSENRELTMDDYLAMLRRRLKVILVPLLLAPLGGFAISYLFSP |
| Ga0209333_11413041 | 3300027676 | Forest Soil | MMENRELTMDDYLAMLRRRIRVILIPALLAPLAGFGISYVFSAKYTS |
| Ga0209011_11715562 | 3300027678 | Forest Soil | MIENRELTVDDYLAMLRRRLKVILIPALLAPLAGFLISFA |
| Ga0209328_101214382 | 3300027727 | Forest Soil | MIANRELTMDDYLAMLRRRAKWILIPALLAPLAGW |
| Ga0209248_100509241 | 3300027729 | Bog Forest Soil | MIENRELSMDDYLAMLRRRLKIILIPALLAPLAGLLI |
| Ga0209248_101336122 | 3300027729 | Bog Forest Soil | MIENRELSVDDYLAMLRRRLKVILIPALLAALAGFLISYAF |
| Ga0209908_102308582 | 3300027745 | Thawing Permafrost | MENRELTMDDYLAMFRRRAKLILIPALLAPLAGFGVSYFFPCLLYTSR |
| Ga0209772_102952912 | 3300027768 | Bog Forest Soil | MIQNRELTMDDYLAMLRRRLLVILLPVLLAPVAGYLLSYAFTPRFTSQSLILVE |
| Ga0209656_104601151 | 3300027812 | Bog Forest Soil | MIANRELSIDDYLAMLRRRAKVILIPALLAPLAGWMVSYAF |
| Ga0209773_104224341 | 3300027829 | Bog Forest Soil | MVNRMSENRELNMDDYLAMLRRRIKVILIPALLAPLA |
| Ga0209274_100606103 | 3300027853 | Soil | MANRELTMDDYLAMLRRRLKVILVPALVAPLTGFLVSYALPAR |
| Ga0209517_103964261 | 3300027854 | Peatlands Soil | MIENRELTMDDYLAMLRRRAKVILIPALLAPLAGWLLSYAFTP |
| Ga0209465_103605051 | 3300027874 | Tropical Forest Soil | MIANRELTMDDYAAMLRRRAKVLLIPALLAPLAGFLVSYVFPAKYTSQ |
| Ga0209283_102999221 | 3300027875 | Vadose Zone Soil | MGRPERNIGMIENRELTIDDYLAMLRRRVKVILIPALLAPVAGFL |
| Ga0209068_101137442 | 3300027894 | Watersheds | MIENRDLTIDDYLAMLQRRLKLILIPTLLAPLAGFLISYAFTAKY |
| Ga0209624_105391612 | 3300027895 | Forest Soil | MIENRDLNMDDYLAMLRRRMKVILIPTLLAPLAGFLISYAFAPKYT |
| Ga0209415_100150581 | 3300027905 | Peatlands Soil | MIANRELGIDDYLAMLRRRAKVILIPALLAPLAGWMVSYAFSAK |
| Ga0209583_103650571 | 3300027910 | Watersheds | MIENRELSMDDYLAVVRRHKRMILIPLLAGPILGFLVSFTFRPK |
| Ga0209698_101479551 | 3300027911 | Watersheds | MITNREMTMQDYTAMFRRRALIILIPALLAPLAGFLISYAFPAKYT |
| Ga0209698_111830912 | 3300027911 | Watersheds | MIENRELGMDDYLAMLRRRAKMILIPALLAPLAGFLVSYAFPAKYTS |
| Ga0209069_106252742 | 3300027915 | Watersheds | MVKSMIENRELTMDDYLAMVRRRLKVILIPALLAPLAGFLVSYG |
| Ga0302168_10529421 | 3300028639 | Fen | MIENRELTMDDYLAMVKRRLKVILIPALLAPLAGYLVSYGFSPKYTS |
| Ga0302294_101561901 | 3300028740 | Fen | MERELTMDDYLAILRRRLKVILVPMLAAAVAGFVV |
| Ga0302156_102785951 | 3300028748 | Bog | MENRELTIDDYLAMLRRRAKLIVIPMLLAPIAGYLVSY |
| Ga0302231_101967061 | 3300028775 | Palsa | MGNRELTLDDYLAMLRRRMKVILIPALLAPLAGFLISYVFS |
| Ga0302290_100490822 | 3300028777 | Fen | MIENRELTMDDYLAMVKRRLKVILIPALLAPDRKS |
| Ga0302201_102099862 | 3300028785 | Bog | MENRELTIDDYLAMLRRRAKLIVIPMLLAPIAGYLVSYIFHAKYTSQSLLLME |
| Ga0302232_102122872 | 3300028789 | Palsa | MIENRELSIDDYLAMLRRRAKVILIPALLAPLAGWMV |
| Ga0265338_105145212 | 3300028800 | Rhizosphere | MSDTRELTMEDYLAMVRRRLKVILIPLLMAPVAGFLVSYAF |
| Ga0302199_11041331 | 3300028860 | Bog | MENRELTIDDYLAMLRRRAKLIVIPMLLAPIAGYLVSYIFHAKYTSQSL |
| Ga0302218_101558761 | 3300028863 | Palsa | MENRELTMDDYLAMLRRRIKVILLPVLLAPLAGFLVSYAFPPKFTS |
| Ga0302278_100815951 | 3300028866 | Bog | MENRELTIDDYLAMLRRRAKLIVIPMLLAPIAGYLVSYIFHAKYTSQSLLLMEAP |
| Ga0308309_100008471 | 3300028906 | Soil | MIENRDLTLDDYLAMLRRRVKLILFPALLAPLVGFLISYAFTARYTS |
| Ga0222749_100109265 | 3300029636 | Soil | MENRELGMDDYLAMFRRRMKVILIPALLAPLAGFLVSYVFPAKY |
| Ga0222749_100417443 | 3300029636 | Soil | MIENRELSIDDYLAMLRRRAKVLLIPAFIAPLVGFLVSYAFSPKYTSQA |
| Ga0311368_105165082 | 3300029882 | Palsa | MSENRELTMDDYLAMLKRRLRVILIPALLAPITGFGISYVFSPKYTSQ |
| Ga0311328_103198102 | 3300029939 | Bog | MAIRELTMDDYLAMVRRRIKVILIPALLGPLAGFAVSYFFAAKYTS |
| Ga0311330_104028872 | 3300029945 | Bog | MENRELTIDDYLAMLRRRIKVILIPALLAPLAGFLVSYVFSA |
| Ga0311336_101749603 | 3300029990 | Fen | MVNSMIENRELSMDDYLAMVRRRLKIILIPALLAPLAGYL |
| Ga0302270_103499642 | 3300030011 | Bog | MENRELTIDDYLAMLRRRIKVILIPALLAPLAGFLVSYVFSAKYTSQSEVL |
| Ga0302177_107054172 | 3300030053 | Palsa | MIQNREMKMDDYLAMLRRRAKIILIPALFALPAGFLVSYRFQPKFTS |
| Ga0302179_102239162 | 3300030058 | Palsa | MMEERELTMDDYLAMLRRRIKVILTPALLAPLAGFLVSYAFPAKYTSKSLVL |
| Ga0302179_104022271 | 3300030058 | Palsa | MENRELTMDDYLAMLRRRIKVILMPLLLAPLAGFLVSYAFAPKF |
| Ga0311372_126537422 | 3300030520 | Palsa | MSENRELTMDDYLAMLKRRLRVILIPALLAPITGFGISYVFSPKYTSQS |
| Ga0311354_104665692 | 3300030618 | Palsa | MSDRELTMDDYLAMLRRRLKVILIPTLIAPLTGFLVSYARPSRYQTQSTVLVE |
| Ga0265459_142952031 | 3300030741 | Soil | MENRELTMDDYLAMARRRMKMILIPALLAPLAGFA |
| Ga0075387_114414342 | 3300030850 | Soil | MSENRELTMDDYLAMLRRRLKVILIPTLLATTTSSSC |
| Ga0138301_10712362 | 3300031022 | Soil | METRELTMDDYLAMFRRRIKVILIPALLAPLAGFLVSYAFSPKYTS |
| Ga0170823_125860761 | 3300031128 | Forest Soil | MQNRELTMDDYLAMLRRRLKVILIPALVAPLAGFLISYV |
| Ga0170824_1004984381 | 3300031231 | Forest Soil | MTETRELTMDDYLAMLRRRLKVILIPTLLAPLVGFAVSYA |
| Ga0170824_1201965453 | 3300031231 | Forest Soil | MIQNRELTMDDYLAMLRRRLKVILIPALLAPLAGFVVSFA |
| Ga0302307_102301012 | 3300031233 | Palsa | MIQNREMKMDDYLAMLRRRAKIILIPALFALPAGFLVSYRFQ |
| Ga0302325_101804654 | 3300031234 | Palsa | MSENRELTMDDYLAMLRRRLKVILIPALLAPLAGFLVSYAFP |
| Ga0302324_1001087641 | 3300031236 | Palsa | MMEERELTMDDYLAMLRRRIKVILTPALLAPLAGFLVS |
| Ga0302324_1005596641 | 3300031236 | Palsa | MEERELTMDDYLAMLRRRIKVILTPALLAPLAGFLVS |
| Ga0265339_100659683 | 3300031249 | Rhizosphere | MIENRELTMDDYLAMLRRRAKVILIPALLAPLVGYVVSL |
| Ga0302326_109169791 | 3300031525 | Palsa | MIGKRELGMDDYLAMLRRRAKVILIPALLAPLAGWLTSYAFTP |
| Ga0318574_107637471 | 3300031680 | Soil | MMENRDLTLDDYLAMLRRRSKLILIPALLAPLVGFLISYAFT |
| Ga0310686_1145432032 | 3300031708 | Soil | YLAMLRRRVKVILIPELLAPLAGYSVSYIFPAKYTSTSEVLV |
| Ga0310686_1197150982 | 3300031708 | Soil | MMENRELTMDDYLAMLRRRMKVILIPALLAPLAGFLVSYA |
| Ga0307474_105619411 | 3300031718 | Hardwood Forest Soil | MIENRELSMDDYLAMLRRRLKVILIPALAAPLAGFLISYAFAPRYTSQSLI |
| Ga0306917_104471301 | 3300031719 | Soil | MMENRQLTVDDYLAMFRRRIKMILIPTLLAPLVGFGAS |
| Ga0306917_115189341 | 3300031719 | Soil | MLRRRAKIILVPALLAPLAGYLVSYGFPAKFTSQSVVLVEG |
| Ga0307475_101760393 | 3300031754 | Hardwood Forest Soil | MIENRDLTLDDYLAMSRRRFKLILIPALLAPLVGFLISYAFTA |
| Ga0307475_104306671 | 3300031754 | Hardwood Forest Soil | MSENRELTMDDYLAMLRRRLKVILIPALLAPLAGYGVSYAFSPKFTSQSTV |
| Ga0307475_105266632 | 3300031754 | Hardwood Forest Soil | MIQNRELTMDDYLAMLRRRATIILLPALVAPLIGFLVSYAFAPKYTSQAL |
| Ga0307475_112328812 | 3300031754 | Hardwood Forest Soil | MENRELTIDDYLAMLRRRMKVILIPALLAPLAGFLVSYVFPA |
| Ga0318509_102039322 | 3300031768 | Soil | MMENRDLTLDDYLAMLRRRSKLILIPALLAPLVGFLISYAFTPKY |
| Ga0307473_1000023611 | 3300031820 | Hardwood Forest Soil | MIENRDLTLDDYLAMFRRRLKMILIPALLAPLVGFLISYALT |
| Ga0307473_107461021 | 3300031820 | Hardwood Forest Soil | MIQNRELSMDDYLAMLRRRLKVLLIPALVAPLVGFLVSFAFSPKYT |
| Ga0307473_108604051 | 3300031820 | Hardwood Forest Soil | MIDNRDLTLDDYLAILRRRWKLILIPTLLAPLVGFLISYALTP |
| Ga0307478_102282102 | 3300031823 | Hardwood Forest Soil | MENREFTMDDYLAMLRRRIKVILIPALVAPLAGFLVSYFFAAKY |
| Ga0307478_103714781 | 3300031823 | Hardwood Forest Soil | MENRELTMDDYLAMLRRRMKVILIPALLAPLAGFLVSYAFPPKFTSQS |
| Ga0306919_114265981 | 3300031879 | Soil | MMENRQLTVDDYLAMFRRRIKMILIPTLLAPLVGFGASYLFQPKYTSR |
| Ga0306923_107444181 | 3300031910 | Soil | MIQGRELTLDDFLVLIKRRMKTALLPAVLAPLAGFLVSYGFPAKYTSQ |
| Ga0306921_127208191 | 3300031912 | Soil | MIENRDLGMDDYLAMLRRRLMVILIPVLLAPLAGFLVSFAFAPRYTSQ |
| Ga0310910_107336582 | 3300031946 | Soil | MITSRELTMQDYAAMFRRRAKIILIPALLAPLVGYLISY |
| Ga0318545_101159692 | 3300032042 | Soil | MMENRDLTLDDYLAMLRRRSKLILIPALLAPLVGFLISY |
| Ga0307471_1003650992 | 3300032180 | Hardwood Forest Soil | MITNRELTMQDYTAMLGRRAKIILIPALLAPLAGYLISYAFPA |
| Ga0307472_10000085711 | 3300032205 | Hardwood Forest Soil | MIENRDLTLDDYLAMFRRRLKMILIPALLAPLVGF |
| Ga0307472_1006355381 | 3300032205 | Hardwood Forest Soil | MIENRDLTLDDYLAMLRRRMKMILIPALLAPLVGFLISYFFTA |
| Ga0307472_1021812882 | 3300032205 | Hardwood Forest Soil | MIENRELTMDDYLAMLRRRAKWILIPALLAPLAGWLISY |
| Ga0335079_112555112 | 3300032783 | Soil | MIGNRELSMDDYLGMLRRRLKVILLPALLAPLVGYLVSFAFSPKY |
| Ga0335080_100624621 | 3300032828 | Soil | MVKNMIENRDLTMDDYLAMVRRRLKVILIPALLAPLA |
| Ga0335070_1001080712 | 3300032829 | Soil | MIENRELSMDDYLAMIRRRLVVILIPALLAPLAGYMVSY |
| Ga0335069_102383781 | 3300032893 | Soil | MIEGRELGFDDYLAIARRRAKVILIPALLAPVIGYAISFAFSPKYTS |
| Ga0335083_105115381 | 3300032954 | Soil | MIEYRELTMDDYLAMLRRRARVILAPAVLAPLAGFLLSFGFAAKYTSQSLILVEGQK |
| Ga0335083_105580421 | 3300032954 | Soil | MIMNREMTMDDYAAMLRRRAWFILIPALFAPLVGFLISYAFPAKYTSRSLV |
| Ga0335077_106961632 | 3300033158 | Soil | MIENRELTMDDYLAMLRRRGKVILIPALLAPIVGFLISYAFT |
| Ga0316212_10418672 | 3300033547 | Roots | MIQNRELTMDDYLAMLRRRLKVIVVPALFAPLVGFMVSYTFTPKWTS |
| Ga0371487_0217978_759_899 | 3300033982 | Peat Soil | MSDRELTMDDYLAMLLRRLRVILIPALMAPLAGFLVSYVFPPKYTSQ |
| Ga0326724_0475220_2_142 | 3300034091 | Peat Soil | MSENRELTMDDYLAMLRRRLKVILIPVLFAPLAGFLVSYAFPPKFTS |
| ⦗Top⦘ |