| Basic Information | |
|---|---|
| Family ID | F011316 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 292 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MAEAALSATETALENQRIGGLQIRVAALCTLIQICDGYDI |
| Number of Associated Samples | 202 |
| Number of Associated Scaffolds | 292 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.97 % |
| % of genes near scaffold ends (potentially truncated) | 97.60 % |
| % of genes from short scaffolds (< 2000 bps) | 92.81 % |
| Associated GOLD sequencing projects | 185 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.342 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (29.452 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.959 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.370 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.76% β-sheet: 0.00% Coil/Unstructured: 63.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 292 Family Scaffolds |
|---|---|---|
| PF14696 | Glyoxalase_5 | 13.70 |
| PF01168 | Ala_racemase_N | 10.96 |
| PF07690 | MFS_1 | 9.25 |
| PF01144 | CoA_trans | 6.16 |
| PF11794 | HpaB_N | 2.05 |
| PF01565 | FAD_binding_4 | 1.71 |
| PF00903 | Glyoxalase | 1.37 |
| PF03972 | MmgE_PrpD | 1.37 |
| PF01966 | HD | 1.03 |
| PF00083 | Sugar_tr | 1.03 |
| PF13520 | AA_permease_2 | 1.03 |
| PF14534 | DUF4440 | 1.03 |
| PF00296 | Bac_luciferase | 1.03 |
| PF00528 | BPD_transp_1 | 1.03 |
| PF02604 | PhdYeFM_antitox | 1.03 |
| PF14031 | D-ser_dehydrat | 0.68 |
| PF03466 | LysR_substrate | 0.68 |
| PF07171 | MlrC_C | 0.68 |
| PF00583 | Acetyltransf_1 | 0.68 |
| PF01724 | DUF29 | 0.68 |
| PF00106 | adh_short | 0.68 |
| PF01609 | DDE_Tnp_1 | 0.34 |
| PF13378 | MR_MLE_C | 0.34 |
| PF02233 | PNTB | 0.34 |
| PF13360 | PQQ_2 | 0.34 |
| PF00211 | Guanylate_cyc | 0.34 |
| PF00378 | ECH_1 | 0.34 |
| PF00005 | ABC_tran | 0.34 |
| PF03069 | FmdA_AmdA | 0.34 |
| PF00355 | Rieske | 0.34 |
| PF04909 | Amidohydro_2 | 0.34 |
| PF00990 | GGDEF | 0.34 |
| PF11716 | MDMPI_N | 0.34 |
| PF07883 | Cupin_2 | 0.34 |
| PF13773 | DUF4170 | 0.34 |
| PF01047 | MarR | 0.34 |
| PF01494 | FAD_binding_3 | 0.34 |
| PF04226 | Transgly_assoc | 0.34 |
| PF12796 | Ank_2 | 0.34 |
| PF01593 | Amino_oxidase | 0.34 |
| PF01220 | DHquinase_II | 0.34 |
| PF04542 | Sigma70_r2 | 0.34 |
| PF01641 | SelR | 0.34 |
| PF03922 | OmpW | 0.34 |
| PF03551 | PadR | 0.34 |
| PF01436 | NHL | 0.34 |
| PF04392 | ABC_sub_bind | 0.34 |
| PF13458 | Peripla_BP_6 | 0.34 |
| PF00501 | AMP-binding | 0.34 |
| PF00294 | PfkB | 0.34 |
| PF13356 | Arm-DNA-bind_3 | 0.34 |
| COG ID | Name | Functional Category | % Frequency in 292 Family Scaffolds |
|---|---|---|---|
| COG4670 | Acyl CoA:acetate/3-ketoacid CoA transferase | Lipid transport and metabolism [I] | 6.16 |
| COG2057 | Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit | Lipid transport and metabolism [I] | 6.16 |
| COG1788 | Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit | Lipid transport and metabolism [I] | 6.16 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 1.37 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 1.03 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.03 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 1.03 |
| COG5476 | Microcystin degradation protein MlrC, contains DUF1485 domain | General function prediction only [R] | 0.68 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.68 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.34 |
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.34 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.34 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.34 |
| COG3047 | Outer membrane protein OmpW | Cell wall/membrane/envelope biogenesis [M] | 0.34 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.34 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.34 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.34 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.34 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.34 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.34 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.34 |
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.34 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.34 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.34 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.34 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.34 |
| COG1282 | NAD/NADP transhydrogenase beta subunit | Energy production and conversion [C] | 0.34 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.34 |
| COG0757 | 3-dehydroquinate dehydratase | Amino acid transport and metabolism [E] | 0.34 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.34 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.34 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.34 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.34 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.34 % |
| Unclassified | root | N/A | 24.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2032320005|FACEOR_FY84VJD01D1O10 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100038230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4303 | Open in IMG/M |
| 3300003223|JGI26343J46809_1016519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 577 | Open in IMG/M |
| 3300003351|JGI26346J50198_1018425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 680 | Open in IMG/M |
| 3300004080|Ga0062385_10556243 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 718 | Open in IMG/M |
| 3300004080|Ga0062385_11022641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300004081|Ga0063454_100213871 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300004081|Ga0063454_101232504 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 621 | Open in IMG/M |
| 3300004082|Ga0062384_100701642 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 697 | Open in IMG/M |
| 3300004082|Ga0062384_101119180 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
| 3300004091|Ga0062387_100245150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1116 | Open in IMG/M |
| 3300004091|Ga0062387_100728571 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 730 | Open in IMG/M |
| 3300004092|Ga0062389_101054589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Lichenicola → Lichenicola cladoniae | 998 | Open in IMG/M |
| 3300004114|Ga0062593_101122086 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 818 | Open in IMG/M |
| 3300004635|Ga0062388_101890859 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 615 | Open in IMG/M |
| 3300004635|Ga0062388_102916099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300005177|Ga0066690_11073175 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 502 | Open in IMG/M |
| 3300005331|Ga0070670_101936777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 543 | Open in IMG/M |
| 3300005332|Ga0066388_101378339 | Not Available | 1223 | Open in IMG/M |
| 3300005332|Ga0066388_103376940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 815 | Open in IMG/M |
| 3300005338|Ga0068868_100228913 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1559 | Open in IMG/M |
| 3300005530|Ga0070679_102026980 | Not Available | 525 | Open in IMG/M |
| 3300005534|Ga0070735_10508172 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 718 | Open in IMG/M |
| 3300005535|Ga0070684_101518441 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300005560|Ga0066670_10940151 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
| 3300005563|Ga0068855_102501505 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300005610|Ga0070763_10398984 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 773 | Open in IMG/M |
| 3300005764|Ga0066903_101833626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1160 | Open in IMG/M |
| 3300006028|Ga0070717_10803652 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300006028|Ga0070717_11602493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 590 | Open in IMG/M |
| 3300006028|Ga0070717_11897600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300006028|Ga0070717_12149774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300006031|Ga0066651_10841482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300006032|Ga0066696_10073567 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1987 | Open in IMG/M |
| 3300006032|Ga0066696_10264099 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1114 | Open in IMG/M |
| 3300006052|Ga0075029_100831253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 630 | Open in IMG/M |
| 3300006059|Ga0075017_100768970 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300006059|Ga0075017_101656841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300006175|Ga0070712_101638715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. USMB20 | 563 | Open in IMG/M |
| 3300006176|Ga0070765_100824324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 877 | Open in IMG/M |
| 3300006237|Ga0097621_100911816 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 819 | Open in IMG/M |
| 3300006797|Ga0066659_10525234 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 952 | Open in IMG/M |
| 3300006797|Ga0066659_10722324 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 816 | Open in IMG/M |
| 3300006797|Ga0066659_11534617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300006800|Ga0066660_11185171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 600 | Open in IMG/M |
| 3300006847|Ga0075431_101997510 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300006871|Ga0075434_100260428 | Not Available | 1753 | Open in IMG/M |
| 3300006871|Ga0075434_102358174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 535 | Open in IMG/M |
| 3300009012|Ga0066710_103259587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 621 | Open in IMG/M |
| 3300009553|Ga0105249_11748273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 694 | Open in IMG/M |
| 3300009553|Ga0105249_13107754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 533 | Open in IMG/M |
| 3300009792|Ga0126374_10126650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1504 | Open in IMG/M |
| 3300009792|Ga0126374_10772550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 731 | Open in IMG/M |
| 3300009792|Ga0126374_10910158 | Not Available | 682 | Open in IMG/M |
| 3300010045|Ga0126311_11279835 | Not Available | 609 | Open in IMG/M |
| 3300010048|Ga0126373_10898531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 950 | Open in IMG/M |
| 3300010048|Ga0126373_11549001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 728 | Open in IMG/M |
| 3300010048|Ga0126373_11658912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 704 | Open in IMG/M |
| 3300010048|Ga0126373_11674232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 700 | Open in IMG/M |
| 3300010339|Ga0074046_10855125 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
| 3300010358|Ga0126370_10172944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1602 | Open in IMG/M |
| 3300010358|Ga0126370_11531218 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300010360|Ga0126372_12602575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300010361|Ga0126378_10897797 | Not Available | 993 | Open in IMG/M |
| 3300010361|Ga0126378_11424183 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 785 | Open in IMG/M |
| 3300010361|Ga0126378_11579005 | Not Available | 745 | Open in IMG/M |
| 3300010366|Ga0126379_10550795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1233 | Open in IMG/M |
| 3300010366|Ga0126379_11495109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 781 | Open in IMG/M |
| 3300010366|Ga0126379_11495118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 781 | Open in IMG/M |
| 3300010376|Ga0126381_101665723 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 921 | Open in IMG/M |
| 3300010376|Ga0126381_101852891 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300010376|Ga0126381_102641424 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 718 | Open in IMG/M |
| 3300010376|Ga0126381_103589150 | Not Available | 608 | Open in IMG/M |
| 3300010376|Ga0126381_105049694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300010379|Ga0136449_100212741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3653 | Open in IMG/M |
| 3300010379|Ga0136449_103733547 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 574 | Open in IMG/M |
| 3300010379|Ga0136449_103977694 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300010398|Ga0126383_10591310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1180 | Open in IMG/M |
| 3300012176|Ga0153952_1108352 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 609 | Open in IMG/M |
| 3300012202|Ga0137363_11535305 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300012212|Ga0150985_101267608 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1001 | Open in IMG/M |
| 3300012350|Ga0137372_10883678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 635 | Open in IMG/M |
| 3300012683|Ga0137398_10735407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 687 | Open in IMG/M |
| 3300012923|Ga0137359_11111044 | Not Available | 676 | Open in IMG/M |
| 3300012925|Ga0137419_10106806 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1949 | Open in IMG/M |
| 3300012951|Ga0164300_10703872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia | 612 | Open in IMG/M |
| 3300012971|Ga0126369_10162343 | Not Available | 2115 | Open in IMG/M |
| 3300012971|Ga0126369_12454652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300013764|Ga0120111_1036953 | Not Available | 1276 | Open in IMG/M |
| 3300014159|Ga0181530_10366324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 740 | Open in IMG/M |
| 3300014168|Ga0181534_10574286 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 646 | Open in IMG/M |
| 3300014200|Ga0181526_10159365 | Not Available | 1447 | Open in IMG/M |
| 3300014325|Ga0163163_11243379 | Not Available | 807 | Open in IMG/M |
| 3300014489|Ga0182018_10373315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 766 | Open in IMG/M |
| 3300014495|Ga0182015_10586624 | Not Available | 708 | Open in IMG/M |
| 3300014501|Ga0182024_10084004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4728 | Open in IMG/M |
| 3300014654|Ga0181525_10432860 | Not Available | 724 | Open in IMG/M |
| 3300014968|Ga0157379_12055276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Uphvl-Ar1 | 565 | Open in IMG/M |
| 3300015051|Ga0137414_1144871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300015264|Ga0137403_10415935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1223 | Open in IMG/M |
| 3300015372|Ga0132256_101914113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 700 | Open in IMG/M |
| 3300015373|Ga0132257_102782261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 637 | Open in IMG/M |
| 3300016270|Ga0182036_10935274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 712 | Open in IMG/M |
| 3300016294|Ga0182041_10108189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2060 | Open in IMG/M |
| 3300016319|Ga0182033_11319975 | Not Available | 648 | Open in IMG/M |
| 3300016319|Ga0182033_11416201 | Not Available | 626 | Open in IMG/M |
| 3300016341|Ga0182035_10447467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 1094 | Open in IMG/M |
| 3300016341|Ga0182035_10447695 | Not Available | 1094 | Open in IMG/M |
| 3300016341|Ga0182035_11506071 | Not Available | 605 | Open in IMG/M |
| 3300016357|Ga0182032_11217317 | Not Available | 648 | Open in IMG/M |
| 3300016357|Ga0182032_11861581 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300016371|Ga0182034_11268848 | Not Available | 642 | Open in IMG/M |
| 3300016371|Ga0182034_11292277 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 636 | Open in IMG/M |
| 3300016371|Ga0182034_11335309 | Not Available | 626 | Open in IMG/M |
| 3300016371|Ga0182034_11919381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300016371|Ga0182034_12025462 | Not Available | 509 | Open in IMG/M |
| 3300016387|Ga0182040_11077175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 672 | Open in IMG/M |
| 3300016404|Ga0182037_10610156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 927 | Open in IMG/M |
| 3300016404|Ga0182037_10958522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 744 | Open in IMG/M |
| 3300016404|Ga0182037_12048303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300016422|Ga0182039_10773767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 851 | Open in IMG/M |
| 3300016445|Ga0182038_11216414 | Not Available | 672 | Open in IMG/M |
| 3300016445|Ga0182038_11898007 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300017955|Ga0187817_10371065 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300017955|Ga0187817_10742247 | Not Available | 626 | Open in IMG/M |
| 3300017955|Ga0187817_10843514 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300017970|Ga0187783_10978693 | Not Available | 610 | Open in IMG/M |
| 3300017972|Ga0187781_10895523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 646 | Open in IMG/M |
| 3300017975|Ga0187782_11696001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 500 | Open in IMG/M |
| 3300018013|Ga0187873_1393795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
| 3300018034|Ga0187863_10390761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 775 | Open in IMG/M |
| 3300018042|Ga0187871_10423264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 736 | Open in IMG/M |
| 3300018062|Ga0187784_11449249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 544 | Open in IMG/M |
| 3300018090|Ga0187770_10444713 | Not Available | 1022 | Open in IMG/M |
| 3300020581|Ga0210399_10843811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 746 | Open in IMG/M |
| 3300021170|Ga0210400_10193045 | Not Available | 1653 | Open in IMG/M |
| 3300021170|Ga0210400_11487048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300021171|Ga0210405_10374720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1122 | Open in IMG/M |
| 3300021180|Ga0210396_10171156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1947 | Open in IMG/M |
| 3300021361|Ga0213872_10273561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 707 | Open in IMG/M |
| 3300021362|Ga0213882_10533788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300021384|Ga0213876_10670522 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300021401|Ga0210393_10836397 | Not Available | 748 | Open in IMG/M |
| 3300021403|Ga0210397_10926780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 675 | Open in IMG/M |
| 3300021403|Ga0210397_11373394 | Not Available | 549 | Open in IMG/M |
| 3300021404|Ga0210389_10476852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 982 | Open in IMG/M |
| 3300021432|Ga0210384_11454803 | Not Available | 590 | Open in IMG/M |
| 3300021433|Ga0210391_10642656 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300021439|Ga0213879_10035194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1277 | Open in IMG/M |
| 3300021439|Ga0213879_10189695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 608 | Open in IMG/M |
| 3300021474|Ga0210390_11092098 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300021476|Ga0187846_10197041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 845 | Open in IMG/M |
| 3300021478|Ga0210402_11269509 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300021559|Ga0210409_10784815 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300021560|Ga0126371_10274847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1805 | Open in IMG/M |
| 3300021560|Ga0126371_11866500 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300021560|Ga0126371_12754133 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300024179|Ga0247695_1065514 | Not Available | 539 | Open in IMG/M |
| 3300024227|Ga0228598_1015730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1493 | Open in IMG/M |
| 3300025916|Ga0207663_10706571 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300025928|Ga0207700_11109636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 707 | Open in IMG/M |
| 3300025938|Ga0207704_11293046 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 623 | Open in IMG/M |
| 3300026023|Ga0207677_11316364 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 664 | Open in IMG/M |
| 3300026312|Ga0209153_1087591 | Not Available | 1155 | Open in IMG/M |
| 3300026523|Ga0209808_1219285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300026551|Ga0209648_10234947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1370 | Open in IMG/M |
| 3300027173|Ga0208097_1011823 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 955 | Open in IMG/M |
| 3300027727|Ga0209328_10187122 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 626 | Open in IMG/M |
| 3300027729|Ga0209248_10006866 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3599 | Open in IMG/M |
| 3300027783|Ga0209448_10011500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2845 | Open in IMG/M |
| 3300027812|Ga0209656_10047044 | All Organisms → cellular organisms → Bacteria | 2461 | Open in IMG/M |
| 3300027812|Ga0209656_10402419 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300027853|Ga0209274_10035129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2337 | Open in IMG/M |
| 3300027855|Ga0209693_10384515 | Not Available | 679 | Open in IMG/M |
| 3300027895|Ga0209624_10517152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 794 | Open in IMG/M |
| 3300027903|Ga0209488_11212276 | Not Available | 507 | Open in IMG/M |
| 3300027908|Ga0209006_11135545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 614 | Open in IMG/M |
| 3300027986|Ga0209168_10070652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1832 | Open in IMG/M |
| 3300028775|Ga0302231_10028020 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2428 | Open in IMG/M |
| 3300028906|Ga0308309_11200179 | Not Available | 654 | Open in IMG/M |
| 3300029636|Ga0222749_10310963 | Not Available | 817 | Open in IMG/M |
| 3300029636|Ga0222749_10735436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300029943|Ga0311340_11561830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300031234|Ga0302325_11000420 | Not Available | 1142 | Open in IMG/M |
| 3300031446|Ga0170820_10914669 | Not Available | 573 | Open in IMG/M |
| 3300031446|Ga0170820_11278060 | Not Available | 505 | Open in IMG/M |
| 3300031525|Ga0302326_12950687 | Not Available | 582 | Open in IMG/M |
| 3300031543|Ga0318516_10222657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1091 | Open in IMG/M |
| 3300031543|Ga0318516_10558058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300031543|Ga0318516_10765395 | Not Available | 546 | Open in IMG/M |
| 3300031544|Ga0318534_10274640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 971 | Open in IMG/M |
| 3300031544|Ga0318534_10459901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 729 | Open in IMG/M |
| 3300031544|Ga0318534_10605581 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 622 | Open in IMG/M |
| 3300031545|Ga0318541_10609204 | Not Available | 611 | Open in IMG/M |
| 3300031561|Ga0318528_10013756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3741 | Open in IMG/M |
| 3300031561|Ga0318528_10075993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1736 | Open in IMG/M |
| 3300031561|Ga0318528_10528341 | Not Available | 633 | Open in IMG/M |
| 3300031572|Ga0318515_10116818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1408 | Open in IMG/M |
| 3300031572|Ga0318515_10148854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1247 | Open in IMG/M |
| 3300031573|Ga0310915_10157274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1574 | Open in IMG/M |
| 3300031573|Ga0310915_10397997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 978 | Open in IMG/M |
| 3300031640|Ga0318555_10133597 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300031640|Ga0318555_10213308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1041 | Open in IMG/M |
| 3300031640|Ga0318555_10646108 | Not Available | 572 | Open in IMG/M |
| 3300031668|Ga0318542_10176442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1071 | Open in IMG/M |
| 3300031670|Ga0307374_10446724 | Not Available | 721 | Open in IMG/M |
| 3300031681|Ga0318572_10590496 | Not Available | 662 | Open in IMG/M |
| 3300031681|Ga0318572_10860288 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300031708|Ga0310686_108375051 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
| 3300031708|Ga0310686_119113618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300031715|Ga0307476_10947613 | Not Available | 635 | Open in IMG/M |
| 3300031715|Ga0307476_11159299 | Not Available | 566 | Open in IMG/M |
| 3300031718|Ga0307474_11544722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300031719|Ga0306917_11181000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 594 | Open in IMG/M |
| 3300031723|Ga0318493_10856097 | Not Available | 513 | Open in IMG/M |
| 3300031724|Ga0318500_10010449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3228 | Open in IMG/M |
| 3300031736|Ga0318501_10186395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1081 | Open in IMG/M |
| 3300031736|Ga0318501_10715137 | Not Available | 553 | Open in IMG/M |
| 3300031744|Ga0306918_10129540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1839 | Open in IMG/M |
| 3300031751|Ga0318494_10115399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1492 | Open in IMG/M |
| 3300031751|Ga0318494_10940439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300031765|Ga0318554_10362195 | Not Available | 824 | Open in IMG/M |
| 3300031769|Ga0318526_10446652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300031777|Ga0318543_10135573 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300031777|Ga0318543_10244851 | Not Available | 799 | Open in IMG/M |
| 3300031779|Ga0318566_10013923 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3425 | Open in IMG/M |
| 3300031779|Ga0318566_10240121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 899 | Open in IMG/M |
| 3300031779|Ga0318566_10448738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 633 | Open in IMG/M |
| 3300031781|Ga0318547_10492308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 757 | Open in IMG/M |
| 3300031781|Ga0318547_11069060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300031792|Ga0318529_10074669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1501 | Open in IMG/M |
| 3300031794|Ga0318503_10253789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300031805|Ga0318497_10645780 | Not Available | 593 | Open in IMG/M |
| 3300031823|Ga0307478_11138369 | Not Available | 651 | Open in IMG/M |
| 3300031831|Ga0318564_10324059 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 678 | Open in IMG/M |
| 3300031832|Ga0318499_10045075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1635 | Open in IMG/M |
| 3300031832|Ga0318499_10080695 | Not Available | 1246 | Open in IMG/M |
| 3300031833|Ga0310917_10013975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 4476 | Open in IMG/M |
| 3300031845|Ga0318511_10520691 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 551 | Open in IMG/M |
| 3300031846|Ga0318512_10357447 | Not Available | 731 | Open in IMG/M |
| 3300031880|Ga0318544_10069045 | Not Available | 1302 | Open in IMG/M |
| 3300031890|Ga0306925_10700106 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300031894|Ga0318522_10003133 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4357 | Open in IMG/M |
| 3300031894|Ga0318522_10217232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 724 | Open in IMG/M |
| 3300031896|Ga0318551_10024489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2855 | Open in IMG/M |
| 3300031896|Ga0318551_10080159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1708 | Open in IMG/M |
| 3300031912|Ga0306921_10217707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 2238 | Open in IMG/M |
| 3300031912|Ga0306921_10335634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1768 | Open in IMG/M |
| 3300031942|Ga0310916_10946539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 720 | Open in IMG/M |
| 3300031945|Ga0310913_10851692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 642 | Open in IMG/M |
| 3300031947|Ga0310909_10200552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → Magnetospirillum kuznetsovii | 1658 | Open in IMG/M |
| 3300031954|Ga0306926_10019429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 7776 | Open in IMG/M |
| 3300031954|Ga0306926_10944934 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1029 | Open in IMG/M |
| 3300031954|Ga0306926_11477267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 785 | Open in IMG/M |
| 3300031962|Ga0307479_11692483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300031962|Ga0307479_12146118 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
| 3300031996|Ga0308176_12765254 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
| 3300032001|Ga0306922_10246261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1921 | Open in IMG/M |
| 3300032001|Ga0306922_11099595 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 815 | Open in IMG/M |
| 3300032008|Ga0318562_10361541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 844 | Open in IMG/M |
| 3300032009|Ga0318563_10579780 | Not Available | 605 | Open in IMG/M |
| 3300032010|Ga0318569_10339495 | Not Available | 700 | Open in IMG/M |
| 3300032025|Ga0318507_10090668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1265 | Open in IMG/M |
| 3300032025|Ga0318507_10154742 | Not Available | 981 | Open in IMG/M |
| 3300032039|Ga0318559_10054390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1685 | Open in IMG/M |
| 3300032044|Ga0318558_10459261 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 635 | Open in IMG/M |
| 3300032055|Ga0318575_10382232 | Not Available | 714 | Open in IMG/M |
| 3300032059|Ga0318533_10809910 | Not Available | 687 | Open in IMG/M |
| 3300032059|Ga0318533_10886694 | Not Available | 654 | Open in IMG/M |
| 3300032060|Ga0318505_10182260 | Not Available | 980 | Open in IMG/M |
| 3300032063|Ga0318504_10206299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 918 | Open in IMG/M |
| 3300032068|Ga0318553_10042206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 2225 | Open in IMG/M |
| 3300032076|Ga0306924_10375177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1630 | Open in IMG/M |
| 3300032076|Ga0306924_12195290 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
| 3300032090|Ga0318518_10616706 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300032160|Ga0311301_10952141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1146 | Open in IMG/M |
| 3300032160|Ga0311301_11870707 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 710 | Open in IMG/M |
| 3300032174|Ga0307470_11116830 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 635 | Open in IMG/M |
| 3300032180|Ga0307471_100675776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1196 | Open in IMG/M |
| 3300032261|Ga0306920_101664035 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 906 | Open in IMG/M |
| 3300032261|Ga0306920_103786711 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 553 | Open in IMG/M |
| 3300032261|Ga0306920_104131633 | Not Available | 525 | Open in IMG/M |
| 3300032261|Ga0306920_104463936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300032782|Ga0335082_11397095 | Not Available | 570 | Open in IMG/M |
| 3300032829|Ga0335070_11506091 | Not Available | 613 | Open in IMG/M |
| 3300032898|Ga0335072_10975582 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 782 | Open in IMG/M |
| 3300032898|Ga0335072_11512161 | Not Available | 572 | Open in IMG/M |
| 3300033134|Ga0335073_11435861 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 671 | Open in IMG/M |
| 3300033290|Ga0318519_10864971 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 558 | Open in IMG/M |
| 3300034268|Ga0372943_1111442 | Not Available | 528 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.25% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.77% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.74% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.40% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.05% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.71% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.71% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.37% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.37% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.03% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.03% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.03% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.03% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.03% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.68% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.68% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.68% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.68% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.34% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.34% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.34% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.34% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.34% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.34% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.34% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.34% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.34% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.34% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.34% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.34% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.34% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.34% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.34% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2032320005 | Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003223 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 | Environmental | Open in IMG/M |
| 3300003351 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012176 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ036 MetaG | Host-Associated | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027173 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACEORA_4648310 | 2032320005 | Soil | MAEAALSATEAALENQRIGPLQIRVAAICTLIQMCDGY |
| JGIcombinedJ26739_1000382305 | 3300002245 | Forest Soil | MAQTHSSATEYALENQRVGGLQIRVAVICGLIQMCDGYDXGSIGWS |
| JGI26343J46809_10165192 | 3300003223 | Bog Forest Soil | MAEMALSATESALENQRLGSLQIRVAALCTLVQVCDGYDIGSIGIAVPALTH |
| JGI26346J50198_10184252 | 3300003351 | Bog Forest Soil | MAEAYVSVTENALENQRIGTLQIGVVAICMLIQMCDGYDV |
| Ga0062385_105562432 | 3300004080 | Bog Forest Soil | MAEAALSATETALENQRIGGLQIRVAALCTLIQICDGYDI |
| Ga0062385_110226411 | 3300004080 | Bog Forest Soil | VAGAALSSIETALENQRLGSLQIRVAALCTLIQMCDGYDVNSIGW |
| Ga0063454_1002138713 | 3300004081 | Soil | MQTAPISAAETALENQRLGPLQIRVAALCTLVQICDGYDINSIGVA |
| Ga0063454_1012325041 | 3300004081 | Soil | MAEATLSSAEAALENQRLGTLQIRVAALCTLVQICDGYDINSIGV |
| Ga0062384_1007016421 | 3300004082 | Bog Forest Soil | MAQAPASSIEAALENQRLGSLQIRVAALCTLIQMCDGYDV |
| Ga0062384_1011191801 | 3300004082 | Bog Forest Soil | MADRAVSATEHALENQRIGPLQIRVAALCGLVQICDGYDV |
| Ga0062387_1002451501 | 3300004091 | Bog Forest Soil | MAETPFSATEDALEHQPLGGLQIRVAVICGLIQMCDGYDVGSI |
| Ga0062387_1007285712 | 3300004091 | Bog Forest Soil | MAQAPASSIEAALENQRLGSLQIRVAALCTLIQMCDGYDVNSIGWAVP |
| Ga0062389_1010545891 | 3300004092 | Bog Forest Soil | MAETPFSATEDALEHQPLGGLQIRVAVICGLIQMCDGYDV |
| Ga0062593_1011220862 | 3300004114 | Soil | MAGEPISAAETALENQRLGPLQIRVAALCTLVQICDGYDINSIGVAVPQ |
| Ga0062388_1018908591 | 3300004635 | Bog Forest Soil | MAQAPASSIEAALENQRLGSLQIRVAALCTLIQMCDGYDVNSIGW |
| Ga0062388_1029160991 | 3300004635 | Bog Forest Soil | MAEVAQVEGILSPTEAALENQRLGGLQFRVAALCTLVQVCDGY |
| Ga0066690_110731752 | 3300005177 | Soil | MAEMPLSSTETALENQRIGPLQIRVAAICTVVQMCDGYDVNSIGV |
| Ga0070670_1019367772 | 3300005331 | Switchgrass Rhizosphere | MAGEPISAAETALENQRLGPLQIRVAALCTLVQICDGYDINS |
| Ga0066388_1013783391 | 3300005332 | Tropical Forest Soil | VAELHLSATEATIENQPIGALQVKVALICALVQMCDGYDV |
| Ga0066388_1033769402 | 3300005332 | Tropical Forest Soil | MAEAGFSATESALENQRIGGLQIRVAALCALIQICDGYDVNAIGVSVPSLT |
| Ga0068868_1002289132 | 3300005338 | Miscanthus Rhizosphere | MADAPLSPAEAALENQRIGGLQIRVVVLCMLVQTCDGYDL |
| Ga0070679_1020269801 | 3300005530 | Corn Rhizosphere | MMSAPSSAPSSPTEVALENQRIGPLQLRFAALCTLVQICDGYD |
| Ga0070735_105081721 | 3300005534 | Surface Soil | MTEMVPSGAELALENQRLGRLQILVATLTGLVQVCDGYDLNAIAWAVPSLIK |
| Ga0070684_1015184412 | 3300005535 | Corn Rhizosphere | MAGEPISAAETALENQRLGPLQIRVAALCTLVQICDGYDIN |
| Ga0066670_109401512 | 3300005560 | Soil | MQTAPISAAETALENQRLGPLQIRVAALCTLVQICDGYDINSIGVAV |
| Ga0068855_1025015052 | 3300005563 | Corn Rhizosphere | VADITLSRTETTLENQRIGGLQIRVVALCTLIQMCDGYDIGAIGWAV |
| Ga0070763_103989841 | 3300005610 | Soil | MADMAVSAVERALENQRIGSLQIRVAILCGLVQVCDGYDLNAIAWA |
| Ga0066903_1018336262 | 3300005764 | Tropical Forest Soil | MTEALLSATEAALENQRIGPLQIRVAALCTLIQICDGYDINS |
| Ga0070717_108036521 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MANSALSATETALENQRVGGLQLRVAVLCTLVQIC |
| Ga0070717_116024932 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEATPSSAEATLENQRLGPLQYRVAALCALVQICDGYDINSV |
| Ga0070717_118976003 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEAIQSSAEHTLENQRLGPLQIRVAALCTLVQICDGYDINS |
| Ga0070717_121497741 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MADTPLSAAEAALENQRIGGLQVRVILLCMLVQTCDGYDLNA |
| Ga0066651_108414823 | 3300006031 | Soil | MAEATLSSTEATLENQRLGPLQIRVAALCTLVQICDGYDINSIGVA |
| Ga0066696_100735675 | 3300006032 | Soil | MQAGPISAAETALENQRLGPLQLRVAALCTLVQICDGYDINSIGVA |
| Ga0066696_102640992 | 3300006032 | Soil | MAEAALSGAETALENQRIGGLQIRVAALCTLVQICDGYDINSVGVTVP |
| Ga0075029_1008312532 | 3300006052 | Watersheds | MAETASSAEAALENQRIGGLQLRVAALCTLVQICDGYDLNSIA |
| Ga0075017_1007689702 | 3300006059 | Watersheds | MAQAALSAAEAALENQRIGGLQLRVAALCTLVQICDG |
| Ga0075017_1016568412 | 3300006059 | Watersheds | MATTSLSATESALENQRIGGLQLRVAVLCGLVQICDGYDLNS |
| Ga0070712_1016387151 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEAALSGAEAALENQRLGPLQIRVAALCTLVQICDGYDI |
| Ga0070765_1008243241 | 3300006176 | Soil | MAEAALSSAEHALENQRIGGLPIRVAILCTLVQICDGYDVGSIG* |
| Ga0097621_1009118162 | 3300006237 | Miscanthus Rhizosphere | MAEAAVSAAEAALENQRIGGLQIRVAVLCTLVQVCDGYDLNSIAW |
| Ga0066659_105252342 | 3300006797 | Soil | MAEAMVSGAEAALENQRLGPLQIRVAALCTLVQICDGYD |
| Ga0066659_107223241 | 3300006797 | Soil | MSEPAVSATETALENQRIGPLQIRVAALCTLIQICDGYDVNAIGVS |
| Ga0066659_115346172 | 3300006797 | Soil | MAEATLSSTEATLENQRVGGLQIRVAALCTLVQICDGYDVNAIG |
| Ga0066660_111851711 | 3300006800 | Soil | MAEAALSSAEEALENQRLGPLQFRVAALCALVQICDG |
| Ga0075431_1019975101 | 3300006847 | Populus Rhizosphere | MTEAPFSATEAALENQRIGGLQIRVAALCTLIQICDGYD |
| Ga0075434_1002604285 | 3300006871 | Populus Rhizosphere | MTETMVSPVETALENQRIGSLQIRVVALCGLIQICDGFDV |
| Ga0075434_1023581742 | 3300006871 | Populus Rhizosphere | MAEALFSATESALENQKIGGLQIRVAALCALIQIGDGYDVN |
| Ga0066710_1032595872 | 3300009012 | Grasslands Soil | MAEAALSSTEEALENQRLGPLQFRFAALCALVQICDGYDI |
| Ga0105249_117482732 | 3300009553 | Switchgrass Rhizosphere | MAQTGISATEMALETQRIGGLQIRVAALCTLIQICDGYDINSIA* |
| Ga0105249_131077542 | 3300009553 | Switchgrass Rhizosphere | MAHVTSSAESALENQRIGSLQLRVAALCTLVQICDGYDLNAV |
| Ga0126374_101266501 | 3300009792 | Tropical Forest Soil | MSATEAALENQRLGGLQITVVTICTLIQMCDGYDVGSIGWAVP |
| Ga0126374_107725502 | 3300009792 | Tropical Forest Soil | MADAVLSATESALENQKIGGLQIRVAALCTLIQIC |
| Ga0126374_109101581 | 3300009792 | Tropical Forest Soil | MAEAVFSATESALENQRIGGLQIRVAALCALIQICDGYDV |
| Ga0126311_112798352 | 3300010045 | Serpentine Soil | MSAAETALENQRLGPLQLRVAALCTLVQICDGYDINSIGVAVP |
| Ga0126373_108985312 | 3300010048 | Tropical Forest Soil | MMAETALSSTETALENQRIGGLQLRVATLCTLIQICDGYDINSIGWAVPS |
| Ga0126373_115490012 | 3300010048 | Tropical Forest Soil | MTEASLSSAEHALENQRLGPLQIRVAALCTLVQICDGY |
| Ga0126373_116589121 | 3300010048 | Tropical Forest Soil | MRPIEVALEDQRIGPLQLRVAVLCTLVQICDGYDLNAVAWAVPSL |
| Ga0126373_116742322 | 3300010048 | Tropical Forest Soil | MAEAVLSATEAALENQRIGPLQIRVAALCTLIQICDGYDVNAIGV |
| Ga0074046_108551252 | 3300010339 | Bog Forest Soil | MAEPAASAAEAALENQRIGGLQLRVAALCLLVQTCDGYDLNSVAWAV |
| Ga0126370_101729441 | 3300010358 | Tropical Forest Soil | MAHVAVSSAEHAIENQRIGGLQIRVAVLCTLVQICDGYDVG |
| Ga0126370_115312182 | 3300010358 | Tropical Forest Soil | MAEVEFSAAEHALENQRLGSLQIRVAALCTLVQICDGYDVNAIGVSVPS |
| Ga0126372_126025751 | 3300010360 | Tropical Forest Soil | MAEALLSSAEAALENQRVGALQIRVAALCTLVQICDGYDVN |
| Ga0126378_108977972 | 3300010361 | Tropical Forest Soil | MADTAVSAVESALENQRIGSLQLRVALLCTLVQICDGYDINSV |
| Ga0126378_114241831 | 3300010361 | Tropical Forest Soil | MVEAVLSATETALENQRIGPLQIRVAALCTLIQICDGYDVNAIGV |
| Ga0126378_115790052 | 3300010361 | Tropical Forest Soil | MADLAVSSIETAIENQRIGGLQIRVALLCSLIQICDGYDVNSVGVTVPS |
| Ga0126379_105507952 | 3300010366 | Tropical Forest Soil | MAEAAISATESALENQRIGGLQIRVAALCTLVQICDGYDVNAIGIAVPSL |
| Ga0126379_114951091 | 3300010366 | Tropical Forest Soil | MTETMVSPIETALENQRIGSLQIRVVALCGLVQICDAFDVNSIGIVVPS |
| Ga0126379_114951181 | 3300010366 | Tropical Forest Soil | MTETMVSPVETALENQRIGSLQIRVVALCGLVQICDAFDVNSIGIVVPS |
| Ga0126381_1016657232 | 3300010376 | Tropical Forest Soil | MAQAAISAAEAALENQRIGGLQLRVAVLCTLVQICDG |
| Ga0126381_1018528911 | 3300010376 | Tropical Forest Soil | MAEVSLSAAEAALENQRLGALQIRVAALCTLVQICDGYDIGAIGIA |
| Ga0126381_1026414242 | 3300010376 | Tropical Forest Soil | MAQPAMSAVEAALENQRIGRLQLRVAALCTLVQICDGYDLNSVAWAV |
| Ga0126381_1035891502 | 3300010376 | Tropical Forest Soil | MAEAVFSATESALENQRIGGLQIRVAALCALIQIC |
| Ga0126381_1050496941 | 3300010376 | Tropical Forest Soil | MVAAAVSTTEAALENQRLGGLQLRVAALCTLVQICDGYDI |
| Ga0136449_1002127411 | 3300010379 | Peatlands Soil | MAVAVLSTTEAALENQRVGGLQLRVAVLCTLVQICDGYDLN |
| Ga0136449_1037335471 | 3300010379 | Peatlands Soil | MAQAALSAAEAALENQRIGGLQVRVAALCTLVQICDG |
| Ga0136449_1039776942 | 3300010379 | Peatlands Soil | MAQAAMSAAEAALENQRIGGLQLRVAALCLLVQVCDGYDLNSVAWAVPALIRFW |
| Ga0126383_105913103 | 3300010398 | Tropical Forest Soil | MTEASLSSAEHALENQRLGPLQIRVAALCTLVQICDGYDI |
| Ga0153952_11083521 | 3300012176 | Attine Ant Fungus Gardens | MAQTHSSAAEHALENQALGGLQIRVAVICGLIQMCDGYDVGS |
| Ga0137363_115353052 | 3300012202 | Vadose Zone Soil | MAEAQLSSTEVALENQRVGPLQIRVAALCTLIQICDAFDVNAIAVTVPS |
| Ga0150985_1012676081 | 3300012212 | Avena Fatua Rhizosphere | MANATSSAAEAAIENQRVDGLQIRVAVLCMLVQICDGYDLNA |
| Ga0137372_108836781 | 3300012350 | Vadose Zone Soil | MAEAALSATESALENQKIGGLQIRVAALCALIQVCDG |
| Ga0137398_107354071 | 3300012683 | Vadose Zone Soil | MAEATLSSAESALENQRIGPLQLRVAALCTLIQIC |
| Ga0137359_111110441 | 3300012923 | Vadose Zone Soil | MMAQGAVSATETALENQRIGPLQLRVAALCTLIQICDGYDINSIAWAVPS |
| Ga0137419_101068062 | 3300012925 | Vadose Zone Soil | MAEATLSSAESALENQRIGPLQLRVAALCTLIQICDGYD |
| Ga0164300_107038722 | 3300012951 | Soil | MAAAALSTTEAALENQRLGGLQLRVAALCTLVQICD |
| Ga0126369_101623432 | 3300012971 | Tropical Forest Soil | MAEVRLSATETALENQRIGALQIRVAALCTLIQIC |
| Ga0126369_124546522 | 3300012971 | Tropical Forest Soil | MAGTLSAAETALENQRLGGLQIRVAAICTLIQMCDGYDVGSI |
| Ga0120111_10369532 | 3300013764 | Permafrost | MSEMAVSAVETALENQRIGPLQIRVAALCTLIQILDGYDVNAIG |
| Ga0181530_103663242 | 3300014159 | Bog | MAGAAYSSTEAALENQTIGRLQLRVAALCTLVQICDGYDLNSVAWAV |
| Ga0181534_105742861 | 3300014168 | Bog | MADATLSAAEAALETQRIGGLQLRVAALCLLVQTCDGYDLNSVAWA |
| Ga0181526_101593651 | 3300014200 | Bog | MANAAMSAAEAALENQRIGGLQLRVAVLCTLVQICDGYDLNSVAWAVPSLI |
| Ga0163163_112433792 | 3300014325 | Switchgrass Rhizosphere | MAQTGISATEMALETQRIGGLQIRVAALCTLIQICDGYDINSIAWSVPSLI |
| Ga0182018_103733152 | 3300014489 | Palsa | MPVVSATEAALENQRLGGLQMRVAALCTLVQVCDGYDLNSVAWAVPPLI |
| Ga0182015_105866242 | 3300014495 | Palsa | MMADVVVSAVESALENQRIGSLQIRVAILCGLVQVCDGYDLNAIAWAAP |
| Ga0182024_100840045 | 3300014501 | Permafrost | MSDAVVSATETALENQRIGPLQIRVAALCTLIQICDGYDIN |
| Ga0181525_104328601 | 3300014654 | Bog | MAEAASSATEVALENQRIGGLQLRVAALCMLVQIC |
| Ga0157379_120552761 | 3300014968 | Switchgrass Rhizosphere | MATTSLSATESALENQRIGGLQLRVAALCGLVQICDGYDLNSVAW |
| Ga0137414_11448712 | 3300015051 | Vadose Zone Soil | MAETALSATESALENQRIGGLQIRVAALCGLIQICDGYDVNSIGVT |
| Ga0137403_104159351 | 3300015264 | Vadose Zone Soil | MAETALSATESALENQRIGGLQIRVAALCALIQICDGYDINSIGV |
| Ga0132256_1019141132 | 3300015372 | Arabidopsis Rhizosphere | MAEAILSSTEAALENQRLGPLQYRVAALCALVQICDGYDI |
| Ga0132257_1027822612 | 3300015373 | Arabidopsis Rhizosphere | MELSAAETALENQRLGPLQIRVAALCTLVQICDGYDINSVGVTVPSLT |
| Ga0182036_109352741 | 3300016270 | Soil | MADVAQSSTELALENQRIGALQIRVVAICSLIQICDGYDVG |
| Ga0182041_101081893 | 3300016294 | Soil | MAELALSATERALENQRIGGLQIRVAALCTLIQICDGYDINSIG |
| Ga0182033_113199752 | 3300016319 | Soil | MAETAFSATERALENQRIGSLQISVVALCTLIQMCDGYDVG |
| Ga0182033_114162012 | 3300016319 | Soil | MADTAQSATESALENQRIGALQIRVVAICSLIQICDVRRRF |
| Ga0182035_104474671 | 3300016341 | Soil | MTEAVLSATEAALENQRIGPLQIRVAALCTLIQICDGYDINS |
| Ga0182035_104476951 | 3300016341 | Soil | MAEAAFSATESALENQRIGALQIGVVAICTLIQMCDGYDVGSI |
| Ga0182035_115060711 | 3300016341 | Soil | MAEATFSATEKALENQRIGSLQIRVAALCTLIQICDGY |
| Ga0182032_112173172 | 3300016357 | Soil | MVEAGLSTAESALENQKIGGLQIRVAALCALIQMCD |
| Ga0182032_118615811 | 3300016357 | Soil | MAQPAMSAAEAALENQRIGGLQIRVAALCTLVQICDGYDLNAVAWAVPPL |
| Ga0182034_112688482 | 3300016371 | Soil | MAEAGLSTTESALENQKIGGLQIRVAALCALIQMCDGY |
| Ga0182034_112922771 | 3300016371 | Soil | MVRAALSAAEAALETQRIGGLQLRVAALCTLVQICDGYDLNSVAWAVPS |
| Ga0182034_113353091 | 3300016371 | Soil | MAVAAGATIEALLDNQRLGALQLRVAVLCALVQMCDGYDLN |
| Ga0182034_119193812 | 3300016371 | Soil | MAELALSATERALENQRIGGLQIRVAALCTLIQICDGYDINS |
| Ga0182034_120254622 | 3300016371 | Soil | VAEVRLSATEAALENQRIGALQVRVVVLCTLIQICDAYDV |
| Ga0182040_110771751 | 3300016387 | Soil | MVAAAVSTTEAALENQRLGGLQLRVAALCTLVQICDGYDLNSVAWAVPSLI |
| Ga0182037_106101561 | 3300016404 | Soil | MAEAVLSATERALENQRIGGLQIRVAAICTLVQMCDGYDVNSIGVSV |
| Ga0182037_109585221 | 3300016404 | Soil | MAEAALSATETALENQRIGGLQLRVAALCTLVQICDGYDVNSI |
| Ga0182037_120483031 | 3300016404 | Soil | MAEISLSATEAALENQRLGALQIRVAALCTLVQICDGYDIGSIGIAVPALTH |
| Ga0182039_107737671 | 3300016422 | Soil | MAEATFSATETALENQRLGALQIGVVAICTLIQMCDGYDVGSIG |
| Ga0182038_112164142 | 3300016445 | Soil | MAETAFSATERALENQRIGSLQISVVALCTLIQMCDGYDVGS |
| Ga0182038_118980071 | 3300016445 | Soil | MTQASLSTIESTLENQPLGGLQIRVATICTLVQMCDGYDVGS |
| Ga0187817_103710652 | 3300017955 | Freshwater Sediment | MAEAAFSATERALENQRIGTLQIGVVAICMLIQMCDG |
| Ga0187817_107422472 | 3300017955 | Freshwater Sediment | MTGMAVSAVESALENQRIGSLQIRVALLCGLVQVCDGYDLNA |
| Ga0187817_108435141 | 3300017955 | Freshwater Sediment | MAAASLSTTEAALENQRLGGLQLRVAASCTLVQICDGYD |
| Ga0187783_109786932 | 3300017970 | Tropical Peatland | MAEMPLSAAEAALEGQKLGALQYRVMVLCCLVQICDGYDIGAIG |
| Ga0187781_108955231 | 3300017972 | Tropical Peatland | MAEAALSATESALENQRIGALQIGVVAICTLIQMCDGYDIGSI |
| Ga0187782_116960011 | 3300017975 | Tropical Peatland | MAEAVLSPTESALENQRIGRLQIRVAILCTLVQIFDGYDV |
| Ga0187873_13937951 | 3300018013 | Peatland | MPVVSATEAALENQRLGGLQMRVAALCTLVQVCDGYDLNAVAWAVPS |
| Ga0187863_103907611 | 3300018034 | Peatland | MPVVSATEAALENQRLGGLQMRVAALCTLVQVCDGYDLNAVAW |
| Ga0187871_104232641 | 3300018042 | Peatland | MAETSVSAIEHALENQRLGGLQIRVVTICGLIQMCDGYDVGSIGWS |
| Ga0187784_114492491 | 3300018062 | Tropical Peatland | MSQAALSTAESALENQRIGGLQIRVAILCTLVQICDGYD |
| Ga0187770_104447131 | 3300018090 | Tropical Peatland | MTDMAVSAVESALENQRIGGLQIRVALLCGLVQVCDGYDLNAIAWAAPSLIKG |
| Ga0210399_108438111 | 3300020581 | Soil | MAQTYSSATEHALENQRVGGLQIRVALICALIQMCDGYDVGTIGW |
| Ga0210400_101930451 | 3300021170 | Soil | MISALSSAAEARLENQRIGGLQIRVAALCTLVQMCDEFDINSIAWAVPS |
| Ga0210400_114870481 | 3300021170 | Soil | MAETALSATESALENQRIGGLQIRVAALCAFIQVC |
| Ga0210405_103747202 | 3300021171 | Soil | MADAGLSATESALENQRIGGLQIRVAALCALIQVCDGYDIN |
| Ga0210396_101711561 | 3300021180 | Soil | MAEAALSATETALENQRIGGLQIRVAALCTLIQICDGYDINSV |
| Ga0213872_102735612 | 3300021361 | Rhizosphere | MAEVAVSSAEAVLENQRIGGLQIRVAILCTLVQICDGYDVGSIGWAV |
| Ga0213882_105337882 | 3300021362 | Exposed Rock | MAASISTPEAALENQRIGRLQITVVAICTLIQMCDGYDVG |
| Ga0213876_106705221 | 3300021384 | Plant Roots | MQVTSEPLSVSEAALENQPIGGLQLRVAALCTLVQLCDGHDINS |
| Ga0210393_108363972 | 3300021401 | Soil | MADAPVSAVETALENQRIGSLQIRVAILCGLVQVCDGYDLNAIAWAA |
| Ga0210397_109267802 | 3300021403 | Soil | MSQTPMSNLETALENQRLGGLQMRVAVLCTLVQICDGYDINSIG |
| Ga0210397_113733941 | 3300021403 | Soil | MADATLSSIETALENQRLGGLQIRVAALCTLIQMCDGYDVNSIGWAVPS |
| Ga0210389_104768521 | 3300021404 | Soil | MAQAALSAAEAALENQRIGALQIRVAALCTLVQICDGYDLNSVAWAVPS |
| Ga0210384_114548032 | 3300021432 | Soil | MADTAVSAVETALENQRIGSLQIRVAILCTLIQICDGYDINSVAWAVPKL |
| Ga0210391_106426562 | 3300021433 | Soil | MAPVAGSTTEAALENQRLAGLQLRVAALCTLVQICDGYDLNSVAWAVPSLIREWH |
| Ga0213879_100351942 | 3300021439 | Bulk Soil | LAEAILSATESALENQRIGALQIRVAALCTFVQICDA |
| Ga0213879_101896951 | 3300021439 | Bulk Soil | MSATETALENQRIGGLQIRVAALCTLVQICDAYDVNAIGV |
| Ga0210390_110920981 | 3300021474 | Soil | MAVVANSATEAALENQRLGGLQLRVAALCTLVQMCDGYDLNSVAWAVPSL |
| Ga0187846_101970411 | 3300021476 | Biofilm | MAEAVLSATERALENQRIGGLQIRVAAICTLVQMCDGYDVN |
| Ga0210402_112695091 | 3300021478 | Soil | MAEAQLSSTEVALENQRVGPLQIRVAALCTLVQICDGYDINSIAVTV |
| Ga0210409_107848151 | 3300021559 | Soil | MAAVAGSTTEAALENQRLGGLQLRVAALCTLVQICDGYDLNSVAWAVPSL |
| Ga0126371_102748471 | 3300021560 | Tropical Forest Soil | VQTGMLSAAETALENQRLGPLQIRVATLCTLVQICDGYDIN |
| Ga0126371_118665002 | 3300021560 | Tropical Forest Soil | MAELRLSATEAALENQRIGALQIRVAALCTLIQICDAYDVNA |
| Ga0126371_127541332 | 3300021560 | Tropical Forest Soil | MADVQLSATETALENQRIGALQIRVAALCTFVQICDA |
| Ga0247695_10655141 | 3300024179 | Soil | MAGEPISAAETALENQRLGPLQIRVAALCTLVQICDGYDINSI |
| Ga0228598_10157302 | 3300024227 | Rhizosphere | MAVAALSTTEAALENQRLGGLQLRVAALCTLVQICDGYDLN |
| Ga0207663_107065712 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEAQLSSTETALENQRVGGLQIRVAALCALVQICDGYDIN |
| Ga0207700_111096362 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEAALSATEAALENQRIGGLQIRVAALCTLIQICDGYDINSVAWAVPSLT |
| Ga0207704_112930461 | 3300025938 | Miscanthus Rhizosphere | MAQPAVSAAEAALENQRIGGLQVRVAVLCTLVQICDGYDINSVAWAVPSLIR |
| Ga0207677_113163642 | 3300026023 | Miscanthus Rhizosphere | MADAPLSPAEAALENQRIGGLQIRVVVLCMLVQTCDGYDLNAVAWTVPPLIR |
| Ga0209153_10875912 | 3300026312 | Soil | MAEAMISGAEDALENQRIGGLQMRVAALCALVQICDGYDI |
| Ga0209808_12192851 | 3300026523 | Soil | MAEAALSATEAALENQRIGPLQIRVAALCTLIQICDGYDINSVA |
| Ga0209648_102349472 | 3300026551 | Grasslands Soil | MTEAALSATETALENQRIGGLQIRVAALCTLIQICDGYDINSVA |
| Ga0208097_10118233 | 3300027173 | Forest Soil | MGKLEGKIAEAALSSAETALETQRIGGLQIRVAMLCTLVQICDGYDMGSIGW |
| Ga0209328_101871221 | 3300027727 | Forest Soil | TEHALENQRVGGLQIRVALICGLIQMCDGYDVGAGIKR |
| Ga0209248_100068663 | 3300027729 | Bog Forest Soil | MATAVTPKTVVSATEYALENQRLGGLQIRVAAICGLIQMCDGYDVGSIGWAVRR |
| Ga0209448_100115001 | 3300027783 | Bog Forest Soil | MAEAAFSATERALENQRVGALQISVVAICTLIQMCDGYDVGSIGWAV |
| Ga0209656_100470441 | 3300027812 | Bog Forest Soil | MAEVHLSATEAALENQRIGGLQIRVAALCALVQICDG |
| Ga0209656_104024192 | 3300027812 | Bog Forest Soil | MAEVHLSATEAALENQRIGGLQLRVATLCALVQICDGYDI |
| Ga0209274_100351291 | 3300027853 | Soil | MAGTPVSATETALENQRLGGLQLRVAALCTLVQFCDGYDLNSVAWAVPPLIKE |
| Ga0209693_103845152 | 3300027855 | Soil | MADTAVSAVESALENQRIGGLQIRVAVLCTLVQICDGYDINSIAW |
| Ga0209624_105171521 | 3300027895 | Forest Soil | MAQMHSSATEYALENQRVGGLQIRVAVICGLIQMCDGYDIGSIGWS |
| Ga0209488_112122761 | 3300027903 | Vadose Zone Soil | MQAGPISPAETALENQRLGPLQIRVAALCTLVQICDGYDI |
| Ga0209006_103091824 | 3300027908 | Forest Soil | MSQSQSSPIEDVLENQKLGGLQIRVAVFCGLIQMCDGYDV |
| Ga0209006_111355451 | 3300027908 | Forest Soil | MAQMHSSATEHALENQRVGGLQIRVALICGLIQMCDGYDVGTIGWS |
| Ga0209168_100706521 | 3300027986 | Surface Soil | MAISVTETAIEHQKIGALQIRVVAICTLIQMCDGY |
| Ga0302231_100280201 | 3300028775 | Palsa | MPEATSSAVETALENQRIGGLQLRVAALCLLVQICDGYDLN |
| Ga0308309_112001791 | 3300028906 | Soil | MADATLSSTETALENQRIGPLQIRVAAICTVVQMCDGYDVNSI |
| Ga0222749_103109631 | 3300029636 | Soil | MALTHSSATEYALENQRVGGLQIRVAVICGLIQMCDGYDVGTIGWS |
| Ga0222749_107354361 | 3300029636 | Soil | MAEATLSSTETALENQRIGGLQIRVAAICTVVQMCDGYD |
| Ga0311340_115618301 | 3300029943 | Palsa | MAVAVLSATEAALENQRLGGLQLRVAALCMLVQICDGYDLNSV |
| Ga0302325_110004201 | 3300031234 | Palsa | MADTAVSAVEQALENQRIGSLQIRVVVLCLLVQICDGYDVNSIAWAVPSLIKA |
| Ga0170820_109146691 | 3300031446 | Forest Soil | MAERVLSATESALENQRIGSLQIRVAALCTLIQIC |
| Ga0170820_112780602 | 3300031446 | Forest Soil | MADTAVSTVESALENQRIGGLQIRVAILCGLVQMCDGYDLNAIAWAAGAAALC |
| Ga0302326_129506872 | 3300031525 | Palsa | MADTAVSAVERALENQRIGSLQIRVVVLCLLVQICDGYDVNSIAWAVPSLIKA |
| Ga0318516_102226571 | 3300031543 | Soil | LTEAVLSTTERAIENQRIGGLQIRVAALCTFVQICDAYDVNAI |
| Ga0318516_105580582 | 3300031543 | Soil | LTEAMSSATESAIENQRIGGLQLRVTALCALVQICDGYDVNAIG |
| Ga0318516_107653951 | 3300031543 | Soil | MAEAVLSATERALENQRIGGLQIRVAALCTLVQICDGYDIN |
| Ga0318534_102746401 | 3300031544 | Soil | MAEAALPAVESAIENQRIGALQIRVVAICTLIQMCDGYDVGSAPSRAA |
| Ga0318534_104599012 | 3300031544 | Soil | LAEVILSATERAIENQRIGGLQLRVAALCALVQVCDGYDVNAIG |
| Ga0318534_106055811 | 3300031544 | Soil | MAEASLSATEAALENQRIGPLQIRVAAICTLIQMCDGYDVN |
| Ga0318541_106092041 | 3300031545 | Soil | MAETAFSATERALENQRIGSLQIGVVALCTLIQMCDGYDVGSIGWA |
| Ga0318528_100137566 | 3300031561 | Soil | MAEAAFSATETALENQRLGALQIGVVAICTLIQMCDGYDVGSI |
| Ga0318528_100759932 | 3300031561 | Soil | LTEAVLSTTERAIENQRIGGLQIRVAALCTFVQICDAYDVNAIGVSVLSL |
| Ga0318528_105283411 | 3300031561 | Soil | MAEAALPAVESAIENQRIGPLQIRVVAICTLIQMCD |
| Ga0318515_101168182 | 3300031572 | Soil | LTEAVLSTTERAIENQRIGGLQIRVAALCTFVQICDAYDVNAIGVSVPSL |
| Ga0318515_101488541 | 3300031572 | Soil | MAEAAYSATETALENQRLGALQMRVAALCALIQMCDGYDVGSIG |
| Ga0310915_101572741 | 3300031573 | Soil | MAEAAYSATETALENQRLGALQMRVAALCALIQMCDGY |
| Ga0310915_103979971 | 3300031573 | Soil | MAEAILFSATESALENQRIGGLQIRVAALCTLIQICDGYDINSIGWAVPSL |
| Ga0318555_101335972 | 3300031640 | Soil | MVETRLSSTEATLENQRLGGLQIRVAALCALVQVCDGYDVN |
| Ga0318555_102133083 | 3300031640 | Soil | MAEVSLSAAEAALENQRLGALQIRVAALCTLVQICDGYDIGSIGIAVPALTH |
| Ga0318555_106461082 | 3300031640 | Soil | MAETAFSATERALENQRIGALQIGVAALCMLIQMCDGYD |
| Ga0318542_101764421 | 3300031668 | Soil | MAEAALSATESAIENQRIGGLQLRVAALCALVQICDGYDVNAIG |
| Ga0307374_104467241 | 3300031670 | Soil | MSDAGVSTIETRLENQAIGALQIRVAAICTVVQLCDGYD |
| Ga0318572_105904962 | 3300031681 | Soil | MAQAAFSTIESALENQRIGGLQIRVAALCALVQVCD |
| Ga0318572_108602881 | 3300031681 | Soil | MMETMVSPVETALENQRIGSLQIRVVALCGLVQICD |
| Ga0310686_1083750511 | 3300031708 | Soil | MAHAASAAAEAALENQRIGGLQLRVAALCLLVQTCDGYDLNSV |
| Ga0310686_1191136181 | 3300031708 | Soil | MAAAALSTTEAALENQRLGGLQLRVAALCTLVQICDGYDVNSVAWAVPSLIR |
| Ga0307476_109476131 | 3300031715 | Hardwood Forest Soil | MEAVTSSAAEAALENQRIGGLQIRVAAICGLIQMCDGYDVGSIGWSV |
| Ga0307476_111592992 | 3300031715 | Hardwood Forest Soil | MADTAVSAVETALENQRIGSLQIRVAILCTLIQICDGYDINSVAWAVPKLI |
| Ga0307474_115447221 | 3300031718 | Hardwood Forest Soil | MAEMALSPTESALENQRVGSLQLRVAALCTLVQICDGYDINSIGWA |
| Ga0306917_111810001 | 3300031719 | Soil | LTEAVLSTTERAIENQRIGGLQIRVAALCTFVQICDAYDVNAIGVSVL |
| Ga0318493_108560971 | 3300031723 | Soil | MAEAALPAVESAIENQRIGPLQIRVVAICTLIQMCDGYD |
| Ga0318500_100104491 | 3300031724 | Soil | MAEAALSATETALEYQRIGGLQLRVAALCTLVQICD |
| Ga0318501_101863952 | 3300031736 | Soil | MAEAALSATESAIENQRIGGLQLRVAALCALVQICDGYDVNAIGVSV |
| Ga0318501_107151372 | 3300031736 | Soil | MVEAGLSTAESALENQKIGGLQIRVAALCALIQMCDGYD |
| Ga0306918_101295401 | 3300031744 | Soil | MAEAALSATESAIENQRIGGLQLRVAALCALVQICDGYDVN |
| Ga0318494_101153991 | 3300031751 | Soil | MAEAALSATETALENQRIGGLQLRVAALCTLVQICDGYDVN |
| Ga0318494_109404392 | 3300031751 | Soil | LAEVQLSTTETALENQRIGPLQLRVVALCTLIQICDAYDVNAIAVTV |
| Ga0318554_103621951 | 3300031765 | Soil | MAEAALSATESAIENQRIGGLQLRVAALCALVQIC |
| Ga0318526_104466522 | 3300031769 | Soil | LAEVILSATERAIENQRIGGLQLRVAALCALVQVCDGYD |
| Ga0318543_101355732 | 3300031777 | Soil | MVETRLSSTEATLENQRLGGLQIRVAALCALVQVCDGYDVNAIG |
| Ga0318543_102448512 | 3300031777 | Soil | MAETAFSATERALENQRIGALQIGVAALCMLIQMCDGYNVGSIGWA |
| Ga0318566_100139235 | 3300031779 | Soil | MAELQLSATETALENQRIGALQIRVAALCTLIQICDAYDVNAIAVTVPS |
| Ga0318566_102401211 | 3300031779 | Soil | MAQTYSSATEHALENQRVGGLQIRVALICALIQMCDGYDVGTIG |
| Ga0318566_104487382 | 3300031779 | Soil | MAEAVLSSTERALENQRIGPLQIRVAAICTLVQMCDGYDV |
| Ga0318547_104923081 | 3300031781 | Soil | MADVAQSSTELALENQRIGALQIRVVAICSLIQICDGYDV |
| Ga0318547_110690602 | 3300031781 | Soil | MTEAVLSATEAALENQRIGPLQIRVAALCTLIQICDGYDINSVAWAVPS |
| Ga0318529_100746693 | 3300031792 | Soil | MAEAALPAVESAIENQRIGPLQIRVVAICTLIQMCDGYDVGSIGWA |
| Ga0318503_102537891 | 3300031794 | Soil | LTEAVLSTTERAIENQRIGGLQLRVAALCTFVQICDAYDV |
| Ga0318497_106457802 | 3300031805 | Soil | MAEGAFSATERALENQRIGALQIGVVAICTLIQMCDGYD |
| Ga0307478_111383691 | 3300031823 | Hardwood Forest Soil | MAEMASSSAELALENQKIGGLQIRVAALCTLVQICDGYDINSIGVAVPQ |
| Ga0318564_103240591 | 3300031831 | Soil | MAQAAFSATEAALENQRIGGLQLRVAALCTLVQICDG |
| Ga0318499_100450751 | 3300031832 | Soil | MAEAVLSATETALENQRIGPLQIRVAAICTLVQMCDGYD |
| Ga0318499_100806951 | 3300031832 | Soil | MAEAGLSTTESALENQKIGGLQIRVATLCALIQMC |
| Ga0310917_100139751 | 3300031833 | Soil | MAEAALSATETALEYQRIGGLQLRVAALCTLVQICDGYDVNSIGVSVPSLTHA |
| Ga0318511_105206912 | 3300031845 | Soil | MANTALSAAEAALENQRIGGLQIRVAILCTLVQIC |
| Ga0318512_103574472 | 3300031846 | Soil | MAEAALPAVESAIENQRIGPLQIRVVAICTLIQMCDGY |
| Ga0318544_100690451 | 3300031880 | Soil | MAEAAFSATESALENQRLGGLQIRVAALCALIQMCDGYDVGSIGW |
| Ga0306925_107001061 | 3300031890 | Soil | MMETMVSPVETALENQRIGSLQIRVVALCGLVQICDAFDVN |
| Ga0318522_100031336 | 3300031894 | Soil | MAELQLSATETALENQRIGALQIRVAALCTLIQICDAYDVN |
| Ga0318522_102172321 | 3300031894 | Soil | MAEAVLSATERALENQRIGGLQIRVAAICTLVQMCDGYDVNSIGVSVPSL |
| Ga0318551_100244891 | 3300031896 | Soil | MAEASLSATEVALENQRLGALQIRVAALCTLVQICDGYDIGSIGIVVPSLTHA |
| Ga0318551_100801592 | 3300031896 | Soil | MAEAVLSSTERALENQRIGPLQIRVAAICTLVQMCDGYDVNSI |
| Ga0306921_102177073 | 3300031912 | Soil | MAEAALPAVESAIENQRIGPLQIRVVAICTLIQMCDGYDVGSIGW |
| Ga0306921_103356341 | 3300031912 | Soil | MTEVSLSAAEAALENQRLGALQIRVAALCTLVQICD |
| Ga0310916_109465391 | 3300031942 | Soil | MAEAVLSATERALENQRIGGLQIRVAAICTLVQMCDGY |
| Ga0310913_108516921 | 3300031945 | Soil | VAEVRLSATEAALENQRIGALQVRVVVLCTLIQICDAYDVNAI |
| Ga0310909_102005521 | 3300031947 | Soil | MTEVSLSAAEAALENQRLGALQIRVAALCTLVQICDGYDI |
| Ga0306926_100194299 | 3300031954 | Soil | MAEAAFSATETALENQRIGALQIGVVALCTLIQMCDGYDV |
| Ga0306926_109449342 | 3300031954 | Soil | MAEASLSATEAALENQRIGPLQIRVAAICTLIQMCDGYDVNS |
| Ga0306926_114772672 | 3300031954 | Soil | MVAAAVSTTEAALENQRLGGLQLRVAALCTLVQICDGYDLNSVAWAVPS |
| Ga0307479_116924832 | 3300031962 | Hardwood Forest Soil | MTEAYASATEHALENQRIGGLQIRVAALCTLIQICD |
| Ga0307479_121461182 | 3300031962 | Hardwood Forest Soil | MAEAAFSATESALENQRIGALQIGVVAICTLIQMCDGYD |
| Ga0308176_127652541 | 3300031996 | Soil | MADAALSAAETALENQRIGGLQVRVVVLCMLVQTCDGYDLNAVAWAVPPL |
| Ga0306922_102462615 | 3300032001 | Soil | MAEVSLSAAEAALENQRLGALQIRVAALCTLVQICD |
| Ga0306922_110995951 | 3300032001 | Soil | MAEAALSATETALENQRIGGLQIRVAVLCTLIQICDGYDINSVAWA |
| Ga0318562_103615411 | 3300032008 | Soil | MAQPAMSAAEAALENQRIGGLQIRVAALCTLVQICDGYDLNA |
| Ga0318563_105797801 | 3300032009 | Soil | MAETAFSATERALENQRIGALQIGVVAICVLIQMCDGYDVGSIGWA |
| Ga0318569_103394951 | 3300032010 | Soil | MAEASLSATEVALENQRLGALQIRVAALCTLVQICDG |
| Ga0318507_100906681 | 3300032025 | Soil | MAEAALSATETALENQRIGGLQIRVTALCTLIQICDGYDI |
| Ga0318507_101547421 | 3300032025 | Soil | MAEAAYSATETALENQRLGALQMRVAALCALIQMCD |
| Ga0318559_100543902 | 3300032039 | Soil | MAEAALSATETALENQRIGGLQLRVAALCTLVQIC |
| Ga0318558_104592612 | 3300032044 | Soil | MANTALSAAEAALENQRIGGLQIRVAILCTLVQICDGYDLNAVAWAVPSLIKAWH |
| Ga0318575_103822322 | 3300032055 | Soil | MAEAALSATESAIENQRIGGLQLRVAALCALVQICDGY |
| Ga0318533_108099101 | 3300032059 | Soil | MADTAQSATESALENQRIGALQIRVVAICSLIQIC |
| Ga0318533_108866941 | 3300032059 | Soil | MAEVSLSAAEAALENQRLGALQIRVAALCTLVQICDGY |
| Ga0318505_101822601 | 3300032060 | Soil | MAEATFSATEKALENQRIGGLQIRVAALCTLIQICDGYDIN |
| Ga0318504_102062992 | 3300032063 | Soil | LAEGVLSATERAIENQRIGGLQLRVAALCTFVQICDAYDVNAIGVSVPSLT |
| Ga0318553_100422061 | 3300032068 | Soil | MVEAGLSTAESALENQKIGGLQIRVAALCALIQMCDGYDVGSIGWAV |
| Ga0318553_101419951 | 3300032068 | Soil | MTQASLSTIESTLENQPLGGLQIRVATICTLVQMC |
| Ga0306924_103751771 | 3300032076 | Soil | MAEAAFSATETALENQRLGALQIGVVAICTLIQMC |
| Ga0306924_121952902 | 3300032076 | Soil | VEAALSAAEAALENQRIGRLQLRVAALCTLIQICDAFDVN |
| Ga0318518_106167062 | 3300032090 | Soil | MVETRLSSTEATLENQRLGGLQIRVAALCALVQVCDGYDVNAIGVSV |
| Ga0311301_109521411 | 3300032160 | Peatlands Soil | MASSTTEHALENQRLGGLQIRVAVICALIQMCDGYDIG |
| Ga0311301_118707072 | 3300032160 | Peatlands Soil | MAQAAMSAAEAALENQRIGGLQLRVAALCLLVQVCDGYDLNSVAWAVPSL |
| Ga0307470_111168302 | 3300032174 | Hardwood Forest Soil | MAEAAVSATETALENQRIGGLQLRVAALCTLVQIC |
| Ga0307471_1006757761 | 3300032180 | Hardwood Forest Soil | MPDAALSATESAIENQRIGGLQIRVAALCAFIQICDGY |
| Ga0306920_1016640352 | 3300032261 | Soil | MAQAALSAAEVALENQRIGGLQLRVAALCTLVQICDGYDLNSVAWAV |
| Ga0306920_1037867112 | 3300032261 | Soil | MADTAQSATESALENQRIGALQIRVVAICSLIQICDVRRRFDWLG |
| Ga0306920_1041316331 | 3300032261 | Soil | MAEAAFSATETAFENQRIGALQIGVVALCTLIQMCDGYDVGSIGWAV |
| Ga0306920_1044639362 | 3300032261 | Soil | MADAAQSATELALENQRIGALQIRVVAICSLIQICDGYDVGS |
| Ga0335082_113970951 | 3300032782 | Soil | MADTTVSRVESALENQRIGSLQIRVALLCGLVQMCDGYDLNAIAWAVP |
| Ga0335070_115060912 | 3300032829 | Soil | MADATALSIESALENQQIGSLQLRVAALCTLIQICDGYDINSIA |
| Ga0335072_109755822 | 3300032898 | Soil | MADTAVSSVERALENQRIGGLQIRVAVLCTLIQICDGY |
| Ga0335072_115121612 | 3300032898 | Soil | MADVAMSSVEAALENQRIGGLQIRVALLCGLVQICD |
| Ga0335073_114358611 | 3300033134 | Soil | MSAAEAALENQKIGGLQLRVAVLCTLVQICDGYDLNSVAWAVP |
| Ga0318519_108649711 | 3300033290 | Soil | MAEAALSATETALENQRIGGLQIRVAVLCTLIQICDGYDINSVAWAVPSLT |
| Ga0372943_1111442_2_130 | 3300034268 | Soil | MATAALSATETTLENQRLGGLQIRVAALCTLVQICDGYDINSV |
| ⦗Top⦘ |