| Basic Information | |
|---|---|
| Family ID | F011262 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 293 |
| Average Sequence Length | 46 residues |
| Representative Sequence | TRESLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLLGRR |
| Number of Associated Samples | 211 |
| Number of Associated Scaffolds | 293 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.98 % |
| % of genes from short scaffolds (< 2000 bps) | 88.74 % |
| Associated GOLD sequencing projects | 190 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.317 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.526 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.645 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.536 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 293 Family Scaffolds |
|---|---|---|
| PF03721 | UDPG_MGDP_dh_N | 80.20 |
| PF16363 | GDP_Man_Dehyd | 3.75 |
| PF13360 | PQQ_2 | 3.07 |
| PF02698 | DUF218 | 0.68 |
| PF01370 | Epimerase | 0.68 |
| PF01925 | TauE | 0.34 |
| PF13551 | HTH_29 | 0.34 |
| PF01548 | DEDD_Tnp_IS110 | 0.34 |
| PF13570 | PQQ_3 | 0.34 |
| PF01494 | FAD_binding_3 | 0.34 |
| COG ID | Name | Functional Category | % Frequency in 293 Family Scaffolds |
|---|---|---|---|
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 80.20 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 80.20 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 80.20 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 80.20 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 80.20 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.68 |
| COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.34 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.34 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.34 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.34 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.34 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.32 % |
| Unclassified | root | N/A | 0.68 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16844158 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300000789|JGI1027J11758_11919596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100352582 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101558050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300002558|JGI25385J37094_10154170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300002906|JGI25614J43888_10074108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 959 | Open in IMG/M |
| 3300002906|JGI25614J43888_10114791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
| 3300002917|JGI25616J43925_10031444 | All Organisms → cellular organisms → Bacteria | 2346 | Open in IMG/M |
| 3300002917|JGI25616J43925_10361287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10405559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300004080|Ga0062385_10846581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300004082|Ga0062384_100356457 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300004091|Ga0062387_100456318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 879 | Open in IMG/M |
| 3300004091|Ga0062387_101575581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300004139|Ga0058897_10958532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 874 | Open in IMG/M |
| 3300004635|Ga0062388_100928334 | Not Available | 839 | Open in IMG/M |
| 3300005166|Ga0066674_10123715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1211 | Open in IMG/M |
| 3300005166|Ga0066674_10451378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300005180|Ga0066685_10443799 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300005180|Ga0066685_11097968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300005181|Ga0066678_10938817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300005184|Ga0066671_10123674 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
| 3300005187|Ga0066675_10113295 | All Organisms → cellular organisms → Bacteria | 1811 | Open in IMG/M |
| 3300005332|Ga0066388_107521704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300005434|Ga0070709_11035230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300005439|Ga0070711_101449790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300005468|Ga0070707_100104572 | All Organisms → cellular organisms → Bacteria | 2745 | Open in IMG/M |
| 3300005468|Ga0070707_102058932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300005471|Ga0070698_101567940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300005518|Ga0070699_101218844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300005538|Ga0070731_10886107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300005541|Ga0070733_10281455 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300005542|Ga0070732_10674232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300005547|Ga0070693_100071043 | All Organisms → cellular organisms → Bacteria | 2050 | Open in IMG/M |
| 3300005552|Ga0066701_10208470 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300005553|Ga0066695_10201942 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300005554|Ga0066661_10495081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
| 3300005591|Ga0070761_11090448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300005602|Ga0070762_10935723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300005617|Ga0068859_100787893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1039 | Open in IMG/M |
| 3300005842|Ga0068858_102200472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300006041|Ga0075023_100422673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300006046|Ga0066652_101005341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
| 3300006052|Ga0075029_100206998 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300006052|Ga0075029_100492519 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300006163|Ga0070715_10144150 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300006172|Ga0075018_10744072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300006175|Ga0070712_101359008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300006175|Ga0070712_101733816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300006358|Ga0068871_100198901 | All Organisms → cellular organisms → Bacteria | 1729 | Open in IMG/M |
| 3300006796|Ga0066665_10099966 | All Organisms → cellular organisms → Bacteria | 2125 | Open in IMG/M |
| 3300006796|Ga0066665_10360005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1190 | Open in IMG/M |
| 3300006881|Ga0068865_100292391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1301 | Open in IMG/M |
| 3300006893|Ga0073928_10673437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
| 3300006904|Ga0075424_102835950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300006954|Ga0079219_10572568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 817 | Open in IMG/M |
| 3300007255|Ga0099791_10151901 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300007265|Ga0099794_10110278 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300007788|Ga0099795_10013183 | All Organisms → cellular organisms → Bacteria | 2530 | Open in IMG/M |
| 3300009038|Ga0099829_10473161 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300009038|Ga0099829_10521450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 987 | Open in IMG/M |
| 3300009038|Ga0099829_10605739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 911 | Open in IMG/M |
| 3300009088|Ga0099830_10736853 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300009088|Ga0099830_11215414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300009089|Ga0099828_10265572 | All Organisms → cellular organisms → Bacteria | 1541 | Open in IMG/M |
| 3300009089|Ga0099828_10911594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 785 | Open in IMG/M |
| 3300009101|Ga0105247_11340371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300009553|Ga0105249_12620431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300009631|Ga0116115_1049599 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300009792|Ga0126374_10032345 | All Organisms → cellular organisms → Bacteria | 2468 | Open in IMG/M |
| 3300010046|Ga0126384_10464561 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300010322|Ga0134084_10186598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300010358|Ga0126370_10070949 | All Organisms → cellular organisms → Bacteria | 2302 | Open in IMG/M |
| 3300010360|Ga0126372_10307856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1396 | Open in IMG/M |
| 3300010373|Ga0134128_12396350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300010376|Ga0126381_100193658 | All Organisms → cellular organisms → Bacteria | 2712 | Open in IMG/M |
| 3300010376|Ga0126381_100436561 | All Organisms → cellular organisms → Bacteria | 1833 | Open in IMG/M |
| 3300010398|Ga0126383_10714755 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300010398|Ga0126383_10853147 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300010398|Ga0126383_12822761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300011120|Ga0150983_15747921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300011120|Ga0150983_15880528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300011269|Ga0137392_11227722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300011270|Ga0137391_11190262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300011271|Ga0137393_10469368 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300011271|Ga0137393_10508225 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300011271|Ga0137393_10521722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1019 | Open in IMG/M |
| 3300011271|Ga0137393_10612255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 934 | Open in IMG/M |
| 3300011271|Ga0137393_10822921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 793 | Open in IMG/M |
| 3300011271|Ga0137393_10948247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 734 | Open in IMG/M |
| 3300011271|Ga0137393_11005854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300012169|Ga0153990_1085074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300012202|Ga0137363_10307434 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300012202|Ga0137363_10876155 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300012202|Ga0137363_11005965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300012203|Ga0137399_10547184 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300012203|Ga0137399_10708261 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300012205|Ga0137362_10009392 | All Organisms → cellular organisms → Bacteria | 7061 | Open in IMG/M |
| 3300012205|Ga0137362_11673295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300012206|Ga0137380_10902933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
| 3300012206|Ga0137380_11409770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300012210|Ga0137378_10716530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 912 | Open in IMG/M |
| 3300012210|Ga0137378_11169609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300012285|Ga0137370_10861598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300012356|Ga0137371_10140552 | All Organisms → cellular organisms → Bacteria | 1892 | Open in IMG/M |
| 3300012357|Ga0137384_10450518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1059 | Open in IMG/M |
| 3300012361|Ga0137360_11033944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
| 3300012362|Ga0137361_10227433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1694 | Open in IMG/M |
| 3300012363|Ga0137390_10842690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 873 | Open in IMG/M |
| 3300012582|Ga0137358_10069761 | All Organisms → cellular organisms → Bacteria | 2359 | Open in IMG/M |
| 3300012582|Ga0137358_10087907 | All Organisms → cellular organisms → Bacteria | 2097 | Open in IMG/M |
| 3300012683|Ga0137398_10265894 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300012918|Ga0137396_10754074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
| 3300012922|Ga0137394_10080062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2734 | Open in IMG/M |
| 3300012922|Ga0137394_11506239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300012925|Ga0137419_10654370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 848 | Open in IMG/M |
| 3300012927|Ga0137416_11597366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300012929|Ga0137404_10036650 | All Organisms → cellular organisms → Bacteria | 3672 | Open in IMG/M |
| 3300012929|Ga0137404_10146273 | All Organisms → cellular organisms → Bacteria | 1960 | Open in IMG/M |
| 3300012929|Ga0137404_10602792 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300012929|Ga0137404_11160058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300012930|Ga0137407_10022192 | All Organisms → cellular organisms → Bacteria | 4789 | Open in IMG/M |
| 3300012948|Ga0126375_11102369 | Not Available | 654 | Open in IMG/M |
| 3300012961|Ga0164302_10460071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 886 | Open in IMG/M |
| 3300012971|Ga0126369_10261310 | All Organisms → cellular organisms → Bacteria | 1710 | Open in IMG/M |
| 3300012971|Ga0126369_11387754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
| 3300012971|Ga0126369_12591179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300012986|Ga0164304_10114315 | All Organisms → cellular organisms → Bacteria | 1636 | Open in IMG/M |
| 3300012986|Ga0164304_11806985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300013308|Ga0157375_11490680 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300014325|Ga0163163_10816718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 996 | Open in IMG/M |
| 3300014968|Ga0157379_11395166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| 3300015167|Ga0167661_1021897 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1176 | Open in IMG/M |
| 3300015197|Ga0167638_1076861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
| 3300015241|Ga0137418_10371596 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300016341|Ga0182035_10444047 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300016404|Ga0182037_11812486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300016422|Ga0182039_10071686 | All Organisms → cellular organisms → Bacteria | 2453 | Open in IMG/M |
| 3300016445|Ga0182038_10911215 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300016750|Ga0181505_10744310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3121 | Open in IMG/M |
| 3300017659|Ga0134083_10111825 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300017973|Ga0187780_10171202 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
| 3300018001|Ga0187815_10315413 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300018006|Ga0187804_10513194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300018006|Ga0187804_10556923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300018007|Ga0187805_10068663 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
| 3300018062|Ga0187784_10745106 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300018090|Ga0187770_11094295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300018090|Ga0187770_11137801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300018090|Ga0187770_11287174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300018433|Ga0066667_10808544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 798 | Open in IMG/M |
| 3300019890|Ga0193728_1030970 | All Organisms → cellular organisms → Bacteria | 2660 | Open in IMG/M |
| 3300020004|Ga0193755_1179823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300020199|Ga0179592_10227074 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300020199|Ga0179592_10350616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300020579|Ga0210407_10154572 | All Organisms → cellular organisms → Bacteria | 1769 | Open in IMG/M |
| 3300020579|Ga0210407_10397048 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300020579|Ga0210407_10608719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 851 | Open in IMG/M |
| 3300020579|Ga0210407_10630801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
| 3300020581|Ga0210399_10151439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1918 | Open in IMG/M |
| 3300020581|Ga0210399_10435847 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300020581|Ga0210399_10446732 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300020581|Ga0210399_10525037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
| 3300020581|Ga0210399_10821770 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300020582|Ga0210395_10938919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300020583|Ga0210401_11146208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300021086|Ga0179596_10401852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300021088|Ga0210404_10717509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300021168|Ga0210406_10967246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300021171|Ga0210405_10046861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3427 | Open in IMG/M |
| 3300021171|Ga0210405_11281701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300021180|Ga0210396_10074130 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3094 | Open in IMG/M |
| 3300021180|Ga0210396_11321355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300021401|Ga0210393_10084125 | All Organisms → cellular organisms → Bacteria | 2523 | Open in IMG/M |
| 3300021404|Ga0210389_10401515 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300021407|Ga0210383_10021093 | All Organisms → cellular organisms → Bacteria | 5482 | Open in IMG/M |
| 3300021407|Ga0210383_10734619 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300021420|Ga0210394_10263610 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
| 3300021432|Ga0210384_10318745 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1400 | Open in IMG/M |
| 3300021432|Ga0210384_10528806 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300021478|Ga0210402_10213588 | All Organisms → cellular organisms → Bacteria | 1775 | Open in IMG/M |
| 3300021479|Ga0210410_10337191 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300021479|Ga0210410_10962164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300021559|Ga0210409_10112678 | All Organisms → cellular organisms → Bacteria | 2503 | Open in IMG/M |
| 3300021559|Ga0210409_10122312 | All Organisms → cellular organisms → Bacteria | 2392 | Open in IMG/M |
| 3300021559|Ga0210409_11549840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300021560|Ga0126371_10020566 | All Organisms → cellular organisms → Bacteria | 6084 | Open in IMG/M |
| 3300021560|Ga0126371_10638187 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300021560|Ga0126371_11324410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 853 | Open in IMG/M |
| 3300021855|Ga0213854_1015442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300022532|Ga0242655_10201079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300022873|Ga0224550_1004826 | All Organisms → cellular organisms → Bacteria | 1905 | Open in IMG/M |
| 3300024222|Ga0247691_1062943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300024330|Ga0137417_1046805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300024331|Ga0247668_1056653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
| 3300024347|Ga0179591_1027185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2166 | Open in IMG/M |
| 3300025906|Ga0207699_10272360 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300025939|Ga0207665_11016572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300026095|Ga0207676_12153107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300026309|Ga0209055_1076143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1392 | Open in IMG/M |
| 3300026310|Ga0209239_1239965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300026310|Ga0209239_1292102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300026312|Ga0209153_1047897 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
| 3300026330|Ga0209473_1055195 | All Organisms → cellular organisms → Bacteria | 1723 | Open in IMG/M |
| 3300026334|Ga0209377_1146221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 902 | Open in IMG/M |
| 3300026351|Ga0257170_1045875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300026356|Ga0257150_1075871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300026490|Ga0257153_1094149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300026499|Ga0257181_1043913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 731 | Open in IMG/M |
| 3300026530|Ga0209807_1259837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300026537|Ga0209157_1257060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
| 3300026547|Ga0209156_10055579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2083 | Open in IMG/M |
| 3300026548|Ga0209161_10420831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300026555|Ga0179593_1161551 | All Organisms → cellular organisms → Bacteria | 1651 | Open in IMG/M |
| 3300026557|Ga0179587_10104949 | All Organisms → cellular organisms → Bacteria | 1715 | Open in IMG/M |
| 3300026557|Ga0179587_11136088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300026557|Ga0179587_11157696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300026862|Ga0207724_1025258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300027000|Ga0207803_1026636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300027069|Ga0208859_1029262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300027071|Ga0209214_1040436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300027313|Ga0207780_1017638 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
| 3300027562|Ga0209735_1117701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300027667|Ga0209009_1003433 | All Organisms → cellular organisms → Bacteria | 3905 | Open in IMG/M |
| 3300027671|Ga0209588_1047048 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
| 3300027671|Ga0209588_1152093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
| 3300027678|Ga0209011_1116508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 768 | Open in IMG/M |
| 3300027703|Ga0207862_1184628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300027727|Ga0209328_10259004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300027765|Ga0209073_10317426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300027767|Ga0209655_10185360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300027768|Ga0209772_10049085 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300027768|Ga0209772_10162904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
| 3300027829|Ga0209773_10463153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300027846|Ga0209180_10560584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300027853|Ga0209274_10009750 | All Organisms → cellular organisms → Bacteria | 4321 | Open in IMG/M |
| 3300027867|Ga0209167_10052807 | All Organisms → cellular organisms → Bacteria | 2001 | Open in IMG/M |
| 3300027867|Ga0209167_10201325 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300027869|Ga0209579_10578740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300027875|Ga0209283_10055956 | All Organisms → cellular organisms → Bacteria | 2521 | Open in IMG/M |
| 3300027875|Ga0209283_10947001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300028047|Ga0209526_10128956 | All Organisms → cellular organisms → Bacteria | 1776 | Open in IMG/M |
| 3300028047|Ga0209526_10228880 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
| 3300028047|Ga0209526_10875714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300028047|Ga0209526_10991920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300028065|Ga0247685_1008906 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300028138|Ga0247684_1006213 | All Organisms → cellular organisms → Bacteria | 1870 | Open in IMG/M |
| 3300028536|Ga0137415_10811995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
| 3300028536|Ga0137415_10950396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300029636|Ga0222749_10255929 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300029636|Ga0222749_10827957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300030053|Ga0302177_10228104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1015 | Open in IMG/M |
| 3300030741|Ga0265459_11111947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 849 | Open in IMG/M |
| 3300030862|Ga0265753_1059597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 698 | Open in IMG/M |
| 3300031057|Ga0170834_102518756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300031057|Ga0170834_112639135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 698 | Open in IMG/M |
| 3300031231|Ga0170824_113135895 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1220 | Open in IMG/M |
| 3300031231|Ga0170824_128499491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300031640|Ga0318555_10715325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300031681|Ga0318572_10920155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300031718|Ga0307474_10086947 | All Organisms → cellular organisms → Bacteria | 2330 | Open in IMG/M |
| 3300031718|Ga0307474_10097866 | All Organisms → cellular organisms → Bacteria | 2192 | Open in IMG/M |
| 3300031718|Ga0307474_10563592 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300031719|Ga0306917_10524995 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300031720|Ga0307469_10966310 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300031744|Ga0306918_11139145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300031753|Ga0307477_10542712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
| 3300031771|Ga0318546_11166190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300031798|Ga0318523_10673439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300031833|Ga0310917_11149976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300031941|Ga0310912_10273362 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300031941|Ga0310912_11327775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300031962|Ga0307479_10257225 | All Organisms → cellular organisms → Bacteria | 1725 | Open in IMG/M |
| 3300031962|Ga0307479_10756984 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300032039|Ga0318559_10252919 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300032066|Ga0318514_10298694 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300032076|Ga0306924_11942189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300032091|Ga0318577_10443734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300032174|Ga0307470_10035478 | All Organisms → cellular organisms → Bacteria | 2419 | Open in IMG/M |
| 3300032174|Ga0307470_10480073 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300032180|Ga0307471_100536714 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
| 3300032180|Ga0307471_100850747 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300032180|Ga0307471_101948591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 736 | Open in IMG/M |
| 3300032180|Ga0307471_103214003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300032261|Ga0306920_101887577 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300032261|Ga0306920_102493826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
| 3300032261|Ga0306920_102758877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300032782|Ga0335082_10521436 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300032783|Ga0335079_10908060 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300032898|Ga0335072_11626638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300032954|Ga0335083_11156549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300033806|Ga0314865_166576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300033807|Ga0314866_038975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.46% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.46% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.44% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.41% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.07% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.05% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.05% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.71% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.37% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.37% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.37% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.37% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.02% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.02% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.68% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.68% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.34% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.34% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.34% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.34% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.34% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.34% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.34% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.34% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.34% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.34% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.34% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.34% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012169 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC074 MetaG | Host-Associated | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015167 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021855 | Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
| 3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026862 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 31 (SPAdes) | Environmental | Open in IMG/M |
| 3300027000 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 41 (SPAdes) | Environmental | Open in IMG/M |
| 3300027069 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002 (SPAdes) | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027313 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028065 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK26 | Environmental | Open in IMG/M |
| 3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033806 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20 | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_01485890 | 2088090014 | Soil | GEIHRDHSTRLLWNVLRRQPRLILLGLRGLLMGVRPRSSF |
| JGI1027J11758_119195962 | 3300000789 | Soil | DESARLLWNVVRRQPRLVLLGLRGLLMGKAERASQV* |
| JGIcombinedJ26739_1003525821 | 3300002245 | Forest Soil | LLNAATRETLSEVTRDESTRLLWKVLRHQPQLVLLGLRGLLLGWNSERR* |
| JGIcombinedJ26739_1015580501 | 3300002245 | Forest Soil | LLDASTRQSLGEINRDESARLLWNVVRRQPRLVLLGLRGLLMGKTGTN* |
| JGI25385J37094_101541702 | 3300002558 | Grasslands Soil | VDLLDASTRESLGEINRDDSTRLLWNVVRRQPRLALLGLRGLLMGKRTNP* |
| JGI25614J43888_100741081 | 3300002906 | Grasslands Soil | LVDLLNAATRETLSEITRDESTRLLWNVLRRQPQLVLLGLRGLLLGWSSERR* |
| JGI25614J43888_101147911 | 3300002906 | Grasslands Soil | LVDLLNAATRETLSEITRDESTRLLWNVLRRQPQLVLLGLRGLLLGWNSERR* |
| JGI25616J43925_100314443 | 3300002917 | Grasslands Soil | LLDASTRQSLGEINRDESTRLLWNVVRCQPRLVLLGLRGLLMGKAERS* |
| JGI25616J43925_103612871 | 3300002917 | Grasslands Soil | ASTRQSLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKTERS* |
| JGIcombinedJ51221_104055592 | 3300003505 | Forest Soil | DLLDASTRRSLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKTEKN* |
| Ga0062385_108465811 | 3300004080 | Bog Forest Soil | LNVSARKSLGEINRDESTRLLWNVVRSQPKLVLLGLRGLLLGRR* |
| Ga0062384_1003564572 | 3300004082 | Bog Forest Soil | DLLNDSTRESLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGRGLKS* |
| Ga0062387_1004563181 | 3300004091 | Bog Forest Soil | TRESLGEINRDESTRLLWQVVRRQPRLVLLGLRGLLMGSANKA* |
| Ga0062387_1015755811 | 3300004091 | Bog Forest Soil | STRESLGEISRDESTRLLWNVVKRQPRLVLLGLRGLLLGRK* |
| Ga0058897_109585321 | 3300004139 | Forest Soil | LSEITRDESARLLWNVLRRQPQLVLLGLRGLLLGWNSERR* |
| Ga0062388_1009283342 | 3300004635 | Bog Forest Soil | HLVDLLNVSTRESLGEINRDESTRLLWSVVRRQPKLVLLGLRGLLLGKK* |
| Ga0066674_101237151 | 3300005166 | Soil | ATRESLGEIHRDHSTKLLWSVLRRQPRLVLLGLRGLLMGKGPR* |
| Ga0066674_104513782 | 3300005166 | Soil | QSLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKAERG* |
| Ga0066685_104437992 | 3300005180 | Soil | LATRESLGEIHRDHSTKLLWSVLRRQPRLVLLGLRGLLMGKGPR* |
| Ga0066685_110979681 | 3300005180 | Soil | DASTRQSLGEINRDESARLLWNVVRRQPRLVLLGLRGLLMGKAERCIRV* |
| Ga0066678_109388171 | 3300005181 | Soil | ATRESLGEIHRDHSTQLLWSVLRRQPQLVLLGLRGLLMGKRPR* |
| Ga0066671_101236741 | 3300005184 | Soil | SLGEIHRDESTRLLWNLVRRQPRLLLLGLRGLLMGRGFKN* |
| Ga0066675_101132951 | 3300005187 | Soil | SLGEIHRDESTRLLWNLIRRQPRLLLLGLRGLLMGQRAKN* |
| Ga0066388_1075217041 | 3300005332 | Tropical Forest Soil | TRESLGEIHRDHSTRLLWTVLRRQPRLILLGLRGLLMGARPR* |
| Ga0070709_110352302 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | QKDYSCLVDLLNVATRESLGQIHRDHSTRLLWSVLRRQPRLILLGLRGLLMGMKPR* |
| Ga0070711_1014497901 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | HHFAQEHYSYLVDLLNSATRESLGEIHRDHSTRLLWNVLRRQPRLILLGLRGLLMGGRPRSSF* |
| Ga0070707_1001045723 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | RESLGQIHRDHSTRLLWSVLRRQPRLVLLGLRGLLMGIKPR* |
| Ga0070707_1020589321 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | SLGEINRDDSTRLLWNVVRRQPRLALLGLRGLLMGKRTKP* |
| Ga0070698_1015679403 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LGEINRDESARLLWNVVRRQPRLVLLGLRGLLMGKAERSIRV* |
| Ga0070699_1012188442 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LNAATRESLGEIHRDHSTRLLWNVIRRQPRLLLLGLRGLLMGKKPR* |
| Ga0070731_108861072 | 3300005538 | Surface Soil | LVDLLNDSARESLGEINRDESTRLLWNVIRRQPKLVLLGLRGLLLGKR* |
| Ga0070733_102814552 | 3300005541 | Surface Soil | GEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGRGIKDGPA* |
| Ga0070732_106742322 | 3300005542 | Surface Soil | HLVDLLSLATRNTLSEINRDESARLLWTVLRRQPRLALLGLRGLLLGRNSAGRPANASA* |
| Ga0070693_1000710433 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | DLLNAATRETLSEVTRDESTRLLWNVLRHQPQLVLLGLRGLLLGRNSDRR* |
| Ga0066701_102084701 | 3300005552 | Soil | HRFKQNDYSQLVDLLDASTRESLGEINRDDSTRLLWNVVRRQPRLALLGLRGLLMGKRTNP* |
| Ga0066695_102019421 | 3300005553 | Soil | QSLGEINRDESTRLLWKVVRRQPRLVLLGLRGLLMGKAERG* |
| Ga0066661_104950812 | 3300005554 | Soil | ASTRESLGEINRDESTRLLWSVIRRQPKLVLLGLRGLLLGKK* |
| Ga0070761_110904481 | 3300005591 | Soil | RRALHHFCQDDYCRLVDLLNDSARASLGEINRDESTRLLWNVLRRQPKLVLLGLRGLLLGRR* |
| Ga0070762_109357232 | 3300005602 | Soil | GAINRDESTRLLWNVVCRQPRLVLLGLRGLLMGRGLKD* |
| Ga0068859_1007878931 | 3300005617 | Switchgrass Rhizosphere | TLHHFEQEHYSYLVDLLNSATRESLGEIHRDHSTRLLWNVLRRQPRLILLGLRGLLMGVRPRSSF* |
| Ga0068858_1022004721 | 3300005842 | Switchgrass Rhizosphere | HHFEQKDYSYLVDLLNSATRESLGEIHRDHSTKLLWTVLRRQPRLILLGLRGLLMGSRPR |
| Ga0075023_1004226731 | 3300006041 | Watersheds | EINRDESARLLWNVVRRQPRLVLLGLRGLLMGKTERS* |
| Ga0066652_1010053412 | 3300006046 | Soil | LGEINRDESTRLLWNVVRRQPRLLLLGLRGLLMGKAESS* |
| Ga0075029_1002069982 | 3300006052 | Watersheds | LVDLLDGSMQESLGSINRDESTRLLWNLVRRKPKLALLGLRGLLMGRSFRG* |
| Ga0075029_1004925192 | 3300006052 | Watersheds | QLVDLLNVSARESLGEINRDESTKLLWSVVRRQPKLVLLGLRGLLLGKK* |
| Ga0070715_101441501 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | YLVDLLNLATRESLGEIHRDHSTELLWSVLRRQPRLVLLGLRGLLMGKGPR* |
| Ga0075018_107440721 | 3300006172 | Watersheds | LDASTRESLGEVNRDEATKLLWNVIRHQPSLMLLGLRGLLLGKNSRPRPASV* |
| Ga0070712_1013590081 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | STRESLGEINRDESTRLLWSVVRNQPKLVLMGLRGLLLGRR* |
| Ga0070712_1017338161 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | NSATRESLGEIHRDHSTRLLWTVLRRQPRLVLLGLRGLLMGKKPR* |
| Ga0068871_1001989011 | 3300006358 | Miscanthus Rhizosphere | ESLGETHRDDSTRLLWNVIRKQPRLALLGLRGLLMGRKPR* |
| Ga0066665_100999661 | 3300006796 | Soil | INRDESTKLLWNVIRRQPRLVLMGLRGLLMGKRAQ* |
| Ga0066665_103600052 | 3300006796 | Soil | RDESTRLLWNVVRRQPRLVLLGLRGLLMGKAERS* |
| Ga0068865_1002923911 | 3300006881 | Miscanthus Rhizosphere | LGEIHRDHSTKLLWTVLRRQPRLILLGLRGLLMGSRPR* |
| Ga0073928_106734371 | 3300006893 | Iron-Sulfur Acid Spring | TRVSLGEINRDESTRLLWNVIRRQPQLVLLGLRGLLMGKRNS* |
| Ga0075424_1028359502 | 3300006904 | Populus Rhizosphere | DLLNSATRESLGEIHRDHSMRLLWNVIRRQPRLILLGLRGLLMGARPR* |
| Ga0079219_105725682 | 3300006954 | Agricultural Soil | EHYSQLVDLLNGATRETLSEVTRDESARLLWNVLRRQPQLVLLGLRGLLLGWNSERR* |
| Ga0099791_101519011 | 3300007255 | Vadose Zone Soil | RDESTRLLWNVVRRQPRLVLLGLRGLLMGKTERS* |
| Ga0099794_101102782 | 3300007265 | Vadose Zone Soil | LGEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKAERS* |
| Ga0099795_100131833 | 3300007788 | Vadose Zone Soil | LGQIHRDHSTRLLWNVLRRQPRLVLLGLRGLLMGRKPR* |
| Ga0099829_104731612 | 3300009038 | Vadose Zone Soil | RQSLGEINRDESTRLLWNVVRRRPRLVLLGLRGLLMGKAERS* |
| Ga0099829_105214502 | 3300009038 | Vadose Zone Soil | LGEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKTERS* |
| Ga0099829_106057392 | 3300009038 | Vadose Zone Soil | SRLVDLLNASTRETLSEITRDESTRLLWNVLRRRPQLVLLGLRGLLLGRNGSKRSF* |
| Ga0099830_107368532 | 3300009088 | Vadose Zone Soil | GEINRDESTRLLWNVIRRQPKLVLLGLRGLLLGKR* |
| Ga0099830_112154142 | 3300009088 | Vadose Zone Soil | DASTRQSLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKAARG* |
| Ga0099828_102655721 | 3300009089 | Vadose Zone Soil | QQKDYSQLVDLLDASTRQSLGEINRDESTRLLWNVVRRQPRLVVLGLRGLLTGRGLKG* |
| Ga0099828_109115942 | 3300009089 | Vadose Zone Soil | LLDASTRQSLGEINRDESTRLLWNVVRRQPRLMLLGLRGLLMGRTERS* |
| Ga0105247_113403711 | 3300009101 | Switchgrass Rhizosphere | LLNSATRESLGEIHRDHSTRLLWNVLRRQPRLILLGLRGLLMGVRPRSSF* |
| Ga0105249_126204311 | 3300009553 | Switchgrass Rhizosphere | EHYSYLVDLLNSATRESLGEIHRDHSTRLLWNVLRRQPRLILLGLRGLLMGVRPRSSF* |
| Ga0116115_10495991 | 3300009631 | Peatland | RLVDLLDVSTRESLGEINRDESTRLLWNLVRRQPRLALLGLRGLLLGKR* |
| Ga0126374_100323453 | 3300009792 | Tropical Forest Soil | VDLLNSATRESLGEIHRDHSTRLLWNVLRRQPRLILLGLRGLLMGVRPRSSF* |
| Ga0126384_104645611 | 3300010046 | Tropical Forest Soil | KTLHHFEQKHYSYLVDLLNSATRESLGEIHRDHSTRLLWTVLRRQPRLILLGLRGLLMGARPR* |
| Ga0134084_101865982 | 3300010322 | Grasslands Soil | RESLAEFHRDESTRLLWNLVRRQPRLLLIGLRGLLMGRRIRG* |
| Ga0126370_100709491 | 3300010358 | Tropical Forest Soil | SLGEINRDESTRLLWNVVRNQPKLVLMGLRGLLLGRR* |
| Ga0126372_103078561 | 3300010360 | Tropical Forest Soil | TLHHFEQKHYSCLVDLLNSATRASLGEIHRDESTRLLWTVFRHQPRLILLGLRGLLIGKRPR* |
| Ga0134128_123963502 | 3300010373 | Terrestrial Soil | FQQKDYSHLVDLMNIATRNTLSEINRDESARLLWTVLRRQPRLALLGLRGLLLGRNPTPPAANI* |
| Ga0126381_1001936583 | 3300010376 | Tropical Forest Soil | SQLVDLLNVSARESLGEINRDESTRLLWSVLRRQPKLVLLGLRGLLHGRK* |
| Ga0126381_1004365613 | 3300010376 | Tropical Forest Soil | RESLGEINRDESTRLLWNVARRQPKLVLLGLRGLLLGKKG* |
| Ga0126383_107147552 | 3300010398 | Tropical Forest Soil | RESLGEINRDESTRLLWNVVRRQPKLVLLGLRGLLLGKKG* |
| Ga0126383_108531472 | 3300010398 | Tropical Forest Soil | LLNSATRESLGEIHRDHSTRLLWTVLRRQPRLILLGLRGLLMGARPR* |
| Ga0126383_128227612 | 3300010398 | Tropical Forest Soil | DLLNASARESLGEISRDESTRLLWSVVRRQPELVLLGLRGLLLGRK* |
| Ga0150983_157479212 | 3300011120 | Forest Soil | LSEVTRDESTRLLWHVLRRQPQLALLGLRGLLLGWNSERR* |
| Ga0150983_158805281 | 3300011120 | Forest Soil | LLNASTRESLGEINRDESTRLLWNVIRRQPKLVLLGLRGLLLGKR* |
| Ga0137392_112277221 | 3300011269 | Vadose Zone Soil | SLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKTERS* |
| Ga0137391_111902621 | 3300011270 | Vadose Zone Soil | EINRDESARLLWNVVRRQPRLVLLGLRGLLMGKTEKG* |
| Ga0137393_104693681 | 3300011271 | Vadose Zone Soil | INRDESTRLLWNVVRRQPRLVLLGLRGLLMGKAERS* |
| Ga0137393_105082251 | 3300011271 | Vadose Zone Soil | EINRDESTRLLWNVVRHQPRLVLLGLRSLLMGKAERS* |
| Ga0137393_105217221 | 3300011271 | Vadose Zone Soil | SLGEIHRDHSTRLLWNVIRRQPRLLLLGLRGLLMGKKPR* |
| Ga0137393_106122551 | 3300011271 | Vadose Zone Soil | RQSLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLTGRGLKG* |
| Ga0137393_108229212 | 3300011271 | Vadose Zone Soil | RALHHFKQADYSELVDLLNDSTRESLGEINRDESTRLLWNVIRRQPKLVLLGLRGLLLGKR* |
| Ga0137393_109482472 | 3300011271 | Vadose Zone Soil | DASTRQSLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKTERS* |
| Ga0137393_110058543 | 3300011271 | Vadose Zone Soil | DASTRQSLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKTARG* |
| Ga0153990_10850742 | 3300012169 | Attine Ant Fungus Gardens | NAATRETLSEVTRDESTRLLWNVLRRQPQLVLLGLRGLLLGWNSDRR* |
| Ga0137363_103074341 | 3300012202 | Vadose Zone Soil | FQQEDYSQLVDLLSAATRDTLGEITRDESTRLLWHVLWRQPQLVLLGLRGLLLGWNSARR |
| Ga0137363_108761552 | 3300012202 | Vadose Zone Soil | LNASTRESLGEINRDESTRLLWNVIRRQPKLVLLGLRGLLLGKK* |
| Ga0137363_110059652 | 3300012202 | Vadose Zone Soil | STRQSLGDINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKAERS* |
| Ga0137399_105471841 | 3300012203 | Vadose Zone Soil | QIHRDHSTRLLWNVLRRQPRLVLLGLRGLLMGKKDR* |
| Ga0137399_107082611 | 3300012203 | Vadose Zone Soil | HHFKQADYSELVDLLNDSARESLGEINRDESTRLLWNVIRRQPKLVLLGLRGLLLGKR* |
| Ga0137362_100093921 | 3300012205 | Vadose Zone Soil | SLGDINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKAERS* |
| Ga0137362_116732952 | 3300012205 | Vadose Zone Soil | ALHHFKQADYSELVDLLNDSTRESLGEINRDESTRLLWNVIRRQPKLVLLGLRGLLLGKR |
| Ga0137380_109029332 | 3300012206 | Vadose Zone Soil | EINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKGIKS* |
| Ga0137380_114097701 | 3300012206 | Vadose Zone Soil | RDESTRLLWNVVRRQPRLVLLGLRGLLMGKGIKS* |
| Ga0137378_107165301 | 3300012210 | Vadose Zone Soil | SRLVDLLDASARESLGEITRDEAARLLWSVARRQPRLLLLGLRGLLLGHRELRP* |
| Ga0137378_111696092 | 3300012210 | Vadose Zone Soil | SLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKAESS* |
| Ga0137370_108615982 | 3300012285 | Vadose Zone Soil | LDASTRQSLGEINRDESTRLLWNVVRRQPRLLLLGLRGLLMGKAESS* |
| Ga0137371_101405523 | 3300012356 | Vadose Zone Soil | LVDLLDASARESLGEITRDDAVRLLWSVARRQPRLLLLGLRGLLLGHRELRP* |
| Ga0137384_104505182 | 3300012357 | Vadose Zone Soil | LLDASTRQSLGEITRDESTRLLWNVVRRQPRLVLLGLRGLLMGKTERS* |
| Ga0137360_110339441 | 3300012361 | Vadose Zone Soil | QKDYSHLVDLLNAATRESLGEIHRDQSTKLLWNVIRNQPRLALLGLRGLLMGKKTR* |
| Ga0137361_102274332 | 3300012362 | Vadose Zone Soil | QSLGDINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKAERS* |
| Ga0137390_108426902 | 3300012363 | Vadose Zone Soil | STRQSLGEINRDESNRLLWNVVRRQPRLVLLGLRGLLMGKGIKS* |
| Ga0137358_100697611 | 3300012582 | Vadose Zone Soil | SLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKRAR* |
| Ga0137358_100879071 | 3300012582 | Vadose Zone Soil | INRDESARLLWNVVRRQPRLVLLGLRGLLMGKAERCIRV* |
| Ga0137398_102658942 | 3300012683 | Vadose Zone Soil | LLDASTRQSLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKTERS* |
| Ga0137396_107540742 | 3300012918 | Vadose Zone Soil | SLGKINRDESARLLWNVILQQPRLVLLGLRGMLMGMAERGIKF* |
| Ga0137394_100800621 | 3300012922 | Vadose Zone Soil | TRQSLGEINRDESARLLWNVVRRQPRLVLLGLRGLLMGRAEPSIQV* |
| Ga0137394_115062391 | 3300012922 | Vadose Zone Soil | HRDHSTELLWSVLRRQPRLVLLGLRGLLMGKGPR* |
| Ga0137419_106543701 | 3300012925 | Vadose Zone Soil | YSYLVDLLNLSTRETLSEITRDEAARLLWNVLRRQPRLALLGLRGLLLGRSNAPRPDSA* |
| Ga0137416_115973661 | 3300012927 | Vadose Zone Soil | QSLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKAVRS* |
| Ga0137404_100366505 | 3300012929 | Vadose Zone Soil | VDLLNAATRETLSEVTRDESTRLLWNVLRRQPQLILLGLRGLLLGWNGERR* |
| Ga0137404_101462731 | 3300012929 | Vadose Zone Soil | LLNDSTRESLGEINRDESTRLLWNVIRRQPKLVLLGLRGLLLGKR* |
| Ga0137404_106027921 | 3300012929 | Vadose Zone Soil | ESARLLWNVVRRQPRLVLLGLRGLLMGKAERSIQV* |
| Ga0137404_111600581 | 3300012929 | Vadose Zone Soil | SQLVDLLDASTRQSLGEINRDESARLLWNVVRRQPRLMLLGLRGLLMGKAERSIRV* |
| Ga0137407_100221921 | 3300012930 | Vadose Zone Soil | DYSYLVDLLNSATRESLGEIHRDHSTQLLWSVLRRQPQLVLLGLRGLLMGKRPR* |
| Ga0126375_111023691 | 3300012948 | Tropical Forest Soil | LLDASTRESLGEIHRDESTRLLWNLVRRQPRLALLGLRGLLMGKRMKR* |
| Ga0164302_104600712 | 3300012961 | Soil | VDLLNFSTRDTLSVINRDESTRLLWNVLRRQPRLVLLGLRGLLLGKSVRPVAN* |
| Ga0126369_102613103 | 3300012971 | Tropical Forest Soil | HFEQKHYSYLVDLLNRATRESLGEIHRDHSTRLLWTVLRRQPRLILLGLRGLLMGARTR* |
| Ga0126369_113877541 | 3300012971 | Tropical Forest Soil | TLHHFEQKHYSYLVDLLNSATRESLGEIHRDHSTRLLWTVLRRQPRLILLGLRGLLMGARPR* |
| Ga0126369_125911792 | 3300012971 | Tropical Forest Soil | TRESLGEINRDESTRLLWNVIRRQPRLVLLGLRGLLMGRRAQ* |
| Ga0164304_101143151 | 3300012986 | Soil | NRDESTRLLWNVLRRQPRLVLLGLRGLLLGKSVRPVAN* |
| Ga0164304_118069851 | 3300012986 | Soil | QLVDLLNLSTRDTLSEINRDESTRLLWNVLRRQPRLALLGLRGLLLGKNTTARPRSLQ* |
| Ga0157375_114906802 | 3300013308 | Miscanthus Rhizosphere | LVDLLNSATRESLGEIHRDHSTRLLWNVLRRQPRLILLGLRGLLMGVRPRSSF* |
| Ga0163163_108167182 | 3300014325 | Switchgrass Rhizosphere | ESLGEIHRDHSTRLLWNVLRRQPRLILLGLRGLLMGVRPRSSF* |
| Ga0157379_113951662 | 3300014968 | Switchgrass Rhizosphere | RESLGEIHRDHSTRLLWNVLRRQPRLILLGLRGLLMGVRPRSSF* |
| Ga0167661_10218972 | 3300015167 | Glacier Forefield Soil | LLNAATRESLGEIHRDHSTRLLWNVIRRQPRLVLLGLRGLLMGKKPR* |
| Ga0167638_10768611 | 3300015197 | Glacier Forefield Soil | LVDLLDASILASLAEINRDESTRLLWNVIRRQPQLVLLGLRGLLMGKRHP* |
| Ga0137418_103715961 | 3300015241 | Vadose Zone Soil | KDYSYLVDLLNLSTRETLSEITRDEAARLLWNVLRRQPRLALLGLRGLLLGRSNAPRPDSA* |
| Ga0182035_104440471 | 3300016341 | Soil | QEDYSQLVDLLNASARESLGEINRDESTRLLWNVLRRQPKLVLLGLRGLLLGRK |
| Ga0182037_118124861 | 3300016404 | Soil | EINRDESTRLLWNVVRRQPKLVLLGLRGLLMGRGTRPLMRRAAG |
| Ga0182039_100716861 | 3300016422 | Soil | ESLGEINRDEATRLLWSLVRRQPRLALLGLRGLLLGRR |
| Ga0182038_109112151 | 3300016445 | Soil | EYRQLVDMLNVSTRESLAEINRDEAARLLWNVVRRQPQLVLLGLRGLLLGKR |
| Ga0181505_107443104 | 3300016750 | Peatland | LVDMLNDSTRESLGEINRDESTRLLWNVVRRQPQLVLLGLRGLLLGRR |
| Ga0134083_101118252 | 3300017659 | Grasslands Soil | LLDASTRQSLGEINRDESTRLLWNVVRRQPRLVILGLRGLLMGKGIKS |
| Ga0187780_101712022 | 3300017973 | Tropical Peatland | LVDMLSNSTRESLGEINRDESTRLLWNVLRKQPKLVLLGLRGLLLGRR |
| Ga0187815_103154133 | 3300018001 | Freshwater Sediment | HFQQGDYCRLVDMLNDSTRESLGEINRDESTRLLWDVIRRQPRLALLGLRGLLLGRR |
| Ga0187804_105131942 | 3300018006 | Freshwater Sediment | LNDSARESLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLLGRR |
| Ga0187804_105569232 | 3300018006 | Freshwater Sediment | RESLGEINRDESTRLLWSVVRRQPKLALLGLRGLLLGKKA |
| Ga0187805_100686631 | 3300018007 | Freshwater Sediment | RLVDMLNHSTLESLGEINRDESTRLLWNVVRRQPRLALLGLRGLLLGRR |
| Ga0187784_107451062 | 3300018062 | Tropical Peatland | YFQQEDYCRLVDMLNDSTRESLGEIHRDESTKLLWNVVRRQPRLALLGLRGLLIGRR |
| Ga0187770_110942952 | 3300018090 | Tropical Peatland | DESTRLLWKVLRQQPRLVLLGLRGLLMGRAIRKEPKAL |
| Ga0187770_111378011 | 3300018090 | Tropical Peatland | EDYCQLVDMLNDSARESLGAISRDESTRLLWNVLRRQPRLALLGLRGLLLGRR |
| Ga0187770_112871741 | 3300018090 | Tropical Peatland | NDSTRESLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLLGRR |
| Ga0066667_108085441 | 3300018433 | Grasslands Soil | QSLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKAERD |
| Ga0193728_10309703 | 3300019890 | Soil | GQIHRDHSTRLLWNVLRRQPRLVLLGLRGLLMGKKDR |
| Ga0193755_11798231 | 3300020004 | Soil | VATRESLGQIHRDHSTRLLWNVLRRQPRLVLLGLRGLLMGRKPR |
| Ga0179592_102270741 | 3300020199 | Vadose Zone Soil | HFKQADYSELVDLLNDSTRESLGEINRDESTRLLWNVIRRQPKLVLLGLRGLLLGKR |
| Ga0179592_103506161 | 3300020199 | Vadose Zone Soil | VDLLNTATRETLSEVTRDESTRLLWHVLRRQPQLILLGLRGLLLGWNSERR |
| Ga0210407_101545722 | 3300020579 | Soil | MLNVSTRESLGEINRDESTRLLWHVIRRQPKLALLGLRGLLLGKR |
| Ga0210407_103970481 | 3300020579 | Soil | HLVDLMNLSTRNTLSEITRDESARLLWNVLRRQPRLALLGLRGLLLGRNAAPPSASS |
| Ga0210407_106087191 | 3300020579 | Soil | LSEITRDESARLLWNVLRRQPQLVLLGLRGLLLGWNSQRR |
| Ga0210407_106308012 | 3300020579 | Soil | GEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKTGKN |
| Ga0210399_101514392 | 3300020581 | Soil | LDASTRQSLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKADRS |
| Ga0210399_104358471 | 3300020581 | Soil | TRESLGEINRDESTRLLWNVIRRQPKLVLLGLRGLLLGKR |
| Ga0210399_104467321 | 3300020581 | Soil | LVDLLNAATRDTLSEITRDESTRLLWNVLWRQPQLVLLGLRGLLLGWNSARR |
| Ga0210399_105250372 | 3300020581 | Soil | EINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKSERV |
| Ga0210399_108217702 | 3300020581 | Soil | SLGEINRDESTRLLWNVILRQPKLVLLGLRGLLLGKR |
| Ga0210395_109389192 | 3300020582 | Soil | YSHLVDLLNIATRNTLSEINRDESARLLWTVLRRQPRLALLGLRGLLLGRSAAPRTVNAS |
| Ga0210401_111462081 | 3300020583 | Soil | LLDASTRESLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKGLKN |
| Ga0179596_104018522 | 3300021086 | Vadose Zone Soil | INRDESTRLLWNVVRRQPRLVLLGLRGLLMGKAERS |
| Ga0210404_107175091 | 3300021088 | Soil | DASTRQSLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKAVRS |
| Ga0210406_109672462 | 3300021168 | Soil | EINRDESTRLLWNVVLRQPRLVLLGLRGLLMGRGLKS |
| Ga0210405_100468612 | 3300021171 | Soil | QSLGEINRDEATRLLWNVVRRQPRLVLLGLRGLLMGKTEKSYKS |
| Ga0210405_112817012 | 3300021171 | Soil | LDASTREAVGEISRYESRRLLWNVVKRQPRLVLLGLRGLLMGRSLKS |
| Ga0210396_100741301 | 3300021180 | Soil | RDEASRLLWNVVRRQPRLVLLGLRGLLMGKTEKSYKL |
| Ga0210396_113213551 | 3300021180 | Soil | RALHRFKQADYSELVDLLNASTRESLGEINRDESTRLLWNVIRRQPKLVLLGLRGLLLGK |
| Ga0210393_100841251 | 3300021401 | Soil | CRLVDMLNDSARESLGEINRDESTRLLWNVLRRQPKLALLGLRGLLLGRR |
| Ga0210389_104015151 | 3300021404 | Soil | QQEDYSHLVDLLNITTRNTLSEINRDESARLLWTVLRRQPRLALLGLRGLLLGKNAAPRTVNAST |
| Ga0210383_100210931 | 3300021407 | Soil | VAIRVSLGAINRDESTRLLWNVVCRQPRLVLLGLRGLLMGRSLKD |
| Ga0210383_107346193 | 3300021407 | Soil | DLLNASTRESLGEINRDESSRLLWNVIRRQPKLVLLGLRGLLLGRR |
| Ga0210394_102636101 | 3300021420 | Soil | DASTRESLGEINRDESTRLLWNVVLRQPRLVLLGLRGLLMGRGLKS |
| Ga0210384_103187451 | 3300021432 | Soil | SLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKAVRS |
| Ga0210384_105288061 | 3300021432 | Soil | STRESLGEINRDESTRLLWNVIRRQPKLVLLGLRGLLLGKR |
| Ga0210402_102135881 | 3300021478 | Soil | LGEINRDESTRLLWNVVRRQPRLVLMGLRGLLLGKNSKRFV |
| Ga0210410_103371911 | 3300021479 | Soil | QQKDYSELVDLLDASTRQSLGEINRDESSRLLWNVVRRQPRLILLGLRGLLMEKTAKS |
| Ga0210410_109621642 | 3300021479 | Soil | SLGEINRDESTRLLWNVIRRQPKLVLLGLRGLLLGKR |
| Ga0210409_101126781 | 3300021559 | Soil | STRQSLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKTERS |
| Ga0210409_101223121 | 3300021559 | Soil | TSTRESLGEINRDESARLLWNVVRRQPRLVLLGLRGLLMGKADKT |
| Ga0210409_115498402 | 3300021559 | Soil | RLVDLLNAATRKTLSEVTRDESTRLLWNVLRRQPQLILLGLRGLLLGWNGERR |
| Ga0126371_100205667 | 3300021560 | Tropical Forest Soil | SARESLAEFHRDESARLLWNLVRRQPRLLLLGLRGLLMGRKIRD |
| Ga0126371_106381871 | 3300021560 | Tropical Forest Soil | NHSTRESLGEINRDESTKLLWNVVRRQPRLVLLGLRGLLLGRR |
| Ga0126371_113244102 | 3300021560 | Tropical Forest Soil | SARESLAEFHRDESARLLWNLVRRQPRLLLLGLRGLLMGRRIKD |
| Ga0213854_10154421 | 3300021855 | Watersheds | QLVDLLDISTRQSLGEINRDESTRLLCNVVRRQPRLVLLGLRGLLMGKADRS |
| Ga0242655_102010791 | 3300022532 | Soil | TRESLGAINRDESTRLLWNVVCRQPRLVLLGLRGLLMGRSLKD |
| Ga0224550_10048262 | 3300022873 | Soil | AGESLGEINRDESTRLLWQVVRRQPRLVLLALRGLLMGSPAKL |
| Ga0247691_10629432 | 3300024222 | Soil | RESLGEINRDESTRLLWNVIRRQPKLVLLGLRGLLLGKR |
| Ga0137417_10468051 | 3300024330 | Vadose Zone Soil | RRGNRESLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKAERS |
| Ga0247668_10566531 | 3300024331 | Soil | LLNSATRESLGEIHRDHSTRLLWNVLRRQPRLILLGLRGLLMGVRPRSSF |
| Ga0179591_10271852 | 3300024347 | Vadose Zone Soil | VDLLNAATRETLSEVTRDESTRLLWNVLRRQPQLILLGLRGLLLGWNSERR |
| Ga0207699_102723602 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | SELVDLLNASTRESLGEINRDESTRLLWNVIRRQPKLVLLGLRGLLLGKK |
| Ga0207665_110165722 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | STRESLGEINRDESTRLLWNVVRNQPKLVLLGLRGLLLGRR |
| Ga0207676_121531072 | 3300026095 | Switchgrass Rhizosphere | QEHYSYLVDLLNSATRESLGEIHRDHSTRLLWNVLRRQPRLILLGLRGLLMGVRPRSSF |
| Ga0209055_10761431 | 3300026309 | Soil | INRDESTRLLWNVVRRQPRLVLLGLRGLLMGKAESS |
| Ga0209239_12399652 | 3300026310 | Grasslands Soil | DLLDASTRQSLGEINRDESTRLLWSVVRRQPRLVLLGLRGLLMGKAESS |
| Ga0209239_12921021 | 3300026310 | Grasslands Soil | DASTRQSLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKAERG |
| Ga0209153_10478971 | 3300026312 | Soil | RESLGEIHRDESTRLLWNLVRRQPRLLLLGLRGLLMGRGFKN |
| Ga0209473_10551951 | 3300026330 | Soil | GEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKAERG |
| Ga0209377_11462211 | 3300026334 | Soil | STRQSLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKAERG |
| Ga0257170_10458752 | 3300026351 | Soil | HFKQADYSELVDLLNASTRESLGEINRDESTKLLWNVIRRQPKLVLLGLRGLLLGKR |
| Ga0257150_10758712 | 3300026356 | Soil | LVDLLNVATRESLGQIHRDHSTRLLWNVLRRQPRLVLLGLRGLLMGRKPR |
| Ga0257153_10941491 | 3300026490 | Soil | QIHRDHSTRLLWSVLRRQPRLVLLGLRGLLMGKRLR |
| Ga0257181_10439131 | 3300026499 | Soil | ITRDESTRLLWNVLRRQPQLVLLGLRGLLLGWSSERR |
| Ga0209807_12598372 | 3300026530 | Soil | QSLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKAERG |
| Ga0209157_12570602 | 3300026537 | Soil | LDASTRQSLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKGIKS |
| Ga0209156_100555791 | 3300026547 | Soil | RRAIDASTRQSLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKAERS |
| Ga0209161_104208311 | 3300026548 | Soil | NRDESTRLLWNVVRRQPRLVLLGLRGLLMGKAESS |
| Ga0179593_11615512 | 3300026555 | Vadose Zone Soil | HHFKQADYSELVDLLNDSTRESLGEINRDESTRLLWNVIRRQPKLVLLGLRGLLLGKR |
| Ga0179587_101049491 | 3300026557 | Vadose Zone Soil | VDLLNLSTRETLSEITRDEAARLLWNVLRRQPRLALLGLRGLLLGRSTAPRPDSA |
| Ga0179587_111360882 | 3300026557 | Vadose Zone Soil | STRQSLGEINRDESTRLLWSVVRRQPRLVLLGLRGLLMGKTERS |
| Ga0179587_111576962 | 3300026557 | Vadose Zone Soil | DASTRQSLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKAKRS |
| Ga0207724_10252581 | 3300026862 | Tropical Forest Soil | STRESLGEINRDESTRLLWNVLRRQPKLALLGLRGLLLGRR |
| Ga0207803_10266361 | 3300027000 | Tropical Forest Soil | DMLNDSTRESLGEINRDESTRLLWNVLRRQPKLALLGLRGLLLGRR |
| Ga0208859_10292621 | 3300027069 | Forest Soil | EINRDESTRLLWSVVRRQPRLVLLGLRGLLMGKTEKN |
| Ga0209214_10404361 | 3300027071 | Forest Soil | YFRQEEYCQLVDMLNVATRESLAEINRDQATRLLWNVVRRQPQLVLLGLRGLLLGRR |
| Ga0207780_10176381 | 3300027313 | Tropical Forest Soil | AAISRDEATRLLWNVIRRQPRLVLLGLRGLLLGKRDREFEPSGD |
| Ga0209735_11177012 | 3300027562 | Forest Soil | DLLDASTRQSLGDINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKAERS |
| Ga0209009_10034335 | 3300027667 | Forest Soil | KDYSQLVDLLDASIRASLAEINRDESTRLLWNVIRRQPQLVLLGLRGLLMGKRHP |
| Ga0209588_10470481 | 3300027671 | Vadose Zone Soil | LNAATRETLSEITRDESTRLLWNVLRRQPQLVLLGLRGLLLGWNSERR |
| Ga0209588_11520931 | 3300027671 | Vadose Zone Soil | EINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKAERS |
| Ga0209011_11165081 | 3300027678 | Forest Soil | QQKDYSQLVDLLDASTRASLGEINRDESTRLLWNVVRRQPQLVLLGLRGLLMGKRS |
| Ga0207862_11846281 | 3300027703 | Tropical Forest Soil | LNDSTRESLGEINRDESTRLLWNVLRRQPKLALLGLRGLLLGRR |
| Ga0209328_102590042 | 3300027727 | Forest Soil | LNAATRETLSEITRDEATRLLWNVLRRQPQLVLLGLRGLLLGRNGSKRSP |
| Ga0209073_103174262 | 3300027765 | Agricultural Soil | LDVSARESLGAIHRDESARLLWNLVRRQPRLLLLGLRGLLMGRRIKR |
| Ga0209655_101853602 | 3300027767 | Bog Forest Soil | ARQSLGQINRDESTRLLWQVVRRQPRLVLLGLRGLLMGRSSKI |
| Ga0209772_100490852 | 3300027768 | Bog Forest Soil | LHYFQQEDYSQLVDMMNASTREKLGEINRDESTRLLWNVVRRQPKLALLGLRGLLLGRR |
| Ga0209772_101629041 | 3300027768 | Bog Forest Soil | DLLNDSTRESLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGRGLKS |
| Ga0209773_104631531 | 3300027829 | Bog Forest Soil | RKSLGEINRDESTRLLWQVVRRQPRLVLLGLRGLLMGAANKV |
| Ga0209180_105605841 | 3300027846 | Vadose Zone Soil | LDASTRQSLGEINRDESTRLLWNVVRRRPRLVLLGLRGLLMGKAERS |
| Ga0209274_100097506 | 3300027853 | Soil | RESLGEINRDESTRLLWNVVKRQPRLVLLGLRGLLMGRGLKS |
| Ga0209167_100528073 | 3300027867 | Surface Soil | QLVDLLNAATRDTLSEITRDESTRLLWSVLRRQPQLVLLGLRGLLLGRNGSKRSL |
| Ga0209167_102013252 | 3300027867 | Surface Soil | SLGEINRDESTRLLWNVIRRQPRLVLMGLRGLLVGRK |
| Ga0209579_105787402 | 3300027869 | Surface Soil | ELVDLLNDSARESLGEINRDESTRLLWNVIRRQPKLVLLGLRGLLLGKR |
| Ga0209283_100559561 | 3300027875 | Vadose Zone Soil | QKDYSQLVDLLDASTRQSLGEINRDESTRLLWNVVRRQPRLVVLGLRGLLTGRGLKG |
| Ga0209283_109470012 | 3300027875 | Vadose Zone Soil | EQKDYSQLVDLLDASTRQSLGEINRDESTRLLWNVVRRQPRLMLLGLRGLLMGRTERS |
| Ga0209526_101289562 | 3300028047 | Forest Soil | GWQARRWTHSRLVDLLNAATRETLSEVTRDESTRLLWKVLRHQPQLVLLGLRGLLLGWNSERR |
| Ga0209526_102288801 | 3300028047 | Forest Soil | LNAATRNTLSEITRDESTRLLWNVLRRQPQLVLLGLRGLLLGWNSERR |
| Ga0209526_108757142 | 3300028047 | Forest Soil | DASTRQSLGDINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKAERS |
| Ga0209526_109919201 | 3300028047 | Forest Soil | SQLVDLLDATTRASLGEINRDESTRLLWNVVRRQPQLVLLGLRGLLMGKRS |
| Ga0247685_10089061 | 3300028065 | Soil | QADYSELVDLLNASTRESLGEINRDESTRLLWNVIRRQPKLVLLGLRGLLLGKR |
| Ga0247684_10062132 | 3300028138 | Soil | YSQLVDLLDASTRASLGEINRDESTRLLWNLVRRKPRLALLGLRGLLMGRGLKG |
| Ga0137415_108119951 | 3300028536 | Vadose Zone Soil | QSLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGKAVRS |
| Ga0137415_109503961 | 3300028536 | Vadose Zone Soil | EITRDESTRLLWNVLRRQPQLVLLGLRGLLLGWNRERR |
| Ga0222749_102559291 | 3300029636 | Soil | LLNASTRESLGEINRDESTRLLWSVIRRQPKLVLLGLRGLLLGKR |
| Ga0222749_108279572 | 3300029636 | Soil | LDASTRQSLGDINRDESTRLLWNGMCRQPRLVLLGLRGLLMGKAERS |
| Ga0302177_102281042 | 3300030053 | Palsa | SLGEIHRDESTKLLWQVVRRQPRLVLLGLRGLLMGNGGKG |
| Ga0265459_111119471 | 3300030741 | Soil | STRESLGAINRDESTRLLWNVVCRQPRLVLLGLRGLLMGRGLKD |
| Ga0265753_10595972 | 3300030862 | Soil | GEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGRGLKS |
| Ga0170834_1025187562 | 3300031057 | Forest Soil | DASTRESLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLMGRGLKS |
| Ga0170834_1126391352 | 3300031057 | Forest Soil | ATRESLGQIHRDHSTRLLWSVLRRQPRLVLLGLRGLLMGIKPR |
| Ga0170824_1131358952 | 3300031231 | Forest Soil | LNVATRESLGQIHRDHSTRLLWNVLRRQPRLVLLGLRGLLMGRKPR |
| Ga0170824_1284994911 | 3300031231 | Forest Soil | TRESLGEINRDESTRLLWSVVRNQPKLVLMGLRGLLLGRR |
| Ga0318555_107153252 | 3300031640 | Soil | FHQDDYCRLVDMLNDSARESLGEINRDEATRLLWSLVRRQPRLALLGLRGLLLGRR |
| Ga0318572_109201552 | 3300031681 | Soil | HYSYLVDLLNSATRESLGEIHRDHSTRLLWTVLRRQPRLILLGLRGLLMGARPR |
| Ga0307474_100869471 | 3300031718 | Hardwood Forest Soil | QLVDLLDASTRASLGEINRDESTRLLWNVIRRQPQLVLLGLRGLLMGKRNL |
| Ga0307474_100978661 | 3300031718 | Hardwood Forest Soil | YSHLVDLLNLSTRDTLSEITRDESARLLWNVLRRQPRLALLGLRGLLLGKNAAPRTTS |
| Ga0307474_105635921 | 3300031718 | Hardwood Forest Soil | TATRESLGEIHRDHSTRLLWTVFRHQPRLILLGLRGLLMGKRPR |
| Ga0306917_105249951 | 3300031719 | Soil | GEINRDKALRLLWSVFRRQPRLVLLGLRGLLMSKRAR |
| Ga0307469_109663102 | 3300031720 | Hardwood Forest Soil | DLLNDSTRESLGEINRDESTRLLWNVIRRQPKLVLLGLRGLLLGKR |
| Ga0306918_111391451 | 3300031744 | Soil | SLGEIHRDHSTRLLWTVLRRQPRLILLGLRGLLMGARPR |
| Ga0307477_105427121 | 3300031753 | Hardwood Forest Soil | TLSEVTRDESTRLLWNVLRRQPQLILLGLRGLLLGWNSERR |
| Ga0318546_111661901 | 3300031771 | Soil | DEATRLLWNVIRRQPGLVLLGLRGLLLGKRDREFEPSGD |
| Ga0318523_106734392 | 3300031798 | Soil | HFEQQDYCNLVDMLNDSTRESLGAINRDESTRLLWSVLRRQPRLALLGLRGLLLGRR |
| Ga0310917_111499761 | 3300031833 | Soil | RESLAEISRDEATRLLWNVARRQPRLVLLGLRGLLLGKRDRELHPGGD |
| Ga0310912_102733622 | 3300031941 | Soil | LVDILNVSTRESLAEISRDEATRLLWNVIRRQPGLVLLGLRGLLLGKRDREFEPSGD |
| Ga0310912_113277752 | 3300031941 | Soil | TRESLGEIHRDKALRLLWSVFRRQPRLVLLGLRGLLMSKRAR |
| Ga0307479_102572252 | 3300031962 | Hardwood Forest Soil | SELVDLLNDSTRESLGEINRDESTRLLWNVIRRQPKLVLLGLRGLLLGKR |
| Ga0307479_107569842 | 3300031962 | Hardwood Forest Soil | TRESLGEINRDESTRLLWTVIRRQPRLVLLGLRGLLMGTRAREPHFDKN |
| Ga0318559_102529192 | 3300032039 | Soil | LHSFRQEEYRQLVDILNVSTRESLAEISRDEATRLLWNVIRRQPGLVLLGLRGLLLGKRDREFEPSGD |
| Ga0318514_102986941 | 3300032066 | Soil | GEINRDESTRLLWNVVRRQPRLVLMGLRGLLLGRK |
| Ga0306924_119421891 | 3300032076 | Soil | QLVDLLNVSARESLGEINRDESTRLLWNVIRRQPKLVLLGLRGLLLGKKG |
| Ga0318577_104437341 | 3300032091 | Soil | TRESLGAINRDESTKLLWNVVRRQPRLVLLGLRGLLLGRR |
| Ga0307470_100354781 | 3300032174 | Hardwood Forest Soil | HRDHSTRLLWNVLRRQPRLILLGLRGLLMGVRPRSSF |
| Ga0307470_104800731 | 3300032174 | Hardwood Forest Soil | DLLNLATRESLGEIHRDHSTELLWSVLRRQPRLVLLGLRGLLMGKGLR |
| Ga0307471_1005367141 | 3300032180 | Hardwood Forest Soil | NAATRDTLSEITRDESARLLWNVLRRQPQLVLLGLRGLLLGWNSERR |
| Ga0307471_1008507471 | 3300032180 | Hardwood Forest Soil | TRNTLSQITRDESTRLVWNVLRRQPQLVLLGLRGLLLRWNRERR |
| Ga0307471_1019485911 | 3300032180 | Hardwood Forest Soil | RDESTRLLWSVLRSQPQLVLLGLRGLLLGWNSERR |
| Ga0307471_1032140032 | 3300032180 | Hardwood Forest Soil | GQIHRDHSTRLLWSVLRRQPRLVLLGLRGLLMGIKPR |
| Ga0306920_1018875771 | 3300032261 | Soil | DLLNSATRESLGEIHRDHAVRLLFSVLRRQPRLVLLGLRGLLMGKRAR |
| Ga0306920_1024938262 | 3300032261 | Soil | QQDYCDLVDMLNDSTRESLGEINRDESTRLLWNVLRRQPKLALLGLRGLLLGRR |
| Ga0306920_1027588771 | 3300032261 | Soil | LVDLLNVSARESLGEINRDESTRLLWSVLRRQPKLVLLGLRGLLLGRK |
| Ga0335082_105214362 | 3300032782 | Soil | MLNDSTRQSLGEINRDESTRLLWTVLRKQPKLVLLGMRGLLLGKR |
| Ga0335079_109080601 | 3300032783 | Soil | LNDSTRESLGEINRDESTRLLWSVLRRQPKLALLGLRGLLLGRR |
| Ga0335072_116266381 | 3300032898 | Soil | LGEINRDESTRLLWNVIRRQPRLILLGLRGLLMGRNSPK |
| Ga0335083_111565491 | 3300032954 | Soil | TRESLGEINRDESTRLLWNVVRRQPRLVLLGLRGLLLGRR |
| Ga0314865_166576_2_130 | 3300033806 | Peatland | ASTRESLGEINRDESTRLLWNLVRRQPRLVLLALRGLLLGKR |
| Ga0314866_038975_577_714 | 3300033807 | Peatland | MLSDSTRESLGEINRDESTRLLWNVLRKQPKLVLLGLRGLLLGRR |
| ⦗Top⦘ |