| Basic Information | |
|---|---|
| Family ID | F011257 |
| Family Type | Metagenome |
| Number of Sequences | 293 |
| Average Sequence Length | 47 residues |
| Representative Sequence | QMRLPGLVWGGIAMEAALGRKRLVSLRYIQLGKVRAAARVGCPF |
| Number of Associated Samples | 241 |
| Number of Associated Scaffolds | 293 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.46 % |
| % of genes near scaffold ends (potentially truncated) | 88.74 % |
| % of genes from short scaffolds (< 2000 bps) | 88.40 % |
| Associated GOLD sequencing projects | 219 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.659 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (9.556 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.812 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.638 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 293 Family Scaffolds |
|---|---|---|
| PF07690 | MFS_1 | 7.51 |
| PF01202 | SKI | 5.80 |
| PF13847 | Methyltransf_31 | 5.46 |
| PF06831 | H2TH | 3.41 |
| PF06827 | zf-FPG_IleRS | 2.73 |
| PF03352 | Adenine_glyco | 1.37 |
| PF04073 | tRNA_edit | 1.37 |
| PF12680 | SnoaL_2 | 1.02 |
| PF01757 | Acyl_transf_3 | 0.68 |
| PF12867 | DinB_2 | 0.68 |
| PF01979 | Amidohydro_1 | 0.68 |
| PF13561 | adh_short_C2 | 0.68 |
| PF13946 | DUF4214 | 0.34 |
| PF13193 | AMP-binding_C | 0.34 |
| PF04402 | SIMPL | 0.34 |
| PF13544 | Obsolete Pfam Family | 0.34 |
| PF13539 | Peptidase_M15_4 | 0.34 |
| PF08241 | Methyltransf_11 | 0.34 |
| PF02687 | FtsX | 0.34 |
| PF10017 | Methyltransf_33 | 0.34 |
| PF13683 | rve_3 | 0.34 |
| PF13673 | Acetyltransf_10 | 0.34 |
| PF00654 | Voltage_CLC | 0.34 |
| PF06348 | DUF1059 | 0.34 |
| PF04226 | Transgly_assoc | 0.34 |
| PF03332 | PMM | 0.34 |
| PF09423 | PhoD | 0.34 |
| PF04055 | Radical_SAM | 0.34 |
| PF00583 | Acetyltransf_1 | 0.34 |
| PF13432 | TPR_16 | 0.34 |
| COG ID | Name | Functional Category | % Frequency in 293 Family Scaffolds |
|---|---|---|---|
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 3.41 |
| COG2818 | 3-methyladenine DNA glycosylase Tag | Replication, recombination and repair [L] | 1.37 |
| COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 0.34 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.34 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.34 |
| COG2859 | Outer membrane channel-forming protein BP26/OMP28, SIMPL family | Cell wall/membrane/envelope biogenesis [M] | 0.34 |
| COG2968 | Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain | Function unknown [S] | 0.34 |
| COG3471 | Predicted secreted (periplasmic) protein | Function unknown [S] | 0.34 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.66 % |
| Unclassified | root | N/A | 0.34 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17145027 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3129 | Open in IMG/M |
| 2166559005|cont_contig44921 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 2170459003|FZ032L002HN9LU | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100295647 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300000890|JGI11643J12802_12119834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 692 | Open in IMG/M |
| 3300000955|JGI1027J12803_100805675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 856 | Open in IMG/M |
| 3300000956|JGI10216J12902_120874683 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300001979|JGI24740J21852_10110928 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300001991|JGI24743J22301_10123764 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300004114|Ga0062593_101373774 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300004156|Ga0062589_102692291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 517 | Open in IMG/M |
| 3300004463|Ga0063356_100865346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1271 | Open in IMG/M |
| 3300004480|Ga0062592_102233622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 546 | Open in IMG/M |
| 3300004633|Ga0066395_10959600 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300004643|Ga0062591_100499388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1044 | Open in IMG/M |
| 3300005093|Ga0062594_100790237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 875 | Open in IMG/M |
| 3300005093|Ga0062594_101866746 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300005174|Ga0066680_10211390 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300005180|Ga0066685_10136159 | All Organisms → cellular organisms → Bacteria | 1662 | Open in IMG/M |
| 3300005181|Ga0066678_10048531 | All Organisms → cellular organisms → Bacteria | 2408 | Open in IMG/M |
| 3300005186|Ga0066676_10366660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 966 | Open in IMG/M |
| 3300005187|Ga0066675_10281153 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300005293|Ga0065715_10011286 | All Organisms → cellular organisms → Bacteria | 3575 | Open in IMG/M |
| 3300005293|Ga0065715_10073362 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300005293|Ga0065715_10792976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 613 | Open in IMG/M |
| 3300005293|Ga0065715_11128673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 513 | Open in IMG/M |
| 3300005328|Ga0070676_11420740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 533 | Open in IMG/M |
| 3300005331|Ga0070670_100099609 | All Organisms → cellular organisms → Bacteria | 2501 | Open in IMG/M |
| 3300005332|Ga0066388_101452671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1195 | Open in IMG/M |
| 3300005334|Ga0068869_100767480 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300005337|Ga0070682_101303707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 617 | Open in IMG/M |
| 3300005340|Ga0070689_102047126 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300005347|Ga0070668_100201885 | All Organisms → cellular organisms → Bacteria | 1632 | Open in IMG/M |
| 3300005354|Ga0070675_100170560 | All Organisms → cellular organisms → Bacteria | 1876 | Open in IMG/M |
| 3300005355|Ga0070671_101452519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 606 | Open in IMG/M |
| 3300005440|Ga0070705_100271976 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300005446|Ga0066686_10312130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1070 | Open in IMG/M |
| 3300005457|Ga0070662_101479351 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300005468|Ga0070707_101861694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 569 | Open in IMG/M |
| 3300005536|Ga0070697_100143929 | All Organisms → cellular organisms → Bacteria | 2006 | Open in IMG/M |
| 3300005539|Ga0068853_101206104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 731 | Open in IMG/M |
| 3300005545|Ga0070695_101410483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 578 | Open in IMG/M |
| 3300005546|Ga0070696_100978158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 706 | Open in IMG/M |
| 3300005548|Ga0070665_101531948 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300005548|Ga0070665_102438929 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300005553|Ga0066695_10519928 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300005556|Ga0066707_10549883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 744 | Open in IMG/M |
| 3300005559|Ga0066700_10372700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1008 | Open in IMG/M |
| 3300005564|Ga0070664_102191160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 524 | Open in IMG/M |
| 3300005566|Ga0066693_10120670 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300005575|Ga0066702_10074934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1880 | Open in IMG/M |
| 3300005576|Ga0066708_10309846 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300005577|Ga0068857_101902992 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300005578|Ga0068854_100948628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 759 | Open in IMG/M |
| 3300005614|Ga0068856_100104354 | All Organisms → cellular organisms → Bacteria | 2828 | Open in IMG/M |
| 3300005616|Ga0068852_102024487 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300005618|Ga0068864_100442083 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300005618|Ga0068864_102013584 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300005618|Ga0068864_102534929 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005764|Ga0066903_100774818 | All Organisms → cellular organisms → Bacteria | 1709 | Open in IMG/M |
| 3300005764|Ga0066903_103318768 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300005764|Ga0066903_104784391 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300005764|Ga0066903_105232522 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300005764|Ga0066903_105908695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 642 | Open in IMG/M |
| 3300005829|Ga0074479_10234535 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300005840|Ga0068870_11055062 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300005841|Ga0068863_100487755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1212 | Open in IMG/M |
| 3300006046|Ga0066652_101552798 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300006163|Ga0070715_10835567 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300006173|Ga0070716_101166367 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 617 | Open in IMG/M |
| 3300006196|Ga0075422_10024187 | All Organisms → cellular organisms → Bacteria | 2082 | Open in IMG/M |
| 3300006358|Ga0068871_101203091 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300006358|Ga0068871_102197456 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300006755|Ga0079222_11390313 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300006804|Ga0079221_11669040 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300006845|Ga0075421_100910536 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300006845|Ga0075421_102174049 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300006854|Ga0075425_101801343 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300006854|Ga0075425_103042609 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300006893|Ga0073928_10000083 | All Organisms → cellular organisms → Bacteria | 214632 | Open in IMG/M |
| 3300006904|Ga0075424_102027803 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300007076|Ga0075435_100735405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 858 | Open in IMG/M |
| 3300007258|Ga0099793_10321593 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300009012|Ga0066710_103968982 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300009092|Ga0105250_10246568 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300009093|Ga0105240_12295065 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300009093|Ga0105240_12373415 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300009100|Ga0075418_10174292 | All Organisms → cellular organisms → Bacteria | 2290 | Open in IMG/M |
| 3300009101|Ga0105247_10951703 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300009137|Ga0066709_102663250 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300009147|Ga0114129_11657165 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300009156|Ga0111538_10334496 | All Organisms → cellular organisms → Bacteria | 1917 | Open in IMG/M |
| 3300009162|Ga0075423_10806145 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300009174|Ga0105241_10443005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1148 | Open in IMG/M |
| 3300009176|Ga0105242_11847558 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300009177|Ga0105248_10093199 | All Organisms → cellular organisms → Bacteria | 3392 | Open in IMG/M |
| 3300009545|Ga0105237_12225867 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300009553|Ga0105249_10161023 | All Organisms → cellular organisms → Bacteria | 2169 | Open in IMG/M |
| 3300009553|Ga0105249_13257594 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300010038|Ga0126315_10771098 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300010043|Ga0126380_10641813 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300010044|Ga0126310_10830450 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300010045|Ga0126311_10559874 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300010046|Ga0126384_10825845 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300010046|Ga0126384_11192370 | Not Available | 702 | Open in IMG/M |
| 3300010046|Ga0126384_11192412 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300010046|Ga0126384_11596688 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300010047|Ga0126382_10052830 | All Organisms → cellular organisms → Bacteria | 2391 | Open in IMG/M |
| 3300010047|Ga0126382_10674063 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300010048|Ga0126373_10752046 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300010048|Ga0126373_11969087 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300010159|Ga0099796_10350195 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300010303|Ga0134082_10441941 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300010325|Ga0134064_10047735 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
| 3300010335|Ga0134063_10356222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 712 | Open in IMG/M |
| 3300010335|Ga0134063_10597094 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300010358|Ga0126370_10900685 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300010358|Ga0126370_11426379 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300010359|Ga0126376_10005797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 7411 | Open in IMG/M |
| 3300010359|Ga0126376_12071430 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300010361|Ga0126378_11618873 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300010366|Ga0126379_11188746 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300010373|Ga0134128_10153223 | All Organisms → cellular organisms → Bacteria | 2605 | Open in IMG/M |
| 3300010373|Ga0134128_10891805 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300010375|Ga0105239_10131286 | All Organisms → cellular organisms → Bacteria | 2786 | Open in IMG/M |
| 3300010375|Ga0105239_11238024 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300010376|Ga0126381_100242163 | All Organisms → cellular organisms → Bacteria | 2438 | Open in IMG/M |
| 3300010376|Ga0126381_101364807 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300010376|Ga0126381_104965110 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300010396|Ga0134126_10909883 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300010397|Ga0134124_12039919 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300010398|Ga0126383_10687925 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300010399|Ga0134127_10765851 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300010399|Ga0134127_11863936 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300010399|Ga0134127_12122741 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300010400|Ga0134122_10523167 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300010400|Ga0134122_10949656 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300010400|Ga0134122_13389884 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300010401|Ga0134121_11653088 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300010401|Ga0134121_11757347 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300012200|Ga0137382_10495718 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300012200|Ga0137382_10637776 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300012201|Ga0137365_10029686 | All Organisms → cellular organisms → Bacteria | 4207 | Open in IMG/M |
| 3300012202|Ga0137363_10100951 | All Organisms → cellular organisms → Bacteria | 2193 | Open in IMG/M |
| 3300012205|Ga0137362_10527431 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300012207|Ga0137381_10445538 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300012208|Ga0137376_11295100 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300012209|Ga0137379_10750559 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300012211|Ga0137377_10833617 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300012211|Ga0137377_11092018 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300012285|Ga0137370_10448942 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300012349|Ga0137387_10113402 | All Organisms → cellular organisms → Bacteria | 1903 | Open in IMG/M |
| 3300012350|Ga0137372_10725451 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300012353|Ga0137367_10645835 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300012354|Ga0137366_10783648 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300012357|Ga0137384_10237516 | All Organisms → cellular organisms → Bacteria | 1522 | Open in IMG/M |
| 3300012359|Ga0137385_10317662 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
| 3300012359|Ga0137385_10431680 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300012918|Ga0137396_10713321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1 | 740 | Open in IMG/M |
| 3300012929|Ga0137404_11604459 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300012951|Ga0164300_10096645 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300012955|Ga0164298_10462625 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300012957|Ga0164303_10001405 | All Organisms → cellular organisms → Bacteria | 6557 | Open in IMG/M |
| 3300012960|Ga0164301_11802621 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300012984|Ga0164309_10765440 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300012989|Ga0164305_10205668 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
| 3300012989|Ga0164305_10534325 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300013100|Ga0157373_10826621 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300013105|Ga0157369_10772882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 988 | Open in IMG/M |
| 3300013296|Ga0157374_10658760 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300013297|Ga0157378_10019547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5955 | Open in IMG/M |
| 3300013306|Ga0163162_12880180 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300014157|Ga0134078_10407866 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300014157|Ga0134078_10533618 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300014166|Ga0134079_10165557 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300014326|Ga0157380_12389354 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300014745|Ga0157377_10792691 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300015200|Ga0173480_11031742 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300015261|Ga0182006_1327746 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300015357|Ga0134072_10093839 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300015359|Ga0134085_10022248 | All Organisms → cellular organisms → Bacteria | 2420 | Open in IMG/M |
| 3300015359|Ga0134085_10370293 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300015372|Ga0132256_100342815 | All Organisms → cellular organisms → Bacteria | 1587 | Open in IMG/M |
| 3300015372|Ga0132256_103500182 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300015373|Ga0132257_100274844 | All Organisms → cellular organisms → Bacteria | 2018 | Open in IMG/M |
| 3300015374|Ga0132255_100145330 | All Organisms → cellular organisms → Bacteria | 3298 | Open in IMG/M |
| 3300016319|Ga0182033_11893749 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300016357|Ga0182032_11148647 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 667 | Open in IMG/M |
| 3300016371|Ga0182034_10491501 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300016387|Ga0182040_11968903 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 502 | Open in IMG/M |
| 3300016445|Ga0182038_10524259 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300017654|Ga0134069_1375771 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300017656|Ga0134112_10223246 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300017994|Ga0187822_10357979 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300018000|Ga0184604_10293830 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300018051|Ga0184620_10344923 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300018054|Ga0184621_10242987 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300018072|Ga0184635_10145176 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300018072|Ga0184635_10282808 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300018076|Ga0184609_10304744 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300018076|Ga0184609_10532056 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300018078|Ga0184612_10549911 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300018081|Ga0184625_10667438 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300018482|Ga0066669_10833821 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300019361|Ga0173482_10249958 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300019867|Ga0193704_1097083 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300019873|Ga0193700_1022008 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300019874|Ga0193744_1091902 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300019880|Ga0193712_1101007 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300019881|Ga0193707_1000030 | All Organisms → cellular organisms → Bacteria | 34362 | Open in IMG/M |
| 3300020001|Ga0193731_1100825 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300020006|Ga0193735_1018050 | All Organisms → cellular organisms → Bacteria | 2194 | Open in IMG/M |
| 3300020170|Ga0179594_10175418 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300021078|Ga0210381_10250798 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300021080|Ga0210382_10069552 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300022557|Ga0212123_10000429 | All Organisms → cellular organisms → Bacteria | 139997 | Open in IMG/M |
| 3300022756|Ga0222622_10863133 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300024288|Ga0179589_10278653 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300025898|Ga0207692_10645952 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300025908|Ga0207643_10354525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 921 | Open in IMG/M |
| 3300025909|Ga0207705_10914373 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300025910|Ga0207684_10947192 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300025911|Ga0207654_10620787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 772 | Open in IMG/M |
| 3300025917|Ga0207660_10994487 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300025919|Ga0207657_10181557 | All Organisms → cellular organisms → Bacteria | 1701 | Open in IMG/M |
| 3300025922|Ga0207646_11580121 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300025925|Ga0207650_10228509 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
| 3300025925|Ga0207650_10699889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300025926|Ga0207659_10868002 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300025926|Ga0207659_11417491 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300025931|Ga0207644_10411470 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300025933|Ga0207706_10541144 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300025936|Ga0207670_11780950 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300025942|Ga0207689_11209248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300026035|Ga0207703_10529189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1110 | Open in IMG/M |
| 3300026041|Ga0207639_10105172 | All Organisms → cellular organisms → Bacteria | 2290 | Open in IMG/M |
| 3300026078|Ga0207702_10112187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2426 | Open in IMG/M |
| 3300026088|Ga0207641_10762878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 955 | Open in IMG/M |
| 3300026095|Ga0207676_10811092 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300026095|Ga0207676_11265794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300026324|Ga0209470_1034641 | All Organisms → cellular organisms → Bacteria | 2553 | Open in IMG/M |
| 3300026326|Ga0209801_1217775 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300026327|Ga0209266_1145231 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300026537|Ga0209157_1178516 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300026538|Ga0209056_10028424 | All Organisms → cellular organisms → Bacteria | 5320 | Open in IMG/M |
| 3300026547|Ga0209156_10339212 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300026548|Ga0209161_10174315 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300026550|Ga0209474_10031851 | All Organisms → cellular organisms → Bacteria | 3939 | Open in IMG/M |
| 3300026550|Ga0209474_10489068 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300027266|Ga0209215_1067655 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300027417|Ga0207543_100328 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300027502|Ga0209622_1009774 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
| 3300028379|Ga0268266_10273923 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
| 3300028379|Ga0268266_12164366 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300028536|Ga0137415_10651733 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300028707|Ga0307291_1033977 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300028711|Ga0307293_10073967 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300028718|Ga0307307_10129001 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300028718|Ga0307307_10226511 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300028768|Ga0307280_10141368 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300028807|Ga0307305_10095830 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
| 3300028881|Ga0307277_10530506 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300028884|Ga0307308_10009840 | All Organisms → cellular organisms → Bacteria | 4225 | Open in IMG/M |
| 3300028885|Ga0307304_10471143 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300031231|Ga0170824_117073230 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300031231|Ga0170824_120279495 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300031446|Ga0170820_14193307 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300031469|Ga0170819_14297470 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300031562|Ga0310886_10413313 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300031731|Ga0307405_10036367 | All Organisms → cellular organisms → Bacteria | 2950 | Open in IMG/M |
| 3300031754|Ga0307475_10742123 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300031820|Ga0307473_10706804 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300031833|Ga0310917_10938742 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300031852|Ga0307410_11575017 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300031858|Ga0310892_10535590 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300031908|Ga0310900_11520183 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300031908|Ga0310900_11591840 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300031908|Ga0310900_11878800 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300031911|Ga0307412_11861159 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300031913|Ga0310891_10243360 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300031940|Ga0310901_10119920 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300032002|Ga0307416_103480332 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300032012|Ga0310902_10702530 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300032144|Ga0315910_10227092 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300032179|Ga0310889_10509982 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300032180|Ga0307471_100018708 | All Organisms → cellular organisms → Bacteria | 4994 | Open in IMG/M |
| 3300032256|Ga0315271_11922328 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300032261|Ga0306920_102882073 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300032828|Ga0335080_11902710 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300033290|Ga0318519_10119183 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
| 3300033412|Ga0310810_10394810 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300033412|Ga0310810_10755392 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300034090|Ga0326723_0606390 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.21% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.53% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.48% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.10% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.10% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.41% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.41% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.07% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.39% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.39% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.37% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.37% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.02% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.02% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.02% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.02% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.68% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.68% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.68% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.68% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.34% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.34% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.34% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.34% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.34% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.34% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.34% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.34% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.34% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.34% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.34% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.34% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Host-Associated | Open in IMG/M |
| 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300019873 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1 | Environmental | Open in IMG/M |
| 3300019874 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a1 | Environmental | Open in IMG/M |
| 3300019880 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027417 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G07A1-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_01584200 | 2088090014 | Soil | MRLPGLVWGGVAMEAALGRKRLVSLRYIQLGKIRAAARVGCPF |
| cont_0921.00003090 | 2166559005 | Simulated | MRLPGLVWGGIAMEAGLGRKRLLSLRYIQLGKIRAAARVGCPF |
| E4A_07347340 | 2170459003 | Grass Soil | MFGKDFTPAKIQMRLPGLVWGGIAMEAGLGRKRLVSLRYIQLGKTRAAARIGCPF |
| INPhiseqgaiiFebDRAFT_1002956471 | 3300000364 | Soil | LHAGKDPMRSPGLVWGGIAMEAGLGRKRLVSLRYIQLGRIRTAARVGCPF* |
| JGI11643J12802_121198341 | 3300000890 | Soil | DFTPAKIQMRLPGLVWGGIAMEAALGRKRRVSLRYILLGKIRAAARVGCPF* |
| JGI1027J12803_1008056752 | 3300000955 | Soil | MRRPGIVWGSVAMEGGLAKKRSVSLRYIQLGKVRAASRIGCPF* |
| JGI10216J12902_1208746832 | 3300000956 | Soil | VWGGIVMEAALGRKRLISLRYLQLGRIRAAARIGCPF* |
| JGI24740J21852_101109283 | 3300001979 | Corn Rhizosphere | GMVWGGLAMEAALVRKRLVSLRYIQLGKVRAASRVGCPF* |
| JGI24743J22301_101237641 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | LPGMVWGGLAMEAALGRKRLVSLRYIQLGKVRAASRVGCPF* |
| Ga0062593_1013737743 | 3300004114 | Soil | GLVWGSIGMEAGLGRKRRVSLRFIQLAKVRTAARIGCPF* |
| Ga0062589_1026922912 | 3300004156 | Soil | QMRVPGLVWGSVAVEAALGRKRRVSLRHIQIAKVRTAARVGCPF* |
| Ga0063356_1008653463 | 3300004463 | Arabidopsis Thaliana Rhizosphere | KDLTPVKQQMRKPGLVWGGIAMEAGLSRKRRVSLRYIQLAKVRTAARVGCPF* |
| Ga0062592_1022336222 | 3300004480 | Soil | PVKQQMRLPGMVWGSIAMEAGLGRKRKVSLRFIQLGKVRTASRVGCPF* |
| Ga0066395_109596002 | 3300004633 | Tropical Forest Soil | MRKMFRTDLTSVKLQMRLPGLVWGGIAMEAALGRLRLVSLRYIQLGKIRAAAR |
| Ga0062591_1004993881 | 3300004643 | Soil | KDFTPAKIQMRLPGLVWGGIAMETALGRRRIVSLRYVQLGKVRAASRVGCPF* |
| Ga0062594_1007902373 | 3300005093 | Soil | PVKQQMRVPGMVWGSIAMEAGLGRKRRVSLRFIQLAKVRTAARIGCPF* |
| Ga0062594_1018667461 | 3300005093 | Soil | MRKMFGKDFTPAKIQMRVPGLVWGGLAMQAGLGRKRLVSLRYIQLGKTRAAAHIGCPF* |
| Ga0066680_102113901 | 3300005174 | Soil | MRLPGLVWGGVAMEAALGRKRLVSLRYIQLGKVRATARIGCPF* |
| Ga0066685_101361594 | 3300005180 | Soil | MRLPGLVWGGIAMETALGRKRLVSLRYIQLGKIRAAARIGCPF* |
| Ga0066678_100485314 | 3300005181 | Soil | MFGKDFTPAKIQMRLPSLMWGGIAMEAALGRKRLVSLRYIQLGKIRAAARIGCPF* |
| Ga0066676_103666603 | 3300005186 | Soil | TPAKIQMRLPGLVWGGIVMEAAIGRKRLVSLRYLQLGRIRTAARIGCPF* |
| Ga0066675_102811531 | 3300005187 | Soil | VQMRLPGLVWGGVAMEAALGRKRLVSLRYIQLGKVRATARIGCPF* |
| Ga0065715_100112866 | 3300005293 | Miscanthus Rhizosphere | GVMRKMFGKDFTPAKIQMCLPALVWGGIAMEGALRRKRIVSLCYIQLGKIRAAARVGCLF |
| Ga0065715_100733621 | 3300005293 | Miscanthus Rhizosphere | PGMVWGGIAMEAALGRKRLVSLRYIQLGKVRVASRVGCPF* |
| Ga0065715_107929761 | 3300005293 | Miscanthus Rhizosphere | RVPGLVWGSVAVEAALGRKRRVSLRHIQIAKVRTAARVGCPF* |
| Ga0065715_111286732 | 3300005293 | Miscanthus Rhizosphere | IQMRVPGIVWGSIGFEAGLGRKRRVSLRYIQMGKVRTAARIGCPF* |
| Ga0070676_114207401 | 3300005328 | Miscanthus Rhizosphere | MRVPGLVWGSIAMEAGLNQKRRISLRYIQLAKVRTAARVGCPF* |
| Ga0070670_1000996095 | 3300005331 | Switchgrass Rhizosphere | MHMRVPGLVWGSIAMEAGLAKKRRVSLRFVQLGKVRTASRVGCPF* |
| Ga0066388_1014526711 | 3300005332 | Tropical Forest Soil | KIQMRLPGLVWGGIAMEATLGRKRLVSLRYIQLGKIRAAARVGCPF* |
| Ga0068869_1007674803 | 3300005334 | Miscanthus Rhizosphere | RLPGMVWGGLAMEAALGRKRLVSLRYIQLGKVRAASRVGCPF* |
| Ga0070682_1013037071 | 3300005337 | Corn Rhizosphere | PGMVWGSIAMEAGLGRKRKVSLRFIQLGKVRTAARVGCPF* |
| Ga0070689_1020471261 | 3300005340 | Switchgrass Rhizosphere | MRVPGLVWGGLAMEAGLGRKRLVSLRYIQLGKTRAAAHIGCPF* |
| Ga0070668_1002018854 | 3300005347 | Switchgrass Rhizosphere | PVKQQMRVPGIVWGGIAMEAGMGRKRKVSLRFIQLAKVRTAWRIGCPF* |
| Ga0070675_1001705604 | 3300005354 | Miscanthus Rhizosphere | GMVWGSIAMEAGLGKSRKVSLRFIQLGKVRTAARVGCPF* |
| Ga0070671_1014525193 | 3300005355 | Switchgrass Rhizosphere | RKDLTPAKIQMRLPGLVWGGIAMEAALSRKRLVSLRYIQLGRIRAAVRIGCPF* |
| Ga0070705_1002719763 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLPGLVWGGIAMEAALGRKRIVSLRYIQLGKVRAASRVGCPF* |
| Ga0066686_103121301 | 3300005446 | Soil | KDLTPAKIQMRLPGLVWGGIAMETALGRKRLVSLRYIQLGKIRAAARIGCPF* |
| Ga0070662_1014793511 | 3300005457 | Corn Rhizosphere | QMRLPGMVWGSIAMEAGLGRKRYVSLRYIQIGKVRTAARIGCPF* |
| Ga0070707_1018616941 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | KGLTPAKVQMRLPGLVWGGIAMEAGLGRKRLISLRYIQLGKIRAAARVGCPF* |
| Ga0070697_1001439294 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LTPAKVQMRLPGLVWGGIAMEAGLRRKRLISLRYIQLGKIRAAARVGCPF* |
| Ga0068853_1012061043 | 3300005539 | Corn Rhizosphere | MQMRVPGLVWGSIAMEAGLAKKRRVSLRFIQLGKVRTASRVGCPF* |
| Ga0070695_1014104831 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | KDLTPVKIQMRVPGIVWGSIGMEAGLSRKRSVSLRFIQLAKVRTAARIGCPF* |
| Ga0070696_1009781581 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | KFQMRVPGLVWGSIVMEAGLRRKRRVSLRYIQLAKVRTATRVGCPF* |
| Ga0070665_1015319483 | 3300005548 | Switchgrass Rhizosphere | AKQQMRLPGMVWGSIAMEAGLSRKRHVSLRYIQLGKARTAARIGCPF* |
| Ga0070665_1024389291 | 3300005548 | Switchgrass Rhizosphere | QMRVPGVVWGGIAMETALAKKRRVSLRFIQLGKVRTAWRIGCPF* |
| Ga0066695_105199283 | 3300005553 | Soil | LPGLVWGGIAMEAALGRKRIVSLRYIQLGKIRAAARVGCPF* |
| Ga0066707_105498831 | 3300005556 | Soil | AKIQMRLPGLVWGGIVMEAGLGRKRLVSLRYIQLGKIRAAARIGCPF* |
| Ga0066700_103727002 | 3300005559 | Soil | MFGKDFTPVKIQMRLPGLVWGGIAMEAGLGRKRLVSLRYIQLGKIRAAARIGCPF* |
| Ga0070664_1021911601 | 3300005564 | Corn Rhizosphere | WGGIAMEAGLARKRKVSLRFIQLGKVRTAWRIGCPF* |
| Ga0066693_101206703 | 3300005566 | Soil | GGIAMEAGLGRKRLVSLRYIQLGKIRAATRIGCPF* |
| Ga0066702_100749341 | 3300005575 | Soil | LTPATIQMRVPGIVWGSIGMEAGLAKKRRVSLRYTQLGKVRAASRIGCPF* |
| Ga0066708_103098463 | 3300005576 | Soil | MRLPGLVWGGVAMEAALGRKRLVSLRYIQLGKVRAAARIGCPF* |
| Ga0068857_1019029923 | 3300005577 | Corn Rhizosphere | KQQMRLPGMVWGSIAMEAGLARKRKVSLRFIQLGKVRTASRIGCPF* |
| Ga0068854_1009486281 | 3300005578 | Corn Rhizosphere | LPGMVWGSIAMEAGLGRKRKVSLRFIQLAKVRTAARVGCPF* |
| Ga0068856_1001043544 | 3300005614 | Corn Rhizosphere | MFGKALTPVKQQMHVPGLVWGSIGMEAGLSRKRKVSLRYIQIGKVRTAWRVGCPF* |
| Ga0068852_1020244871 | 3300005616 | Corn Rhizosphere | SIAMEAGLGRKRKVSLRFIQLAKVRTAARVGCPF* |
| Ga0068864_1004420831 | 3300005618 | Switchgrass Rhizosphere | VWGGIAMEAALGRKRIVSLRYIQLGKVRAASRVGCPF* |
| Ga0068864_1020135841 | 3300005618 | Switchgrass Rhizosphere | VWGSIAMEAGLGRKRKVSLRFIQLGKVRTAWRIGCPF* |
| Ga0068864_1025349292 | 3300005618 | Switchgrass Rhizosphere | MFGKALTPVKQQMHVPGLVWGSIGMEAGLSRKRKVSLRYIQIGKVRTAWRV |
| Ga0066903_1007748184 | 3300005764 | Tropical Forest Soil | LVWGGIAMETALGRRRLVSLRYIQLGKVRAASRVRCPF* |
| Ga0066903_1033187683 | 3300005764 | Tropical Forest Soil | MRLPGLVWGGIAMEAAVGRKRLVSLRYIQLGKIRAAARIDCPF* |
| Ga0066903_1047843911 | 3300005764 | Tropical Forest Soil | GIVWGSIAMEAGLGRKRRVSLRYIQLAKVRTASRVGCPF* |
| Ga0066903_1052325223 | 3300005764 | Tropical Forest Soil | MFRTDLTSVKLQMRLPGLVWGGIAMEAALGRLRLVSLRYIQLGKIRAAARTDCLF* |
| Ga0066903_1059086951 | 3300005764 | Tropical Forest Soil | AKIQMRLPGLVWGGIAMEAALGRKRIVSLRYIQLGKVRAASRVGCPF* |
| Ga0074479_102345351 | 3300005829 | Sediment (Intertidal) | LRKMFGKVLTPVKMQVRVPGLVRGSIAMEAGMARSRRVSLRYIQLGKVRTAARIGCPF* |
| Ga0068870_110550623 | 3300005840 | Miscanthus Rhizosphere | WGSIAMEAGLAKKRRVSLRFIQLGKVRTAWRVGCPF* |
| Ga0068863_1004877551 | 3300005841 | Switchgrass Rhizosphere | QMRLPGMVWGSIAMEAGLGRKRKVSLRFIQLGKVRTAARVGCPF* |
| Ga0066652_1015527982 | 3300006046 | Soil | WGSIGMEAGLGAKRRVSLRYIQLGKVRAAARVGCPF* |
| Ga0070715_108355671 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LPGLVWGGIAMEAGLGRKRLVSLRYIQLGKTRAAARIGCPF* |
| Ga0070716_1011663671 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VMRKMFGKDFTPAKIQMRLPGLVWGGIAIKAVLGRKRLVSLRYIQLGKTRAAACIGCPF* |
| Ga0075422_100241871 | 3300006196 | Populus Rhizosphere | KPGLVWGSIAMEAGMGRKRRVSLRYIQLAKVRTAARIGCPF* |
| Ga0068871_1012030913 | 3300006358 | Miscanthus Rhizosphere | LTPAKIQMRLPGMVWGGIAMEAALGRKRLVSLRYIQLGKVRVASRVGCPF* |
| Ga0068871_1021974562 | 3300006358 | Miscanthus Rhizosphere | LTPVKMQMRVPGLVWGGIGMEAGLGAKRRVSLRFIQLGKVRTAARIGCPF* |
| Ga0079222_113903133 | 3300006755 | Agricultural Soil | TPVKQQMRVPGMVWGSIAMEAGLGRKRKVSLRFIQLGKVRTAARVGCPF* |
| Ga0079221_116690402 | 3300006804 | Agricultural Soil | LPGMVWAGIGMEAALGRKRLVSLRYIQLGKIRAATRVGCPF* |
| Ga0075421_1009105361 | 3300006845 | Populus Rhizosphere | QMRKPGLVWGSIAMEAGMGRKRRVSLRYIQLAKVRTAARIGCPF* |
| Ga0075421_1021740491 | 3300006845 | Populus Rhizosphere | PGIVWGSIAMEAGLAKKRRISLRYIQLAKVRTAARIGCPF* |
| Ga0075425_1018013432 | 3300006854 | Populus Rhizosphere | MRKMFGKDLTPAKMQMRLPGLMWGSIAMEAGLSRKRRISFRYSQLAKVRTASL |
| Ga0075425_1030426092 | 3300006854 | Populus Rhizosphere | KMFNKDLTPAKMQMRLPGLVWGAIAMEAGLSKKRRVSLRYIQLAKVRTAARAGCPF* |
| Ga0073928_1000008384 | 3300006893 | Iron-Sulfur Acid Spring | MRLPGLGWGGIAMEAGLGRKRLVSLRYLQLGKIRAAARVGCPF* |
| Ga0075424_1020278031 | 3300006904 | Populus Rhizosphere | IQMRMPALVWGGIGMEAALGRKRIVSLRYIQLGKVRVAARVGCPF* |
| Ga0075435_1007354051 | 3300007076 | Populus Rhizosphere | DFTPAKIQMRLPGLVWGGIAMEAALGRRRIVSLRYVQLGKVRAAAHIGCPF* |
| Ga0099793_103215931 | 3300007258 | Vadose Zone Soil | RLPGLVWGGIAMEAGLGRKRLVSLRYIQLGKIRAANRVGCPF* |
| Ga0066710_1039689822 | 3300009012 | Grasslands Soil | TPAKIQMRLPGLVWGGIAMEAGLGRKRLVSLRYIQLGKIRAAARVGCPF |
| Ga0105250_102465681 | 3300009092 | Switchgrass Rhizosphere | RVPGIVWGGIAMEAGMGRKRKVSLRFIQLAKVRTAWRIGCPF* |
| Ga0105240_122950652 | 3300009093 | Corn Rhizosphere | WGSIAMEAGLGRKRKVSLRFIQLAKVRTASRIGCPF* |
| Ga0105240_123734151 | 3300009093 | Corn Rhizosphere | TPVKQQMRVPGMDWGSIAMEAGLGRKRKVSLRFIQLAKVRTAARVGCPF* |
| Ga0075418_101742925 | 3300009100 | Populus Rhizosphere | RVPGLVWGSIAMEAGLAKKRRVSLRFVQLGKVRTAARVGCPF* |
| Ga0105247_109517033 | 3300009101 | Switchgrass Rhizosphere | LVWGGIAMEAALGRKRIVSLRYIQLGKVRAASRVGCPF* |
| Ga0066709_1026632501 | 3300009137 | Grasslands Soil | KARTPGLVEMRLRELMWGGVVMAAAFGRKRLVSCRYFRLITVRAAARIGCSF* |
| Ga0114129_116571653 | 3300009147 | Populus Rhizosphere | TPAKIQMRLPGLVWGGIAMETALGRKRIVSLRYIQLGKIRAAARVGCPF* |
| Ga0111538_103344961 | 3300009156 | Populus Rhizosphere | MRLPGLVWGGLAMEAALGRKRLVSLRYIQLGKIRAAARVGCPF* |
| Ga0075423_108061453 | 3300009162 | Populus Rhizosphere | QMRVPGLVWGGIAMEAGLGRKRRVSLRFIQLGKVRTAARIGCPF* |
| Ga0105241_104430053 | 3300009174 | Corn Rhizosphere | VWGGIGMEAALGRKRIVSLRYIQLGKVRVAARVGCPF* |
| Ga0105242_118475583 | 3300009176 | Miscanthus Rhizosphere | QMRVPGMVWGSIAMEAGLGRKRKVSLRFIQLAKVRTASRVGCPF* |
| Ga0105248_100931996 | 3300009177 | Switchgrass Rhizosphere | LTPVKQQMRLPGMVWGSIAMEAGLGRKRKVSLRFIQLGKVRTAARIGCPF* |
| Ga0105237_122258671 | 3300009545 | Corn Rhizosphere | VPGMVWGSIAMEAGLGRKRKVSLRFIQLAKVRTAARVGCPF* |
| Ga0105249_101610231 | 3300009553 | Switchgrass Rhizosphere | TPVKIHMRVPGLVWGRIAMEAGLGKKRQVSLRYIQLGKVRTAARVGCPF* |
| Ga0105249_132575941 | 3300009553 | Switchgrass Rhizosphere | MVWGSIAMEAGLGRKRKVSLRFIQLAKVRTASRIGCPF* |
| Ga0126315_107710982 | 3300010038 | Serpentine Soil | TPAKIQTRLPGLVWGGIAMETALGRKRIVSLRHIQLGKVRAASRVGCPF* |
| Ga0126380_106418131 | 3300010043 | Tropical Forest Soil | MRKMFARDLTPVKIQMRKPGLVWGGIAMDAGLGRKRSVSLRFSQLAKVRTAARIGCPF* |
| Ga0126310_108304503 | 3300010044 | Serpentine Soil | GSIAMEAGLAKKRKVSLRFVQLGKVRTAARIGCPF* |
| Ga0126311_105598741 | 3300010045 | Serpentine Soil | GLVWGSIAMEAGMGRKRKVSLRFIQLGKVRTAARIGCPF* |
| Ga0126384_108258453 | 3300010046 | Tropical Forest Soil | LQMRLPGLVWGTIGMEAGLGRKRRVSLKYTQLAKVRTAARIGCPF* |
| Ga0126384_111923702 | 3300010046 | Tropical Forest Soil | CSVDMEGVLAKKRSVSLRYIQPGKVRAASRIGCPF* |
| Ga0126384_111924122 | 3300010046 | Tropical Forest Soil | MMRRMFGKHLTPARILMLRPGIVWGSVAMEGGLAKKRSVSLRYIQLGKVRAASSIGCPF* |
| Ga0126384_115966881 | 3300010046 | Tropical Forest Soil | ATIQMRVPGLIWGSIGMEAGLGKKRRVSLRYTQLAKVRAASRIGCPF* |
| Ga0126382_100528301 | 3300010047 | Tropical Forest Soil | MRKMFGKDFTPAKIQMCLPGLVWGGVVMEAALGRKRLVSLRYIQLGKIRATARMDCPF* |
| Ga0126382_106740631 | 3300010047 | Tropical Forest Soil | IQMRLPGLVWGGIAMEAALGRKRIVSLRYIQLGKVRAASRVGCPF* |
| Ga0126373_107520464 | 3300010048 | Tropical Forest Soil | TPAKMQMRLPGLVWGSIAMEAGLGKKRRVSLRYTQLAKVRTAARVGCPF* |
| Ga0126373_119690873 | 3300010048 | Tropical Forest Soil | VWGGIAMETALGRKRLVSLRYIQLGKIRAAARVGCPF* |
| Ga0099796_103501951 | 3300010159 | Vadose Zone Soil | LLWFYGVMRKMFGKDFTPAKIQMRLPGLVWGGIAMEAGLGRKRPVSLRYIQLRKNPCRFA |
| Ga0134082_104419413 | 3300010303 | Grasslands Soil | QMRLPGLVWGGIAMETALGRKRLVSLRYIQLGKIRAAARIGCPF* |
| Ga0134064_100477353 | 3300010325 | Grasslands Soil | MRKMFGKDFTPAKIQMRLPSLVWGGIAMEAALGRKRLVSLRYIQLGKIRAAARIGCPF* |
| Ga0134063_103562221 | 3300010335 | Grasslands Soil | FYGVIRKMFGKDFTPVKIQMRLPGLVWGGIAMEAGLGRKRLVSLRYIQLGKIRAAARIGCPF* |
| Ga0134063_105970943 | 3300010335 | Grasslands Soil | PGLVWGGVAMEAALGRKRLVSLRYIQLGKVRAAARVCYPF* |
| Ga0126370_109006851 | 3300010358 | Tropical Forest Soil | MRRPGLVWGSIAMEAGLGRKRRVSLRYIQLAKVRTAARIGCPF* |
| Ga0126370_114263791 | 3300010358 | Tropical Forest Soil | MRKMFRTDLTSVKLQMRLPGLVWGGIAMEAALGRLRLVSLRYIQLGKIRAAARIGCLF* |
| Ga0126376_1000579710 | 3300010359 | Tropical Forest Soil | CVAMEAGIGRKRRVSLRYIQLAKVRAAALIGCPF* |
| Ga0126376_120714301 | 3300010359 | Tropical Forest Soil | GIVWGGIAMEAGMARKRKVSLRLVQLAKVRTAARVGCPF* |
| Ga0126378_116188733 | 3300010361 | Tropical Forest Soil | GKNFTPAKIQMRVPALVWGGIAMETAFGRRRIVSLRYIQLGKVRAASRVGCPF* |
| Ga0126379_111887463 | 3300010366 | Tropical Forest Soil | FTPAKIQMRLPALVWGGIAMEAALGRKRIVSLRYIQLGKVRAATRAGCPF* |
| Ga0134128_101532231 | 3300010373 | Terrestrial Soil | PAKIQMRVPGLVLGGLAMEAGLGRKRLVSLRYIQLGKTRAAARIGCPF* |
| Ga0134128_108918051 | 3300010373 | Terrestrial Soil | KMFRKDLTPAKIQMRLPGLAWGGIAMEAGLSRRRLVSLRYIQFGRIRAAARIGCPF* |
| Ga0105239_101312865 | 3300010375 | Corn Rhizosphere | LPWLVWGGIAMEAALGRKRIVSLRYIQLGKVRAASRVGCPF* |
| Ga0105239_112380241 | 3300010375 | Corn Rhizosphere | PGVVWGGIAMETALAKKRRVSLRFIQLGKVRTAWRIGCPF* |
| Ga0126381_1002421631 | 3300010376 | Tropical Forest Soil | RDLTPAKVQMRVPGIVWGSIGMEAGLGRKRRVSLRYTQLGKLRAASRIGCPF* |
| Ga0126381_1013648071 | 3300010376 | Tropical Forest Soil | MHLPALVWGGIAMETALGRKRIVSLRYIQLGKVRAAARVGCPF* |
| Ga0126381_1049651102 | 3300010376 | Tropical Forest Soil | MRLPGLVWAGILMEMALGRKRRVSLRYIQLGRVRTAARVGCPF* |
| Ga0134126_109098833 | 3300010396 | Terrestrial Soil | DLTPAKIQMRLPGMVWGGLAMEAALGRKRLVSLRYIQLGKVRAASRVGCPF* |
| Ga0134124_120399192 | 3300010397 | Terrestrial Soil | FYSVMRKMFGKNLTLVKQQMKTPGLVWGTIAMVAGLGRKRKVSLRYIQLGKVRTAWRIGCPF* |
| Ga0126383_106879253 | 3300010398 | Tropical Forest Soil | MRKMFRTDLTSVKLQMRLPGLVWGGIAMEAALGRKRLVSLRYIQLGKIRAATRVGCPF* |
| Ga0134127_107658513 | 3300010399 | Terrestrial Soil | VWGGIAMEAALGRKRLVSLRYIQLGKVRVASRVGCPF* |
| Ga0134127_118639361 | 3300010399 | Terrestrial Soil | MVWGSIAMEAGLAKKRKVSLRFIQLGKVRTAARVGCPF* |
| Ga0134127_121227411 | 3300010399 | Terrestrial Soil | QMRVPGIVWGGIAMEAGMGRKRKVSLRFIQLAKVRTAWRIGCPF* |
| Ga0134122_105231673 | 3300010400 | Terrestrial Soil | GLVWGSIDMEAGLGRKRKVSLRHIQLGKVRTAARIGCPF* |
| Ga0134122_109496563 | 3300010400 | Terrestrial Soil | VWGSVAMEAGMGRKRRVSLRYIQLAKVRTAARIGCPF* |
| Ga0134122_133898842 | 3300010400 | Terrestrial Soil | SIAMEAGLGRKRRVSLRYIQLAKVRTAARIGCPF* |
| Ga0134121_116530881 | 3300010401 | Terrestrial Soil | AKMQMRKPGLVWGSIAMEAGLARKRRVSLRYIQLAKVRTAARIGCPF* |
| Ga0134121_117573471 | 3300010401 | Terrestrial Soil | AKMQMRLPGLMWGSIAMEAGLSRKRRISFRYSQLAKVRTASLIGCPF* |
| Ga0137382_104957183 | 3300012200 | Vadose Zone Soil | MRLPGLVWGGIAMEAGLGRKRLVSLRYIQLGEIRAAARIGCPF* |
| Ga0137382_106377761 | 3300012200 | Vadose Zone Soil | AKVQMRLPGLVWGGIAMEAGLGRKRLVSLRYIQLGRIRAAARVGCPF* |
| Ga0137365_100296862 | 3300012201 | Vadose Zone Soil | MRLPGLVWGGVAMEAALGCKRLVSLRYIQLGKVRAAARIGCPF* |
| Ga0137363_101009511 | 3300012202 | Vadose Zone Soil | KDFTPAKIQMRLPGLVWGGIAMETALGRKRLVSLRYIQLGKIRAAARIGCPF* |
| Ga0137362_105274312 | 3300012205 | Vadose Zone Soil | TPAKIQMHVPGIVWGSIGMEAGLGRKRRVSLRYIQLGKVRTAARVGCPLCKRIPGVVK* |
| Ga0137381_104455383 | 3300012207 | Vadose Zone Soil | ALARTRLGGIAMEAGLGRKRLVSLRYIQLGKIRAAARIGCPF* |
| Ga0137376_112951001 | 3300012208 | Vadose Zone Soil | PGLVWGGIAMEAGLGRKRLVSLRYIQLGRIRAAAPVGCPF* |
| Ga0137379_107505591 | 3300012209 | Vadose Zone Soil | MFGKDFTPAKIQMRLPGLVWGGIAMEAALGRKRLVSLRYIQLGKIRAATRIG |
| Ga0137377_108336174 | 3300012211 | Vadose Zone Soil | RFPRLVWGGIAMEVALGRKRLVSLRYIQLGRIRAAARVGCPF* |
| Ga0137377_110920183 | 3300012211 | Vadose Zone Soil | PAKVQMRLPGLIWGGIAIEAALGRKRLVSLRYFQLGKVRAAARIGCSF* |
| Ga0137370_104489423 | 3300012285 | Vadose Zone Soil | RLPSLVWGGIAMEAALGRKRLVSLRYIQLGKIRAAARIGCPF* |
| Ga0137387_101134021 | 3300012349 | Vadose Zone Soil | LVWGGIAMEAGLGRKRLVSLRYIQLGKIRAAARIGCPF* |
| Ga0137372_107254513 | 3300012350 | Vadose Zone Soil | GIAMEAALSRKRLVSLRYMQLGKVRAAARIGCPF* |
| Ga0137367_106458353 | 3300012353 | Vadose Zone Soil | VMRKMFGKDFTPAKIQMRLPGLVWGGIAMEAALSRKRLVSLRYMQLGKVRAAARIGCAF* |
| Ga0137366_107836483 | 3300012354 | Vadose Zone Soil | GLVWGGIAMEAALSRKRLVSLRYMQLGKVRAAARVGCPF* |
| Ga0137384_102375163 | 3300012357 | Vadose Zone Soil | KMFGKDFTPAKIQMRLPSLVWGGIAMEAALSRKRLVSLRYMQLGKVRAAARIGCAF* |
| Ga0137385_103176623 | 3300012359 | Vadose Zone Soil | VWGGIAMEARLGRKRLVSLRYIQLGKIRAATRIGCPF* |
| Ga0137385_104316801 | 3300012359 | Vadose Zone Soil | QMRLPALVWGGVAMEAALGRKRLVSLRYIQLGKVRAAARVGCPF* |
| Ga0137396_107133213 | 3300012918 | Vadose Zone Soil | FGKELTPVKLQMRVPGIVWGSIAMEAGIGRKRRVSLRYIQLAKVRTAARIGCPF* |
| Ga0137404_116044593 | 3300012929 | Vadose Zone Soil | LPGLVWGGVAMEAALGRKRLVSLRYIQLGKIRAAARVGCPF* |
| Ga0164300_100966451 | 3300012951 | Soil | KIQMRLPGLVWGGIAMEAGLGRKRLVSLRYIQLGKIRAAARIGCPF* |
| Ga0164298_104626253 | 3300012955 | Soil | MFRKDFTPAKIQMRLPALVWGGIAMEAGLGRERLVSLRYIQLGKIRAGARVGCPF* |
| Ga0164303_100014054 | 3300012957 | Soil | MFRKDFTPAKIQMRLPGLVWGGIAMEAGLGRERLVSLRYIQLGKIRAGARVGCPF* |
| Ga0164301_118026211 | 3300012960 | Soil | VKQQMRVPGMVWGSIAMEAGLGRKRKVSLRFVQLGKVRTAARVGCPF* |
| Ga0164309_107654401 | 3300012984 | Soil | QMRLPGMVWGGIAMEAALGRKRLVSLRYIQLGKIRVASRVGCPF* |
| Ga0164305_102056681 | 3300012989 | Soil | MFRKDFTPAKIQMRLPTLVWGGIAMEAGLGRERLVSLRYIQLGKIRAGARVGCPF* |
| Ga0164305_105343253 | 3300012989 | Soil | VWGGIAMEAGLGRKRLVSLRYIQLGKTRAAARIGCPF* |
| Ga0157373_108266211 | 3300013100 | Corn Rhizosphere | KDLTPVKMQMRVPGVVWGGIGMEAGLGAKRRVSLRFIQLGKVRTAARIGCPF* |
| Ga0157369_107728821 | 3300013105 | Corn Rhizosphere | MRLPGVVWGTLAMEAGLSRKRRVSLRYLQLAKVRTASRIGCPF* |
| Ga0157374_106587601 | 3300013296 | Miscanthus Rhizosphere | IQMRLPGLVWGGIAMEAALGRRRIVSLRYVQLGKVRAAARIGCPF* |
| Ga0157378_100195477 | 3300013297 | Miscanthus Rhizosphere | PGIVWGSIGMEAGLGRKRRVSLRFIQLGKVRTASRIGCPF* |
| Ga0163162_128801801 | 3300013306 | Switchgrass Rhizosphere | VKMQMRVPGMVWGGIAMEAGLAKKRRVSLRFIQLGKVRTAARVGCPF* |
| Ga0134078_104078661 | 3300014157 | Grasslands Soil | MRLPGLVWGGVAMEAALGRKRLVSLRYIQLGKVRAAARVGCPF* |
| Ga0134078_105336181 | 3300014157 | Grasslands Soil | FYCVIRKMFKKDFTPVKIQMRLPGLVWGGIAMEARLGRKRLVSLRYIQLGKIRAATRIGCPF* |
| Ga0134079_101655574 | 3300014166 | Grasslands Soil | AKIQMRLPSLVWGGIAMEAALSRKRLVSLRYMQLGKVRAAARIGCAF* |
| Ga0157380_123893542 | 3300014326 | Switchgrass Rhizosphere | VMRKMFGKELTPVKQQMRVPGLVWGSIAMEAGLARKRKVSLRFIQLGKVRTAWRIGCPF* |
| Ga0157377_107926911 | 3300014745 | Miscanthus Rhizosphere | AKMQMRLPGLMWGTIALEAGLSRKRRVSLRYSQLAKVRTASRIGCPF* |
| Ga0173480_110317422 | 3300015200 | Soil | GLVWGSIAMEAGMGRKRRVSLRYIQLAKVRTASLIGCPF* |
| Ga0182006_13277462 | 3300015261 | Rhizosphere | QMRLPGMVWAGIAMEAALGRKRLVSLRYIQLGKVRAAARVGCPF* |
| Ga0134072_100938391 | 3300015357 | Grasslands Soil | QMRVPGLIWGSVGMEAALGRKRRISLRYAQLAKVRAASRVGCPF* |
| Ga0134085_100222481 | 3300015359 | Grasslands Soil | GKDFTPAKIQMRLPSLVWGGIAMEAALSRKRLVSLRYMQLGKVRAAARIGCAF* |
| Ga0134085_103702931 | 3300015359 | Grasslands Soil | LPGLVWGGIAMEAGLGRKRLVSLRYIQLGKIRAASRVGCLSE* |
| Ga0132256_1003428151 | 3300015372 | Arabidopsis Rhizosphere | WFYGVMRKIFRKDLTPAKIQMRLPGLVWGGIAMEAALSRKRLVSMRYIQLGRIRAAARIGCPF* |
| Ga0132256_1035001821 | 3300015372 | Arabidopsis Rhizosphere | LMWGSIAMEAGLSRKRRISFRYSQLAKVRTASLIGCPF* |
| Ga0132257_1002748441 | 3300015373 | Arabidopsis Rhizosphere | MRVPGIVWGSIGMEAGLGRKRRVSLRLLQLAKIRAAARIGCPF* |
| Ga0132255_1001453302 | 3300015374 | Arabidopsis Rhizosphere | MRKMFGKDFTPAKIQMRVPGLVWGGLAMEAGLGRKRLVSLRYIQLGKTRAAAHIGCPF* |
| Ga0182033_118937491 | 3300016319 | Soil | IQMRLPGLVWGGIVMETALGRRRIVSLRYVQLGKIRAASRVGCPF |
| Ga0182032_111486471 | 3300016357 | Soil | KGRRKIQMRLPGLVWGGIAIEAGLGCKRLISLRYIQLRKVRARVWISPH |
| Ga0182034_104915011 | 3300016371 | Soil | PGKDSDALPALVWGGIAMETALGRRRIVSLRYIQLGKVRTASRFGCPF |
| Ga0182040_119689031 | 3300016387 | Soil | QMRLPGLVWGGIAMEAALGRKRLVSLRYIQLGKVRAAARVGCPF |
| Ga0182038_105242592 | 3300016445 | Soil | YGVMERMFHKDLTPVKIQMRKPGLVWGSIAMEAGLGRKRKVSLRYIQLAKVRTAARIGCP |
| Ga0134069_13757712 | 3300017654 | Grasslands Soil | FTPAKIQMRLPGLVWGGIAMEAGLRRKRLVSLRYIQLGKIRAAARVGCPF |
| Ga0134112_102232463 | 3300017656 | Grasslands Soil | KDLTPARVQMRVPGLVWGGIAMEAGLGRKRLLSPRYIQLAKVRTAARIGCPF |
| Ga0187822_103579791 | 3300017994 | Freshwater Sediment | MPKMFGKDFTPVKIQMRIPGLVWAGIAMEAAIGRKRLVSMRCIQLGRIRAAARIGCPS |
| Ga0184604_102938302 | 3300018000 | Groundwater Sediment | FYGTMRKMFGKELTPVKIQMRLPGLVWGSIGMEAALGRKRRASLRFIQLAKVRTAARIGCPF |
| Ga0184620_103449231 | 3300018051 | Groundwater Sediment | TPAKIQMRLPGLVWGGIAMEAALSRKRLVSLRYLQLGRIRAAARIGCPF |
| Ga0184621_102429871 | 3300018054 | Groundwater Sediment | LVWGGIAMEAGLSRKRLVSLRYIQLGRIRAAARIGCPF |
| Ga0184635_101451763 | 3300018072 | Groundwater Sediment | MFRKDLTPAKIQMRLPGLVWGGIAMEAALSRKRLVSLRYIQLGRIRAAARIGCPF |
| Ga0184635_102828082 | 3300018072 | Groundwater Sediment | FTPAKIQMRLPGLVWGGIAMEAGLGRKRLVSLRYIQLGKIRAAARVGCPF |
| Ga0184609_103047441 | 3300018076 | Groundwater Sediment | KIQMRVPGLVWGGIAMEAGLGRKRLVSLRYIQLGKVHTAARVGCPF |
| Ga0184609_105320561 | 3300018076 | Groundwater Sediment | RWFYGMMRKMFGKDFTPTKIQMRLPGLVWGAIAMEAGLGRKRLVSLRYIQLGKVLAAARIGCPF |
| Ga0184612_105499111 | 3300018078 | Groundwater Sediment | TPAKIQMRVPGLVWGGIALEAGLARKRLVSLRYIQLGKIRATSRVGCPF |
| Ga0184625_106674382 | 3300018081 | Groundwater Sediment | MFGKDFTPAKIQMRLPGLVWGGIAMEAGLGRKRLVSLRYIQLGKIRAAARLGCPF |
| Ga0066669_108338213 | 3300018482 | Grasslands Soil | FYGVMRKMFQKDLTPAKIQMRLPGIVWGSIAMEAGLGKRRRVSLRYTQLAKVRTAARIGCPF |
| Ga0173482_102499583 | 3300019361 | Soil | GGIAMEAGLGRKRLVFLRYIQLGKIRAAARVGCPF |
| Ga0193704_10970831 | 3300019867 | Soil | KDFTPAKIQMRLPGLVWGGIAMEAGLGRKRLVSLRYIQLGKIRAASRVDCPF |
| Ga0193700_10220081 | 3300019873 | Soil | YGVMRKMFRKDLTPAKIQMRLPALVWGGIAMEAALGRKRLVSLRYMQLGKVRAAARIGCP |
| Ga0193744_10919023 | 3300019874 | Soil | LPGLVWGGIAMEAALSRKRLVSMRYIQLGRIRAAARIGCPF |
| Ga0193712_11010072 | 3300019880 | Soil | KIQVRLPGLVWGGIAMEAGLGRKRLVSLRYIQLGKIRAAARVGCPF |
| Ga0193707_100003040 | 3300019881 | Soil | MRKTFGKDFTPAKIQMRLPGLVWGGIAMEAGLGRKRLVSLRYIQFGKTRAAARIGCPF |
| Ga0193731_11008251 | 3300020001 | Soil | TPAKIQMRLPGLVWGGIAMEAGLGRKRLVSLRYIQLGKIRAASRVGCPF |
| Ga0193735_10180506 | 3300020006 | Soil | RKMFRKDLTPAKIQMRLPGLVWGGIAMEAALSRKRLVSLRYIQLGRIRAAARIGCPF |
| Ga0179594_101754183 | 3300020170 | Vadose Zone Soil | MFGKDFTPAKIQMRLPGLVWGGIAMETALGRKRLVSLRYIQLGKIRAAARIGCPF |
| Ga0210381_102507983 | 3300021078 | Groundwater Sediment | GVMRKMFRKDLTPAKIQMRLPGLVWGGIAMEAALSRKRLVSLRYLQLGRIRAAARIGCPF |
| Ga0210382_100695522 | 3300021080 | Groundwater Sediment | MRLPGLVWGGIAMEAGLGRKRLVSFRYIQLGKIRAASRVGCPF |
| Ga0212123_1000042983 | 3300022557 | Iron-Sulfur Acid Spring | MRLPGLGWGGIAMEAGLGRKRLVSLRYLQLGKIRAAARVGCPF |
| Ga0222622_108631332 | 3300022756 | Groundwater Sediment | PAKIQMRVRGLVLGGIAMEPGLGRKGLVSLRYIQLGRVRTAARVGCPF |
| Ga0179589_102786533 | 3300024288 | Vadose Zone Soil | DFTQAKIQMRLPGLVWGGIAMEAGLGRKRLVSLRYIQLGKTRAAARIGCPF |
| Ga0207692_106459522 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | AKIQMRLPGLVWGGIAMEAGRGRKRLVSLRYIQLGKIRAAARTGCPF |
| Ga0207643_103545253 | 3300025908 | Miscanthus Rhizosphere | MVWGSIAMEAGLGRKRKVSLRFIQLAKVRTAARVGCPF |
| Ga0207705_109143733 | 3300025909 | Corn Rhizosphere | AKIQMRLPGMVWGGIVMEAALGRKRLVSLRYIQLGKVRVASRVGCPF |
| Ga0207684_109471921 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | GLVWGGIAMETGLGRKRLVSLRYIQLGKIRAAARVGCPF |
| Ga0207654_106207873 | 3300025911 | Corn Rhizosphere | GMVWGSIAMEAGLGRKRKVSLRFIQLGKVRTASRVGCPF |
| Ga0207660_109944871 | 3300025917 | Corn Rhizosphere | PGLMWGSIAMEAGLSKKRQVSLRYIQLGKVRTAARVGCPF |
| Ga0207657_101815573 | 3300025919 | Corn Rhizosphere | VWGGIVMEAALGRKRLVSLRYIQLGKVRVASRVGCPF |
| Ga0207646_115801212 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | WGGIAMETGLGRKRLVSLRYIQLGKIRAAARVGCPF |
| Ga0207650_102285094 | 3300025925 | Switchgrass Rhizosphere | LTPVKQQMRVPGVVWGGIGMELGLAKKRRVSLRYVQLGKVRTANRIGWPF |
| Ga0207650_106998893 | 3300025925 | Switchgrass Rhizosphere | MHMRVPGLVWGSIAMEAGLAKKRRVSLRFVQLGKVRTASRVGCPF |
| Ga0207659_108680023 | 3300025926 | Miscanthus Rhizosphere | LTPVKMQMRLPGMVWGSIAMEAGLGKSRKVSLRFIQLGKVRTAARVGCPF |
| Ga0207659_114174911 | 3300025926 | Miscanthus Rhizosphere | AWGGIAMEAGLSRRRLVSLRYIQFGRIRAAARIGCPF |
| Ga0207644_104114704 | 3300025931 | Switchgrass Rhizosphere | IQMRKPGLVWGSVAMEAGMGRKRRVSLRYIQLAKVRTAARIGCPF |
| Ga0207706_105411443 | 3300025933 | Corn Rhizosphere | VWGSVGMEAGLRRKRRVSLRFIQLAKVRTASRIGCPF |
| Ga0207670_117809502 | 3300025936 | Switchgrass Rhizosphere | MRVPGLVWGGLAMEAGLGRKRLVSLRYIQLGKTRAAARIGCPF |
| Ga0207689_112092483 | 3300025942 | Miscanthus Rhizosphere | LTPVKMQMRVPGLVWGSVGMEAGLGAKRRVSLRFIQLGKVRTAARVGCPF |
| Ga0207703_105291893 | 3300026035 | Switchgrass Rhizosphere | PGIVWGSIAMEAGLGRKRKVSLRFIQLGKVRTAARVGCPF |
| Ga0207639_101051722 | 3300026041 | Corn Rhizosphere | MFGKALTPVKQQMHVPGLVWGSIGMEAGLSRKRKVSLRYIQIGKVRTAWRVGCPF |
| Ga0207702_101121874 | 3300026078 | Corn Rhizosphere | MFGKALTPVKQQMHVPGLVWGSIGMEAGLSRKRKVSLRYIQIGKVRTAWRVG |
| Ga0207641_107628783 | 3300026088 | Switchgrass Rhizosphere | KDLTPVKQQMRLPGMVWGSIAMEAGLGRKRKVSLRFIQLGKVRTASRIGCPF |
| Ga0207676_108110921 | 3300026095 | Switchgrass Rhizosphere | MFGKDLTSAKMQMRLPGLMWGSIAMEAGLSRKRRISFRYSQLAKVRTASLIGCPF |
| Ga0207676_112657941 | 3300026095 | Switchgrass Rhizosphere | MFGKALTPVKQQMHVPGLVWGSIGMEAGLSRKRKVSLRYIQIGKVRTAWRVGC |
| Ga0209470_10346411 | 3300026324 | Soil | GKDFTPAKIQMRLPSLVWGGIAMEAALSRKRLVSLRYMQLGKVRAAARIGCAF |
| Ga0209801_12177753 | 3300026326 | Soil | MRLPGLVWGGVAMEAALGRKRLVSLRYIQLGKVRATARIGCPF |
| Ga0209266_11452311 | 3300026327 | Soil | QMRLPGLVWGGVAMEAALGCKRLVSLRYIQLGKVRAAARIGCPF |
| Ga0209157_11785163 | 3300026537 | Soil | STPAKVQMRLPGLVWGGVAMEAALGRKRLVSLRYIQLGKVRATARIGCPF |
| Ga0209056_100284241 | 3300026538 | Soil | DFTPVKIQMRLPGLVWGGIAMEARLGRKRLVSLRYIQLGKIRAATRIGCPF |
| Ga0209156_103392122 | 3300026547 | Soil | VPGVVWGSIGMEAGLSRKRRVSLRYTQLSKVRAASRIGCPF |
| Ga0209161_101743151 | 3300026548 | Soil | RKMFGKDFTPAKIQMRLPSLVWGGIAMEAALSRKRLVSLRYMQLGKVRAAARIGCAF |
| Ga0209474_100318516 | 3300026550 | Soil | MRVPGLVWGGIAMEAGLGRKRLLSPRYIQLAKVRTAARIGCPF |
| Ga0209474_104890681 | 3300026550 | Soil | LPGLVWGGVAMEAALGRKRLVSLRYIQLGKVRAAARVGCPF |
| Ga0209215_10676551 | 3300027266 | Forest Soil | WGSIAMEVGLSRKRRVSLRYIQLAKVRTAARVGCPF |
| Ga0207543_1003281 | 3300027417 | Soil | DFTPAKIQMRLPGLVWGGIAMEAGLGRKRLVFLRYIQLGKIRAAARVGCPF |
| Ga0209622_10097742 | 3300027502 | Forest Soil | MRKMFGKDFTPAKIQMRLPGLIWGGIAMEAGLGRKRLVSLRCIQLGKIRAAARIGCPF |
| Ga0268266_102739231 | 3300028379 | Switchgrass Rhizosphere | QMRLPGMVWGGLAMEAALVRKRLVSLRYIQLGKVRAASRVGCPF |
| Ga0268266_121643662 | 3300028379 | Switchgrass Rhizosphere | QMRVPGVVWGGIAMETALAKKRRVSLRFIQLGKVRTAWRIGCPF |
| Ga0137415_106517331 | 3300028536 | Vadose Zone Soil | MRNIFGKDFTPVKIQMHLPGLVWGGIAMEAALGRKRLVSLRYIQLGKIRAATRIGCPF |
| Ga0307291_10339773 | 3300028707 | Soil | GGIAMEAGLGRKRLVSLRYIQLGKIRAAARVGCPF |
| Ga0307293_100739671 | 3300028711 | Soil | YGVMRKMFRKDLTPAKIQMRLPALVWGGVAMEAALGRKRLVSLRYMQLGKVRAAARIGCP |
| Ga0307307_101290011 | 3300028718 | Soil | KDLTPAKIQMRLPALVWGGIAMEAALGRKRLVSLRYMQLGKVRAAARIGCPF |
| Ga0307307_102265112 | 3300028718 | Soil | KIQMRLPGLVWGGIAMEAGLGRKRLVSLRYIQLGKIRAASRVGCPF |
| Ga0307280_101413683 | 3300028768 | Soil | KCSGKITPAKIQMRLPGLVWGGIAMEAALGRKRLVSLRYIQLGKIRAAARVGCPF |
| Ga0307305_100958301 | 3300028807 | Soil | KDFTPAKIQMRLPGLVWGGIAMEAGLGRKRLVSLRYIQLGKIRAASRVGCPF |
| Ga0307277_105305062 | 3300028881 | Soil | GLVWGGIAMEAALSRKRLVSLRYIQLGRIRAAARIGCPF |
| Ga0307308_100098409 | 3300028884 | Soil | LPGLVWGAIAMEAGLGRKRLVSLRYIQLGKTRAAARIGCPF |
| Ga0307304_104711433 | 3300028885 | Soil | LPALVWGGIAMEAALGRKRLVSLRYMQLGKVRAAARIGCPF |
| Ga0170824_1170732303 | 3300031231 | Forest Soil | WGGIAMEAVLGRKRLVSLRYIQLGKIRAAARIGCPF |
| Ga0170824_1202794952 | 3300031231 | Forest Soil | MRKMFGKDFTPAKIQMRLPGLVWGGIAMEAGLGRKRLVSLRYIQLGKTRAAARIGCPF |
| Ga0170820_141933071 | 3300031446 | Forest Soil | MRKMFGKDFTPAEIQMRLPGLVWGGIVMEAGLGRKRLVSLRYIQLGKIRAAARIGCPF |
| Ga0170819_142974701 | 3300031469 | Forest Soil | IQMRFPGLVWGGIVMEAGLGRKRLVSLRYIQLGKIRAASRVGCPF |
| Ga0310886_104133131 | 3300031562 | Soil | LVWGGIAMEAGMGRKRKVSLRFIQLAKVRTAWRIGCPF |
| Ga0307405_100363671 | 3300031731 | Rhizosphere | PGLVWGSIAMEAGMGRKRRVSLRFIQLGKVRTAARVGCPF |
| Ga0307475_107421231 | 3300031754 | Hardwood Forest Soil | LTPAKVQMRLPCLVWGGIAMEAALGRKRLISLRYIQLGKIRAAARIGCPF |
| Ga0307473_107068041 | 3300031820 | Hardwood Forest Soil | TPAKIQMRVPGLGWGGIAMKAGLGRKRLLSLRYIQLGKIRAAARVGCPF |
| Ga0310917_109387421 | 3300031833 | Soil | MFHKDLTPVKIQMRKPGLVWGSIAMEAGLGRKRKVSLRYIQLAKVRTAARIGCPF |
| Ga0307410_115750171 | 3300031852 | Rhizosphere | VPGLVWGGIAMEAGLAKKRRVSLRFVQLGKVRTASRVGCPF |
| Ga0310892_105355903 | 3300031858 | Soil | KPGLVWGSIAMEAGMGRKRRVSLRYIQLAKVRTAARIGCPF |
| Ga0310900_115201831 | 3300031908 | Soil | IVWGGIAMEAGMGRKRKVSLRFIQLAKVRTAWRIGCPF |
| Ga0310900_115918402 | 3300031908 | Soil | PALVWGGIGMEAALGRKRIVSLRYIQLGKIRAAARVGCPF |
| Ga0310900_118788002 | 3300031908 | Soil | DLTPVKQQMRVPGLVWGSVAMEAGLGAKRRVSLRFIQLGKVRTAARVGCPF |
| Ga0307412_118611592 | 3300031911 | Rhizosphere | LTPVKLQMRKPGLVWGGIALEAGLSRKRRVSLRYIQLAKVRTAARVGCPF |
| Ga0310891_102433603 | 3300031913 | Soil | KIQMRKPGLVWGSIAMEAGMGRKRRVSLRYIQLAKVRTAARIGCPF |
| Ga0310901_101199203 | 3300031940 | Soil | GGIAMEAALGRKRLVSLRYIQLGKIRAASRVGCPF |
| Ga0307416_1034803322 | 3300032002 | Rhizosphere | GIVWGGIAMEAGLAKKRRISLRYIQLAKVRTAARIGCPF |
| Ga0310902_107025303 | 3300032012 | Soil | WGSIGMEAGLGRKRRVSLRFIQLAKVRTAARIGCPF |
| Ga0315910_102270923 | 3300032144 | Soil | PVKMQMRVPGIVWGSIGMEAGLAAKRRVSLRFIQLGKVRTAARVGCPF |
| Ga0310889_105099821 | 3300032179 | Soil | IQMRLPGLVWSGIAMEAGLGRKRLVSLRYIQLGKIRAAARVGCPF |
| Ga0307471_1000187088 | 3300032180 | Hardwood Forest Soil | AKIKMRLPGLGWGGIAMEAGLGRKRLVSLRYIQLGKIRAAARVGCPF |
| Ga0315271_119223282 | 3300032256 | Sediment | GVVWGGILMQMALDRNRRVSLRLLQLATVRTAARVGCPF |
| Ga0306920_1028820732 | 3300032261 | Soil | PAKIQMRLPGLVWGGIAMEAGLGRKRLVSLRYIQLGKIRAAARVGCPF |
| Ga0335080_119027101 | 3300032828 | Soil | GIVWGGIAMEAALGWKRLVSLRYFQLGKVRTAGRIGCPF |
| Ga0318519_101191833 | 3300033290 | Soil | VWGGIAIEAALGRKRLVSLRYIQLGKIRAAARVGCPF |
| Ga0310810_103948104 | 3300033412 | Soil | QMRLPSLVWGGIAMEAALGRKRLISLRYIQLGKIRAAARIGCPF |
| Ga0310810_107553921 | 3300033412 | Soil | KIQMRLPGLVWGGIAMEAGLGRKRLVSLRYIQLGKIRAAARVGCPF |
| Ga0326723_0606390_350_505 | 3300034090 | Peat Soil | DLTPVKIQMRLPGLVWGGVAMQAGLDRRRRVSLRHIQLASVRTAARIGCPF |
| ⦗Top⦘ |