Basic Information | |
---|---|
Family ID | F011200 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 294 |
Average Sequence Length | 35 residues |
Representative Sequence | MEVLIPLAIVAVVIAWSVKRFKPELWNKIVSKFKK |
Number of Associated Samples | 161 |
Number of Associated Scaffolds | 294 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 89.46 % |
% of genes near scaffold ends (potentially truncated) | 10.20 % |
% of genes from short scaffolds (< 2000 bps) | 71.77 % |
Associated GOLD sequencing projects | 131 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (59.524 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (28.231 % of family members) |
Environment Ontology (ENVO) | Unclassified (65.306 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (83.333 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.62% β-sheet: 0.00% Coil/Unstructured: 52.38% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 294 Family Scaffolds |
---|---|---|
PF00565 | SNase | 9.18 |
PF13640 | 2OG-FeII_Oxy_3 | 8.50 |
PF08291 | Peptidase_M15_3 | 7.48 |
PF05175 | MTS | 3.74 |
PF13884 | Peptidase_S74 | 2.72 |
PF11351 | GTA_holin_3TM | 2.38 |
PF00959 | Phage_lysozyme | 1.36 |
PF13385 | Laminin_G_3 | 1.02 |
PF13469 | Sulfotransfer_3 | 1.02 |
PF03237 | Terminase_6N | 0.68 |
PF13847 | Methyltransf_31 | 0.34 |
PF05226 | CHASE2 | 0.34 |
PF13759 | 2OG-FeII_Oxy_5 | 0.34 |
PF13456 | RVT_3 | 0.34 |
PF00166 | Cpn10 | 0.34 |
PF03783 | CsgG | 0.34 |
PF10124 | Mu-like_gpT | 0.34 |
PF01476 | LysM | 0.34 |
PF10614 | CsgF | 0.34 |
COG ID | Name | Functional Category | % Frequency in 294 Family Scaffolds |
---|---|---|---|
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.34 |
COG1462 | Curli biogenesis system outer membrane secretion channel CsgG | Cell wall/membrane/envelope biogenesis [M] | 0.34 |
COG4252 | Extracytoplasmic sensor domain CHASE2 (specificity unknown) | Signal transduction mechanisms [T] | 0.34 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 72.11 % |
Unclassified | root | N/A | 27.89 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000101|DelMOSum2010_c10043847 | Not Available | 2304 | Open in IMG/M |
3300000101|DelMOSum2010_c10055508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1944 | Open in IMG/M |
3300000101|DelMOSum2010_c10199273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 674 | Open in IMG/M |
3300000115|DelMOSum2011_c10036483 | Not Available | 2104 | Open in IMG/M |
3300000115|DelMOSum2011_c10161050 | Not Available | 656 | Open in IMG/M |
3300000116|DelMOSpr2010_c10015618 | All Organisms → Viruses → Predicted Viral | 3814 | Open in IMG/M |
3300000116|DelMOSpr2010_c10028292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2645 | Open in IMG/M |
3300000116|DelMOSpr2010_c10098016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Spongiibacteraceae → unclassified Spongiibacteraceae → BD1-7 clade → BD1-7 clade bacterium | 1113 | Open in IMG/M |
3300000116|DelMOSpr2010_c10135715 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 865 | Open in IMG/M |
3300000116|DelMOSpr2010_c10203331 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 633 | Open in IMG/M |
3300000116|DelMOSpr2010_c10272965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
3300000117|DelMOWin2010_c10037860 | All Organisms → Viruses → Predicted Viral | 2266 | Open in IMG/M |
3300000117|DelMOWin2010_c10039566 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2193 | Open in IMG/M |
3300000117|DelMOWin2010_c10061763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1566 | Open in IMG/M |
3300000117|DelMOWin2010_c10087141 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 1193 | Open in IMG/M |
3300000117|DelMOWin2010_c10225454 | Not Available | 561 | Open in IMG/M |
3300000117|DelMOWin2010_c10257962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 507 | Open in IMG/M |
3300000117|DelMOWin2010_c10262676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 500 | Open in IMG/M |
3300001419|JGI11705J14877_10011083 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 3910 | Open in IMG/M |
3300001460|JGI24003J15210_10003925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6413 | Open in IMG/M |
3300001748|JGI11772J19994_1002915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 3442 | Open in IMG/M |
3300001748|JGI11772J19994_1003291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 3227 | Open in IMG/M |
3300001748|JGI11772J19994_1028413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 750 | Open in IMG/M |
3300005512|Ga0074648_1001612 | All Organisms → cellular organisms → Bacteria | 23079 | Open in IMG/M |
3300005512|Ga0074648_1003413 | All Organisms → cellular organisms → Bacteria | 13439 | Open in IMG/M |
3300005512|Ga0074648_1004530 | Not Available | 11053 | Open in IMG/M |
3300005512|Ga0074648_1141280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 749 | Open in IMG/M |
3300005512|Ga0074648_1144426 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300005611|Ga0074647_1000121 | All Organisms → cellular organisms → Bacteria | 48195 | Open in IMG/M |
3300005611|Ga0074647_1000304 | All Organisms → cellular organisms → Bacteria | 30732 | Open in IMG/M |
3300005613|Ga0074649_1063275 | Not Available | 1514 | Open in IMG/M |
3300005613|Ga0074649_1203449 | Not Available | 596 | Open in IMG/M |
3300006025|Ga0075474_10234953 | Not Available | 554 | Open in IMG/M |
3300006026|Ga0075478_10014223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 2707 | Open in IMG/M |
3300006026|Ga0075478_10036632 | All Organisms → cellular organisms → Bacteria | 1626 | Open in IMG/M |
3300006026|Ga0075478_10054883 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1302 | Open in IMG/M |
3300006027|Ga0075462_10254724 | Not Available | 519 | Open in IMG/M |
3300006029|Ga0075466_1001630 | Not Available | 8352 | Open in IMG/M |
3300006029|Ga0075466_1027835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1782 | Open in IMG/M |
3300006029|Ga0075466_1073263 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 966 | Open in IMG/M |
3300006029|Ga0075466_1100783 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300006735|Ga0098038_1006640 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 4680 | Open in IMG/M |
3300006735|Ga0098038_1029564 | Not Available | 2048 | Open in IMG/M |
3300006735|Ga0098038_1038483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1761 | Open in IMG/M |
3300006735|Ga0098038_1039496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1735 | Open in IMG/M |
3300006735|Ga0098038_1048368 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 1541 | Open in IMG/M |
3300006735|Ga0098038_1087237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1088 | Open in IMG/M |
3300006735|Ga0098038_1146305 | Not Available | 789 | Open in IMG/M |
3300006737|Ga0098037_1065964 | Not Available | 1286 | Open in IMG/M |
3300006737|Ga0098037_1252930 | Not Available | 565 | Open in IMG/M |
3300006749|Ga0098042_1037105 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 1360 | Open in IMG/M |
3300006752|Ga0098048_1222178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 555 | Open in IMG/M |
3300006793|Ga0098055_1024163 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 2569 | Open in IMG/M |
3300006802|Ga0070749_10692708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 545 | Open in IMG/M |
3300006867|Ga0075476_10002961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 8046 | Open in IMG/M |
3300006868|Ga0075481_10333401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 525 | Open in IMG/M |
3300006869|Ga0075477_10322624 | Not Available | 610 | Open in IMG/M |
3300006870|Ga0075479_10180398 | Not Available | 853 | Open in IMG/M |
3300006916|Ga0070750_10042387 | Not Available | 2227 | Open in IMG/M |
3300006916|Ga0070750_10229054 | Not Available | 813 | Open in IMG/M |
3300006919|Ga0070746_10168186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1059 | Open in IMG/M |
3300006919|Ga0070746_10183229 | All Organisms → Viruses → Predicted Viral | 1005 | Open in IMG/M |
3300006919|Ga0070746_10505117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudovirales sp. ctOwN3 | 530 | Open in IMG/M |
3300006920|Ga0070748_1022902 | All Organisms → Viruses → Predicted Viral | 2605 | Open in IMG/M |
3300006921|Ga0098060_1079034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 945 | Open in IMG/M |
3300006924|Ga0098051_1106646 | Not Available | 750 | Open in IMG/M |
3300006928|Ga0098041_1066057 | Not Available | 1167 | Open in IMG/M |
3300007229|Ga0075468_10030628 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1922 | Open in IMG/M |
3300007229|Ga0075468_10080941 | Not Available | 1054 | Open in IMG/M |
3300007236|Ga0075463_10039654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Spongiibacteraceae → unclassified Spongiibacteraceae → BD1-7 clade → BD1-7 clade bacterium | 1534 | Open in IMG/M |
3300007538|Ga0099851_1036775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1949 | Open in IMG/M |
3300007538|Ga0099851_1108512 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 1054 | Open in IMG/M |
3300007538|Ga0099851_1112274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1033 | Open in IMG/M |
3300007538|Ga0099851_1204230 | Not Available | 718 | Open in IMG/M |
3300007538|Ga0099851_1205993 | Not Available | 714 | Open in IMG/M |
3300007538|Ga0099851_1268281 | Not Available | 607 | Open in IMG/M |
3300007538|Ga0099851_1305249 | Not Available | 561 | Open in IMG/M |
3300007539|Ga0099849_1256678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 641 | Open in IMG/M |
3300007539|Ga0099849_1336618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Maricaulales → Maricaulaceae → Maricaulis → unclassified Maricaulis → Maricaulis sp. | 539 | Open in IMG/M |
3300007539|Ga0099849_1342058 | Not Available | 533 | Open in IMG/M |
3300007540|Ga0099847_1201665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 580 | Open in IMG/M |
3300007541|Ga0099848_1026031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 2464 | Open in IMG/M |
3300007541|Ga0099848_1069444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Spongiibacteraceae → unclassified Spongiibacteraceae → BD1-7 clade → BD1-7 clade bacterium | 1388 | Open in IMG/M |
3300007542|Ga0099846_1192409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 722 | Open in IMG/M |
3300007542|Ga0099846_1330679 | Not Available | 518 | Open in IMG/M |
3300007623|Ga0102948_1273676 | Not Available | 516 | Open in IMG/M |
3300007640|Ga0070751_1202632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 771 | Open in IMG/M |
3300007640|Ga0070751_1237263 | Not Available | 697 | Open in IMG/M |
3300007778|Ga0102954_1079615 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 913 | Open in IMG/M |
3300007960|Ga0099850_1182975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Maricaulales → Maricaulaceae → Maricaulis → unclassified Maricaulis → Maricaulis sp. | 831 | Open in IMG/M |
3300008012|Ga0075480_10486908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 596 | Open in IMG/M |
3300008050|Ga0098052_1015952 | All Organisms → cellular organisms → Bacteria | 3714 | Open in IMG/M |
3300008217|Ga0114899_1075035 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
3300008999|Ga0102816_1264736 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 543 | Open in IMG/M |
3300009000|Ga0102960_1010020 | All Organisms → cellular organisms → Bacteria | 3580 | Open in IMG/M |
3300009000|Ga0102960_1106113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1022 | Open in IMG/M |
3300009000|Ga0102960_1131068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 907 | Open in IMG/M |
3300009001|Ga0102963_1062486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. TMED43 | 1534 | Open in IMG/M |
3300009001|Ga0102963_1226497 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 742 | Open in IMG/M |
3300009001|Ga0102963_1397037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 541 | Open in IMG/M |
3300009027|Ga0102957_1087497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1079 | Open in IMG/M |
3300009027|Ga0102957_1291529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 596 | Open in IMG/M |
3300009071|Ga0115566_10039495 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 3286 | Open in IMG/M |
3300009071|Ga0115566_10051888 | Not Available | 2781 | Open in IMG/M |
3300009071|Ga0115566_10159230 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 1403 | Open in IMG/M |
3300009071|Ga0115566_10401182 | Not Available | 790 | Open in IMG/M |
3300009071|Ga0115566_10440426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 746 | Open in IMG/M |
3300009149|Ga0114918_10004890 | All Organisms → cellular organisms → Bacteria | 11578 | Open in IMG/M |
3300009149|Ga0114918_10181055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Spongiibacteraceae → unclassified Spongiibacteraceae → BD1-7 clade → BD1-7 clade bacterium | 1236 | Open in IMG/M |
3300009149|Ga0114918_10494729 | Not Available | 655 | Open in IMG/M |
3300009423|Ga0115548_1051497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1463 | Open in IMG/M |
3300009434|Ga0115562_1243003 | Not Available | 630 | Open in IMG/M |
3300009472|Ga0115554_1010450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5441 | Open in IMG/M |
3300009476|Ga0115555_1012344 | Not Available | 4672 | Open in IMG/M |
3300009492|Ga0127412_10041691 | Not Available | 554 | Open in IMG/M |
3300009495|Ga0115571_1071572 | Not Available | 1552 | Open in IMG/M |
3300009529|Ga0114919_10784190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 646 | Open in IMG/M |
3300010148|Ga0098043_1031889 | Not Available | 1655 | Open in IMG/M |
3300010149|Ga0098049_1052634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1299 | Open in IMG/M |
3300010153|Ga0098059_1028866 | All Organisms → cellular organisms → Bacteria | 2253 | Open in IMG/M |
3300010296|Ga0129348_1007700 | Not Available | 3921 | Open in IMG/M |
3300010296|Ga0129348_1101534 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 1014 | Open in IMG/M |
3300010296|Ga0129348_1181123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 721 | Open in IMG/M |
3300010297|Ga0129345_1122555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 952 | Open in IMG/M |
3300010297|Ga0129345_1206622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 695 | Open in IMG/M |
3300010299|Ga0129342_1017184 | Not Available | 2984 | Open in IMG/M |
3300010299|Ga0129342_1035974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1981 | Open in IMG/M |
3300010300|Ga0129351_1002882 | Not Available | 6990 | Open in IMG/M |
3300010300|Ga0129351_1202758 | Not Available | 769 | Open in IMG/M |
3300010316|Ga0136655_1061022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1166 | Open in IMG/M |
3300010316|Ga0136655_1063624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1138 | Open in IMG/M |
3300010316|Ga0136655_1107135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 843 | Open in IMG/M |
3300010318|Ga0136656_1034452 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1835 | Open in IMG/M |
3300010368|Ga0129324_10265728 | Not Available | 681 | Open in IMG/M |
3300010389|Ga0136549_10352009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 604 | Open in IMG/M |
3300012520|Ga0129344_1243407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. TMED43 | 591 | Open in IMG/M |
3300017697|Ga0180120_10348918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 586 | Open in IMG/M |
3300017709|Ga0181387_1058047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 774 | Open in IMG/M |
3300017709|Ga0181387_1126909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 525 | Open in IMG/M |
3300017717|Ga0181404_1006423 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 3179 | Open in IMG/M |
3300017717|Ga0181404_1010802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2407 | Open in IMG/M |
3300017717|Ga0181404_1034004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 1302 | Open in IMG/M |
3300017719|Ga0181390_1038575 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 1456 | Open in IMG/M |
3300017719|Ga0181390_1165249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 549 | Open in IMG/M |
3300017738|Ga0181428_1000798 | Not Available | 7381 | Open in IMG/M |
3300017738|Ga0181428_1063740 | Not Available | 860 | Open in IMG/M |
3300017739|Ga0181433_1021666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1708 | Open in IMG/M |
3300017746|Ga0181389_1033767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1547 | Open in IMG/M |
3300017750|Ga0181405_1011107 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2571 | Open in IMG/M |
3300017753|Ga0181407_1044667 | All Organisms → Viruses → Predicted Viral | 1168 | Open in IMG/M |
3300017755|Ga0181411_1011970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2866 | Open in IMG/M |
3300017757|Ga0181420_1083982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 991 | Open in IMG/M |
3300017763|Ga0181410_1034702 | All Organisms → Viruses → Predicted Viral | 1603 | Open in IMG/M |
3300017771|Ga0181425_1033220 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 1698 | Open in IMG/M |
3300017771|Ga0181425_1189560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 648 | Open in IMG/M |
3300017772|Ga0181430_1052133 | Not Available | 1268 | Open in IMG/M |
3300017824|Ga0181552_10121079 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 1425 | Open in IMG/M |
3300017824|Ga0181552_10137198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1316 | Open in IMG/M |
3300017824|Ga0181552_10410844 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300017950|Ga0181607_10199319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1178 | Open in IMG/M |
3300017963|Ga0180437_10140565 | Not Available | 1969 | Open in IMG/M |
3300017963|Ga0180437_10416292 | Not Available | 1001 | Open in IMG/M |
3300017963|Ga0180437_10622711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 787 | Open in IMG/M |
3300017971|Ga0180438_10224183 | Not Available | 1481 | Open in IMG/M |
3300017971|Ga0180438_10352914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1122 | Open in IMG/M |
3300017971|Ga0180438_11233007 | Not Available | 539 | Open in IMG/M |
3300017990|Ga0180436_10558327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 851 | Open in IMG/M |
3300018080|Ga0180433_10190361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1677 | Open in IMG/M |
3300018080|Ga0180433_10355104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1141 | Open in IMG/M |
3300018080|Ga0180433_11071635 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 587 | Open in IMG/M |
3300018410|Ga0181561_10470913 | Not Available | 565 | Open in IMG/M |
3300018415|Ga0181559_10697980 | Not Available | 545 | Open in IMG/M |
3300018416|Ga0181553_10102765 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1762 | Open in IMG/M |
3300018417|Ga0181558_10017262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5535 | Open in IMG/M |
3300018420|Ga0181563_10016997 | Not Available | 5812 | Open in IMG/M |
3300018420|Ga0181563_10660233 | Not Available | 579 | Open in IMG/M |
3300018424|Ga0181591_11188313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
3300018876|Ga0181564_10315011 | Not Available | 869 | Open in IMG/M |
3300019459|Ga0181562_10232369 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
3300019751|Ga0194029_1002383 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2439 | Open in IMG/M |
3300019751|Ga0194029_1004770 | Not Available | 1813 | Open in IMG/M |
3300019751|Ga0194029_1057695 | Not Available | 647 | Open in IMG/M |
3300019756|Ga0194023_1011258 | Not Available | 1795 | Open in IMG/M |
3300020014|Ga0182044_1203423 | All Organisms → cellular organisms → Bacteria | 1661 | Open in IMG/M |
3300020051|Ga0181555_1137059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1017 | Open in IMG/M |
3300020194|Ga0181597_10156572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1159 | Open in IMG/M |
3300020428|Ga0211521_10504513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 519 | Open in IMG/M |
3300020438|Ga0211576_10234493 | Not Available | 968 | Open in IMG/M |
3300020462|Ga0211546_10216165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 952 | Open in IMG/M |
3300021371|Ga0213863_10012907 | All Organisms → Viruses | 5076 | Open in IMG/M |
3300021373|Ga0213865_10000378 | Not Available | 30422 | Open in IMG/M |
3300021373|Ga0213865_10011977 | Not Available | 4982 | Open in IMG/M |
3300021375|Ga0213869_10082425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1597 | Open in IMG/M |
3300021375|Ga0213869_10091738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1494 | Open in IMG/M |
3300021375|Ga0213869_10261319 | Not Available | 752 | Open in IMG/M |
3300021389|Ga0213868_10432473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 721 | Open in IMG/M |
3300021957|Ga0222717_10002268 | Not Available | 15012 | Open in IMG/M |
3300021957|Ga0222717_10082437 | All Organisms → cellular organisms → Bacteria | 2032 | Open in IMG/M |
3300021957|Ga0222717_10122131 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1611 | Open in IMG/M |
3300021957|Ga0222717_10137845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Spongiibacteraceae → unclassified Spongiibacteraceae → BD1-7 clade → BD1-7 clade bacterium | 1497 | Open in IMG/M |
3300021957|Ga0222717_10257540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1011 | Open in IMG/M |
3300021957|Ga0222717_10565705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 602 | Open in IMG/M |
3300021958|Ga0222718_10006288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9483 | Open in IMG/M |
3300021958|Ga0222718_10023682 | All Organisms → Viruses | 4212 | Open in IMG/M |
3300021958|Ga0222718_10026565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3931 | Open in IMG/M |
3300021958|Ga0222718_10053403 | All Organisms → Viruses | 2552 | Open in IMG/M |
3300021958|Ga0222718_10062588 | All Organisms → cellular organisms → Bacteria | 2307 | Open in IMG/M |
3300021958|Ga0222718_10087238 | All Organisms → cellular organisms → Bacteria | 1866 | Open in IMG/M |
3300021958|Ga0222718_10094938 | Not Available | 1769 | Open in IMG/M |
3300021958|Ga0222718_10131159 | Not Available | 1437 | Open in IMG/M |
3300021958|Ga0222718_10172465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1202 | Open in IMG/M |
3300021958|Ga0222718_10206404 | Not Available | 1069 | Open in IMG/M |
3300021958|Ga0222718_10229356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 997 | Open in IMG/M |
3300021958|Ga0222718_10229359 | All Organisms → Viruses | 997 | Open in IMG/M |
3300021958|Ga0222718_10411502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 673 | Open in IMG/M |
3300021958|Ga0222718_10518144 | Not Available | 573 | Open in IMG/M |
3300021959|Ga0222716_10500322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 683 | Open in IMG/M |
3300021960|Ga0222715_10176312 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 1300 | Open in IMG/M |
3300021960|Ga0222715_10604680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 565 | Open in IMG/M |
3300021964|Ga0222719_10071829 | All Organisms → Viruses | 2586 | Open in IMG/M |
3300021964|Ga0222719_10303763 | All Organisms → Viruses | 1033 | Open in IMG/M |
3300021964|Ga0222719_10548314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 683 | Open in IMG/M |
3300021964|Ga0222719_10590204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 648 | Open in IMG/M |
3300021964|Ga0222719_10637272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 613 | Open in IMG/M |
3300021964|Ga0222719_10752636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 542 | Open in IMG/M |
3300022050|Ga0196883_1039925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 571 | Open in IMG/M |
3300022053|Ga0212030_1001020 | All Organisms → Viruses | 2386 | Open in IMG/M |
3300022053|Ga0212030_1012163 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 1085 | Open in IMG/M |
3300022053|Ga0212030_1026220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Spongiibacteraceae → unclassified Spongiibacteraceae → BD1-7 clade → BD1-7 clade bacterium | 800 | Open in IMG/M |
3300022061|Ga0212023_1000272 | All Organisms → Viruses | 4121 | Open in IMG/M |
3300022061|Ga0212023_1052639 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 566 | Open in IMG/M |
3300022063|Ga0212029_1004402 | Not Available | 1508 | Open in IMG/M |
3300022063|Ga0212029_1016916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 954 | Open in IMG/M |
3300022068|Ga0212021_1100834 | Not Available | 592 | Open in IMG/M |
3300022072|Ga0196889_1013672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1749 | Open in IMG/M |
3300022167|Ga0212020_1065468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 614 | Open in IMG/M |
3300022178|Ga0196887_1013054 | All Organisms → Viruses | 2617 | Open in IMG/M |
3300022178|Ga0196887_1074517 | All Organisms → Viruses | 807 | Open in IMG/M |
3300022187|Ga0196899_1021052 | All Organisms → Viruses | 2392 | Open in IMG/M |
3300022187|Ga0196899_1021180 | Not Available | 2383 | Open in IMG/M |
3300022187|Ga0196899_1149211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 651 | Open in IMG/M |
3300022187|Ga0196899_1168668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 597 | Open in IMG/M |
3300022198|Ga0196905_1005717 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 4353 | Open in IMG/M |
3300022200|Ga0196901_1003227 | Not Available | 7607 | Open in IMG/M |
3300022200|Ga0196901_1009610 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 4131 | Open in IMG/M |
3300022200|Ga0196901_1040693 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1772 | Open in IMG/M |
3300022200|Ga0196901_1044157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1687 | Open in IMG/M |
3300022200|Ga0196901_1109063 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 957 | Open in IMG/M |
3300024262|Ga0210003_1037731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2607 | Open in IMG/M |
3300024346|Ga0244775_11081761 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 630 | Open in IMG/M |
3300025070|Ga0208667_1007068 | All Organisms → Viruses | 2835 | Open in IMG/M |
3300025084|Ga0208298_1036629 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 1003 | Open in IMG/M |
3300025086|Ga0208157_1006640 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4085 | Open in IMG/M |
3300025086|Ga0208157_1018353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2165 | Open in IMG/M |
3300025086|Ga0208157_1092365 | Not Available | 738 | Open in IMG/M |
3300025099|Ga0208669_1003728 | All Organisms → Viruses | 4926 | Open in IMG/M |
3300025099|Ga0208669_1092266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 639 | Open in IMG/M |
3300025099|Ga0208669_1115747 | Not Available | 547 | Open in IMG/M |
3300025102|Ga0208666_1024833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1864 | Open in IMG/M |
3300025108|Ga0208793_1121486 | Not Available | 713 | Open in IMG/M |
3300025120|Ga0209535_1005962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7386 | Open in IMG/M |
3300025128|Ga0208919_1003261 | Not Available | 7998 | Open in IMG/M |
3300025128|Ga0208919_1161471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 689 | Open in IMG/M |
3300025132|Ga0209232_1016684 | Not Available | 2928 | Open in IMG/M |
3300025138|Ga0209634_1041373 | All Organisms → Viruses → Predicted Viral | 2344 | Open in IMG/M |
3300025151|Ga0209645_1081595 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 1074 | Open in IMG/M |
3300025151|Ga0209645_1185700 | Not Available | 622 | Open in IMG/M |
3300025251|Ga0208182_1098542 | Not Available | 527 | Open in IMG/M |
3300025508|Ga0208148_1004399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4693 | Open in IMG/M |
3300025508|Ga0208148_1099336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 628 | Open in IMG/M |
3300025543|Ga0208303_1003412 | All Organisms → Viruses | 5779 | Open in IMG/M |
3300025543|Ga0208303_1038492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1225 | Open in IMG/M |
3300025577|Ga0209304_1000762 | Not Available | 21761 | Open in IMG/M |
3300025610|Ga0208149_1003487 | All Organisms → cellular organisms → Bacteria | 5361 | Open in IMG/M |
3300025632|Ga0209194_1046933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1260 | Open in IMG/M |
3300025647|Ga0208160_1103324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 736 | Open in IMG/M |
3300025652|Ga0208134_1060504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1161 | Open in IMG/M |
3300025671|Ga0208898_1151728 | All Organisms → Viruses | 625 | Open in IMG/M |
3300025674|Ga0208162_1002889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8351 | Open in IMG/M |
3300025687|Ga0208019_1137151 | Not Available | 705 | Open in IMG/M |
3300025695|Ga0209653_1007842 | Not Available | 6129 | Open in IMG/M |
3300025751|Ga0208150_1024711 | All Organisms → Viruses | 2113 | Open in IMG/M |
3300025759|Ga0208899_1103189 | Not Available | 1060 | Open in IMG/M |
3300025769|Ga0208767_1212012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 640 | Open in IMG/M |
3300025769|Ga0208767_1251776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 551 | Open in IMG/M |
3300025816|Ga0209193_1007326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4161 | Open in IMG/M |
3300025828|Ga0208547_1026708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2246 | Open in IMG/M |
3300025869|Ga0209308_10024695 | Not Available | 3538 | Open in IMG/M |
3300026125|Ga0209962_1031901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 924 | Open in IMG/M |
3300028125|Ga0256368_1039644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 838 | Open in IMG/M |
3300029448|Ga0183755_1010067 | All Organisms → cellular organisms → Bacteria | 3778 | Open in IMG/M |
3300032373|Ga0316204_10730399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 716 | Open in IMG/M |
3300034374|Ga0348335_028361 | All Organisms → Viruses | 2514 | Open in IMG/M |
3300034374|Ga0348335_172381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 561 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 28.23% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 12.58% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 9.86% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 6.46% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 6.12% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 5.44% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 5.10% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 4.76% |
Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 3.40% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 2.72% |
Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 2.72% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.38% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.70% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.36% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.36% |
Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 1.02% |
Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 1.02% |
Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.68% |
Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment | 0.68% |
Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.34% |
Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.34% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.34% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.34% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.34% |
Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.34% |
Methane Seep | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Methane Seep | 0.34% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
3300001419 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m) | Environmental | Open in IMG/M |
3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
3300001748 | Saline surface water microbial communities from Etoliko Lagoon, Greece - surface water (0 m) | Environmental | Open in IMG/M |
3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
3300005611 | Saline surface water microbial communities from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007623 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG | Environmental | Open in IMG/M |
3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
3300009492 | Marine sediment microbial communities from Chincoteague Deepwater methane seep, US Atlantic Margin - Chincoteague Seep MUC-5 6-8 cmbsf | Environmental | Open in IMG/M |
3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
3300012520 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
3300017971 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG | Environmental | Open in IMG/M |
3300017990 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_2 metaG | Environmental | Open in IMG/M |
3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
3300018410 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018415 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
3300020014 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020051 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT metaG (spades assembly) | Environmental | Open in IMG/M |
3300020194 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly) | Environmental | Open in IMG/M |
3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
3300020462 | Marine microbial communities from Tara Oceans - TARA_B100001559 (ERX556040-ERR598986) | Environmental | Open in IMG/M |
3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
3300025251 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes) | Environmental | Open in IMG/M |
3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025577 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes) | Environmental | Open in IMG/M |
3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025695 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
3300026125 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
3300032373 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2 | Environmental | Open in IMG/M |
3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOSum2010_100438473 | 3300000101 | Marine | MDILIPLAIVVVVLAWSVKRFKPEIWEKAVSKFKK* |
DelMOSum2010_100555084 | 3300000101 | Marine | MEILIPLTVVAVVIAWSVKRFKPELWNKVTSKFKK* |
DelMOSum2010_101992732 | 3300000101 | Marine | MDILIPLIIVTVVLAWSVKRFKPELWNKVTSKFKK* |
DelMOSum2011_100364836 | 3300000115 | Marine | MDILIPLAIVVVVLAWSVKRFKPELWNKVTSKFKR* |
DelMOSum2011_101610501 | 3300000115 | Marine | EILIPLAIIAVIMGWSVKKFKPELWDQVVSKFKK* |
DelMOSpr2010_100156187 | 3300000116 | Marine | MEVVIPLAVVVVVLAWSIKRFKPELWKEVTAKFKK* |
DelMOSpr2010_100282925 | 3300000116 | Marine | MEILIPLAIIAVIMGWSVKKFKPELWDQVVSKFKK* |
DelMOSpr2010_100980164 | 3300000116 | Marine | MEVLIPLIVLTVVIAWSVKRFKPELWNKVKSKFKK* |
DelMOSpr2010_101357152 | 3300000116 | Marine | MDILIPLIIVAVVLAWSVKRFKPELWEKAVSKFKK* |
DelMOSpr2010_102033312 | 3300000116 | Marine | MDILIPLIIVTVVLAWSVKRFKPELWEKAVSKFKK* |
DelMOSpr2010_102729652 | 3300000116 | Marine | MEVLIPLAVVAVVIGWSIKRFKPELWSKIVSKFKK* |
DelMOWin2010_100378601 | 3300000117 | Marine | MEVLIPLTVVAVVIAWSIERFKPELWNKIISKFKK* |
DelMOWin2010_100395663 | 3300000117 | Marine | MEVLIPLIIVTIVLAWSVKRFKPELWEKAVAKLRWKK* |
DelMOWin2010_100617631 | 3300000117 | Marine | MEVLIPLTVVAVVIAWSIERFKPELWSKIVSKFKK* |
DelMOWin2010_100871412 | 3300000117 | Marine | MEVLIPLAIVAVVIAWSVKKFKPELWEKTISKFKK* |
DelMOWin2010_102254543 | 3300000117 | Marine | MEVIIPLAVVVVVLAWSVKRFKPELWKKVTAKFKK* |
DelMOWin2010_102579622 | 3300000117 | Marine | MDILIPLAIVVVVLAWSVKRFKPELWEKTISRFKK* |
DelMOWin2010_102626762 | 3300000117 | Marine | MEVLIPLAVVAVVIAWSIERFKPELWSKIVSKFKK* |
JGI11705J14877_100110836 | 3300001419 | Saline Water And Sediment | MEVLIPLAVVAVVIGWSVKRFKPELWSKIVAKLPWKK* |
JGI24003J15210_100039254 | 3300001460 | Marine | MDILIPLIIVTVVLAWSVKRFKPELWNKVTSKLKK* |
JGI11772J19994_10029154 | 3300001748 | Saline Water And Sediment | ILKELNMEVLIPLAVVAVVIAWSIERFKPELWNKIVAKLPWKK* |
JGI11772J19994_100329110 | 3300001748 | Saline Water And Sediment | MELLIPLAVLAVVIAWSVKRFKPELWNKVKSKFKK* |
JGI11772J19994_10284132 | 3300001748 | Saline Water And Sediment | MEVLIPLAVIAVVIAWSIERFKPELWNKIVTKFKR* |
Ga0074648_100161232 | 3300005512 | Saline Water And Sediment | MEVLIPLAVVAVVIAWSIERFKPELWNKIVAKLPWKK* |
Ga0074648_100341318 | 3300005512 | Saline Water And Sediment | MEVLIPLIVVTVVLVWSVKRFKPELWNKVTSKFKK* |
Ga0074648_100453013 | 3300005512 | Saline Water And Sediment | MEVLIPLAVVAVVIAWSIERFKPELWDKIVTKFKR* |
Ga0074648_11412802 | 3300005512 | Saline Water And Sediment | MEVLIPLAVVAVVIAWSIERFKPELWNKVKSKFKK* |
Ga0074648_11444262 | 3300005512 | Saline Water And Sediment | MEVLIPLAVVAVVIAWSIERFKPELWKKAVSKFKR* |
Ga0074647_10001211 | 3300005611 | Saline Water And Sediment | EVLIPLAVVAVVIAWSIERFKPELWNKIVAKLPWKK* |
Ga0074647_100030410 | 3300005611 | Saline Water And Sediment | MEVLIPLAVVAVVIAWSIERFKPELWNKIVTKFKR* |
Ga0074649_10632751 | 3300005613 | Saline Water And Sediment | MEVLIPLAVVAVVIGWSVKRFKPELWNKIVTKFKK* |
Ga0074649_12034492 | 3300005613 | Saline Water And Sediment | MEVLIPLAVVAVVIAWSIERFKPKLWDKIVTKFKR* |
Ga0075474_102349532 | 3300006025 | Aqueous | MEVLIPLAVVAVVIGWSVKRFKPELWKKVTSKFKK* |
Ga0075478_100142233 | 3300006026 | Aqueous | MDILIPLAIVVVVLAWSVKRFKPEIWNKVTSKFKR* |
Ga0075478_100366323 | 3300006026 | Aqueous | MDILIPLIIVTIVLAWSVKRFKPELWEKVTSKIKK* |
Ga0075478_100548831 | 3300006026 | Aqueous | MEVLIPLAVVAVVIAWSIERFKPELWNKIVAKLPWKK*F |
Ga0075462_102547242 | 3300006027 | Aqueous | MEVLIPLAVVAVVIAWSIERFKPELWSKIVAKLPWKK* |
Ga0075466_100163012 | 3300006029 | Aqueous | MDVLIPLVIVTVVLVWSVKRFKPELWSKVTAKLKK* |
Ga0075466_10278352 | 3300006029 | Aqueous | MDILIPLVIVAVVLAWSVKKFKPELWDQVVSKFKK* |
Ga0075466_10732632 | 3300006029 | Aqueous | MDVFIPLIIVAVVLAWSVKKYKPELWNKITSKLKK* |
Ga0075466_11007832 | 3300006029 | Aqueous | MDILIPLIIVAVVLAWSVKRFKPELWNKVTSKFKK* |
Ga0098038_10066408 | 3300006735 | Marine | MDILIPLTIVVVVLVWSVKRFKPELWSKAVALFKK* |
Ga0098038_10295643 | 3300006735 | Marine | MDILIPLIIVTVVLAWSVKKFKPELWAKVTSKFK* |
Ga0098038_10384834 | 3300006735 | Marine | METLIPLAVIVVVLTWSVKKFKPELWSKATALFKK* |
Ga0098038_10394964 | 3300006735 | Marine | MDILIPLVIVTLVLAWSVKKFKPELWNKVTSKLKK* |
Ga0098038_10483682 | 3300006735 | Marine | MDILIPLIIVAVVLAWSVKRFKPELWTKVTSKFKK* |
Ga0098038_10872372 | 3300006735 | Marine | MDILIPLIVVVVLAWSVKRFKPELWNKLISFISKN* |
Ga0098038_11463051 | 3300006735 | Marine | NMDILIPLIIVAVVLAWSVKRFKPELWAKVTSKFK* |
Ga0098037_10659641 | 3300006737 | Marine | MDILIPLTIIVVVLVWSVKKFKPELWQKLISFISKN* |
Ga0098037_12529302 | 3300006737 | Marine | MEILIPLAIIAVIMGWSVKKFKPELWDKVVSKFKK* |
Ga0098042_10371053 | 3300006749 | Marine | MDILIPLAIIVVVLAWSVKRFKPELWDKATSWIKK* |
Ga0098048_12221782 | 3300006752 | Marine | MDILIPLIIVVVVLAWSVKRFKPELWNKVTSKFKK* |
Ga0098055_10241634 | 3300006793 | Marine | MDVLIPLAVVAVVIAWSIERFKPELWNKIVAKLPWKK* |
Ga0070749_106927082 | 3300006802 | Aqueous | MEILIPLAVLAVVIAWSVKRFKPELWNKIVSKFKK* |
Ga0075476_100029619 | 3300006867 | Aqueous | MDILIPLAIIIVVLAWSVKRFKPELWEKTISRFKK* |
Ga0075481_103334012 | 3300006868 | Aqueous | MDILIPLIIVAVVLAWSVKRFKPELWEKAVSKFKR* |
Ga0075477_103226241 | 3300006869 | Aqueous | SMEVLIPLTVVAVVIAWSIERFKPELWSKIVSKFKK* |
Ga0075479_101803982 | 3300006870 | Aqueous | MEVLIPLGIVILVVCLATKRFKPELWKEVTAKFKK* |
Ga0070750_100423871 | 3300006916 | Aqueous | MDILIPLVIVVVVLAWSVKRFKPELWNKVTSKLKK* |
Ga0070750_102290541 | 3300006916 | Aqueous | MEVLIPLAVVAVVIAWSVKRFKPELWEKAVSKFKR*MRLSK |
Ga0070746_101681861 | 3300006919 | Aqueous | MDILIPLIIVTVVLAWSVKRFKPELWNKVTSKFKK |
Ga0070746_101832292 | 3300006919 | Aqueous | MDILVPLAIVVVVLAWSVKRFKPELWTKVTSKFKK* |
Ga0070746_105051172 | 3300006919 | Aqueous | MEVLIPLAVIAVVIAWSVKRFKPELWSKVTSKFKK* |
Ga0070748_10229023 | 3300006920 | Aqueous | MDILIPLIIVTVALAWSVKRFKPELWNKVTSKFKK* |
Ga0098060_10790344 | 3300006921 | Marine | MDVLIPLGIVAIVVLLSVKRFKPELWEKSVSRFKK* |
Ga0098051_11066462 | 3300006924 | Marine | MEVLIPLAVVAVVIAWSIERFKPELWNKIVTKLPWKK* |
Ga0098041_10660571 | 3300006928 | Marine | MDILIPLIIVTVVLAWSVKRFKPELWEKAVALFKK* |
Ga0075468_100306286 | 3300007229 | Aqueous | MEILIPLAVLAVVIVWSVKKFKPELWNKIVSKFKK* |
Ga0075468_100809411 | 3300007229 | Aqueous | MDILIPLIIVAVVLAWSVKKYKPELWNKITSKLKK* |
Ga0075463_100396541 | 3300007236 | Aqueous | NMEVLIPLAVVAVVIAWSIERFKPELWNKVKSKFKK* |
Ga0099851_10367753 | 3300007538 | Aqueous | MEVLIPLAIVAVVIAWSVKRFKPELWNKIVSKFKK* |
Ga0099851_11085122 | 3300007538 | Aqueous | MEVLIPLAVVAVVIAWSIERFKPELWKKVTSKFKK* |
Ga0099851_11122742 | 3300007538 | Aqueous | MEVLIPLVVIAVVIAWSIERFKPELWEKVTSKFKR* |
Ga0099851_12042303 | 3300007538 | Aqueous | MEVLIPLAVIVVVIGWSVKRFKPELWEKAVSKFKR* |
Ga0099851_12059932 | 3300007538 | Aqueous | MEVLIPLTVVAVVIGWSVKRFKPELWNKIVSKFKK* |
Ga0099851_12682812 | 3300007538 | Aqueous | MEVLIPLIVVAVVIAWSIERFKPELWNKIVAKLPWKK* |
Ga0099851_13052492 | 3300007538 | Aqueous | MEVLIPLVVIAVVIGWSVKRLKPELWEKVTSKFKK* |
Ga0099849_12566782 | 3300007539 | Aqueous | MEVIIPLAVVVVVLAWSVKRFKPELWKEVTAKFKK* |
Ga0099849_13366182 | 3300007539 | Aqueous | MEVLIPLGILAVVAALSVRRFKPELWNKVTSKFKK* |
Ga0099849_13420582 | 3300007539 | Aqueous | MEVLIPLAVIVVVIGWSVKRFKPELWEKTISKFKK* |
Ga0099847_12016652 | 3300007540 | Aqueous | MEVLIPLAVLAVVIAWSVKRFKPELWNKVKSKFKK* |
Ga0099848_10260315 | 3300007541 | Aqueous | MEVLIPLGILAVVVALSVRRFKPELWNKVTSKFKK* |
Ga0099848_10694445 | 3300007541 | Aqueous | MEVLIPLAVIAVVIGWSVKRFKPELWEKVTSKFKK* |
Ga0099846_11924091 | 3300007542 | Aqueous | KSSMEVLIPLAVVSAVIAWSVKRFKPELWNKVTSKFKK* |
Ga0099846_13306792 | 3300007542 | Aqueous | MEVLIPLAVIIVVIGWSVKRFKPELWEKAVSKFKR* |
Ga0102948_12736762 | 3300007623 | Water | MEALIPLTVVAAVIAWSVKRFKPELWNKIVTKFKK* |
Ga0070751_12026321 | 3300007640 | Aqueous | QHILKELNMEVLIPLTVVAVVIAWSIERFKPELWSKIVSKFKK* |
Ga0070751_12372632 | 3300007640 | Aqueous | MEVLIPLAVVAVVIAWSIERLKPELWNKIVAKLPWKK* |
Ga0102954_10796152 | 3300007778 | Water | MDILIPLIIVAAVLAWSVKRFKPELWEKAVSKFKK* |
Ga0099850_11829752 | 3300007960 | Aqueous | MEVLIPLAIVVVVIAWSVKRFKPELWNKIVSKFKK* |
Ga0075480_104869082 | 3300008012 | Aqueous | MEVLIPLAVVAVVIAWSIERFKFELWDKIVTKFKR* |
Ga0098052_10159524 | 3300008050 | Marine | MDILIPLTIVTVVLVWSVKRFKPELWNKVTSQFKK* |
Ga0114899_10750351 | 3300008217 | Deep Ocean | MDVLIPLGIIAIVVLFSVKRFKPELWKKAVSKFKK* |
Ga0102816_12647362 | 3300008999 | Estuarine | MDILVPLAIIAVIIAWSVKKFKPELWNKITAKFKK* |
Ga0102960_10100206 | 3300009000 | Pond Water | MDILIPLIIVTVVLAWSVKRFKPELWSKIVSKFKK* |
Ga0102960_11061133 | 3300009000 | Pond Water | MEVLITLTVVAVVIGWSVKRFKPELWSKIVSKFKK* |
Ga0102960_11310682 | 3300009000 | Pond Water | MEVLIPLAVVAVVIAWSIEKFKPELWDKIVSKFKR* |
Ga0102963_10624863 | 3300009001 | Pond Water | MEVLIPLTVVAVVIAWSIERFKPELWKKVTSKFKK* |
Ga0102963_12264972 | 3300009001 | Pond Water | MEVLIPLAVVAVVIGWSVKRFKPELWDQVVSKFKK* |
Ga0102963_13970371 | 3300009001 | Pond Water | ILKELNMEVLIPLTVVAVVIAWSIERFKPELWSKIVSKFKK* |
Ga0102957_10874972 | 3300009027 | Pond Water | MEVLIPLAVVAVVIAWSIERFKPKLWDKIVSKFKR* |
Ga0102957_12915292 | 3300009027 | Pond Water | MDILIPLIIVAVVLAWSVKRFKPELWNKAVSKFKK* |
Ga0115566_100394953 | 3300009071 | Pelagic Marine | MDILIPLAIIVVVLAWSVKKFKPELWDQVVSKFKK* |
Ga0115566_100518885 | 3300009071 | Pelagic Marine | MDILIPLIIVAVVLAWSVKRFKPELWNKAVSKFKR* |
Ga0115566_101592303 | 3300009071 | Pelagic Marine | MDILIPLIIVTVVLAWSVKRFKPELWEKAVSKFKR* |
Ga0115566_104011822 | 3300009071 | Pelagic Marine | MDILIPLTIIVVVLVWSVKKFKPELWNKLISFISKN* |
Ga0115566_104404262 | 3300009071 | Pelagic Marine | MDILIPLIIVVVLAWSVKKFKPELWNKLISFISKN* |
Ga0114918_1000489013 | 3300009149 | Deep Subsurface | MEVLIPLAVVAVVIAWSVKRFKPELWEKAVSKFKR* |
Ga0114918_101810554 | 3300009149 | Deep Subsurface | MEVLIPLAVLAVVIAWSVKRFKPELWNKIVSKFKK* |
Ga0114918_104947292 | 3300009149 | Deep Subsurface | MEVLIPLAVVAVVIAWSIERFKPEIWNKIVSKFKK* |
Ga0115548_10514972 | 3300009423 | Pelagic Marine | MDILISLIIVTVVFAWSVKRFKPELWEKAVSKFKK* |
Ga0115562_12430032 | 3300009434 | Pelagic Marine | MDILIPLTIIVVVLAWSVKKFKPELWDQVVSKFKK* |
Ga0115554_10104504 | 3300009472 | Pelagic Marine | MDILIPLIIVTVVLAWSVKKFKPELWNKVTSKFKK* |
Ga0115555_10123445 | 3300009476 | Pelagic Marine | MDILIHLTIIVVVLAWSVKKFKPELWNKLISFISKN* |
Ga0127412_100416912 | 3300009492 | Methane Seep | MEVLIPLAVVAVVIGWSVKRFKPELWEKTVSKFKK* |
Ga0115571_10715725 | 3300009495 | Pelagic Marine | MDILIPLTIIVVVLVWSVKEFKPELWNKLISFISKN* |
Ga0114919_107841902 | 3300009529 | Deep Subsurface | MEVLIPLAVVAVVIAWSIERFKPELWDKIVAKFKR* |
Ga0098043_10318892 | 3300010148 | Marine | MDILIPLTIIVVVLAWSVKKFKPELWAKVTSKFK* |
Ga0098049_10526343 | 3300010149 | Marine | MDVLIPLGILAIVVLLSVKRFKPELWEKAVSRFKK* |
Ga0098059_10288664 | 3300010153 | Marine | MDILIPLIIITVIAGWSVKKFKPELWSKVTAKFKK* |
Ga0129348_10077001 | 3300010296 | Freshwater To Marine Saline Gradient | MEVLIPLTVVAVVMGWSVKRFKPELWKKVTSKFKK* |
Ga0129348_11015342 | 3300010296 | Freshwater To Marine Saline Gradient | MEVLIPLAVVAVVIAWSIERFKPELWEKAVSKFKR* |
Ga0129348_11811232 | 3300010296 | Freshwater To Marine Saline Gradient | MEVLIPLAVAAVVIAWSVKRFKPELWNKVTSKFKK* |
Ga0129345_11225552 | 3300010297 | Freshwater To Marine Saline Gradient | MEVLIPLTVVAVVIGWSVKRFKPELWSKIVSKFKK* |
Ga0129345_12066222 | 3300010297 | Freshwater To Marine Saline Gradient | MEVLIPLIVVAVVIAWSIKRFKPELWNKVTSKFKK* |
Ga0129342_10171844 | 3300010299 | Freshwater To Marine Saline Gradient | MEVLIPLAVVSAVIAWSVKRFKPELWNKIVSKFKK* |
Ga0129342_10359744 | 3300010299 | Freshwater To Marine Saline Gradient | MEVLIPLAVVAVVIGWSVKRFKPELWNKVTSKFKK* |
Ga0129351_100288210 | 3300010300 | Freshwater To Marine Saline Gradient | MDILIPLIIVAVVLAWSVKRFKPELWNKVTSKFKR* |
Ga0129351_12027582 | 3300010300 | Freshwater To Marine Saline Gradient | MEVLIPLTVVAVVIAWSIERFKPELWNKIVAKLPWKK* |
Ga0136655_10610221 | 3300010316 | Freshwater To Marine Saline Gradient | LNMDILIPLVIVTLVLAWSVKKFKPELWNKVTSKLKK* |
Ga0136655_10636242 | 3300010316 | Freshwater To Marine Saline Gradient | MEVLIPLTVVAVVIGWSIERFKPELWSKIVSKFKK* |
Ga0136655_11071352 | 3300010316 | Freshwater To Marine Saline Gradient | MEVLIPLIVVVVVIAWSVKRFKPELWNKVTSKFKK* |
Ga0136656_10344521 | 3300010318 | Freshwater To Marine Saline Gradient | MEVLIPLTVVAVVIAWSIERFKPELWSKIVAKLPWKK* |
Ga0129324_102657282 | 3300010368 | Freshwater To Marine Saline Gradient | MEVLIPLAVAAVVIGWSVKKFKPELWNKIVSKFKK* |
Ga0136549_103520092 | 3300010389 | Marine Methane Seep Sediment | MEVLIPLAVVAVVIAWSIERFKPELWGKIVTKFKR* |
Ga0129344_12434071 | 3300012520 | Aqueous | MEVLIPLTVVAVVIAWSIERFKPELWNKIVSKFKK* |
Ga0180120_103489182 | 3300017697 | Freshwater To Marine Saline Gradient | MEVLIPLIVVVVVIAWSVKRFKPELWNKVTSKFKK |
Ga0181387_10580472 | 3300017709 | Seawater | MDILIPLVIVTLVLAWSVKKFKPELWNKITAKFKK |
Ga0181387_11269093 | 3300017709 | Seawater | NMDILIPLVIVTLVLAWSVKRFKPELWTKVTSKFKK |
Ga0181404_10064233 | 3300017717 | Seawater | MDVLIPLGIMVLVIALSMRKFKPELWNKVTSKFKK |
Ga0181404_10108021 | 3300017717 | Seawater | IMDILIPLIIVAVVLAWSVKRFKPELWNKVTSKFK |
Ga0181404_10340043 | 3300017717 | Seawater | MDILVPLIIVVVVLAWSVKRFKPELWNKVTSKFKK |
Ga0181390_10385753 | 3300017719 | Seawater | MDILIPLAIIAVIIAWSVKKFKPELWNKITAKFKK |
Ga0181390_11652492 | 3300017719 | Seawater | MDVLIPLVIMAIVVLLSVKRFKPELWEKAVSKFKR |
Ga0181428_10007981 | 3300017738 | Seawater | MDTLIPLTIIVVVLAWSVKKFKPELWDQVVSKFKK |
Ga0181428_10637403 | 3300017738 | Seawater | MDALIPLGIIAIVVLFSVKRFKPELWKKAVSKFKK |
Ga0181433_10216664 | 3300017739 | Seawater | MDILIPLVIVTLVLAWSVKRFKPELWTKVTSKFKK |
Ga0181389_10337672 | 3300017746 | Seawater | MDILIPLVIVTLVLAWSVKKFKPELWNKVTSKFKK |
Ga0181405_10111077 | 3300017750 | Seawater | LKELNMDILIPLIIVAVVLAWSVKRFKPELWAKVTSKFK |
Ga0181407_10446671 | 3300017753 | Seawater | FNMDILVPLIIVVVVLAWSVKRFKPELWNKVTSKFKK |
Ga0181411_10119705 | 3300017755 | Seawater | HILKELNMDILIPLVIVTLVLAWSVKKFKPELWNKVTSKLKK |
Ga0181420_10839821 | 3300017757 | Seawater | MDILIPLIIVAVVLAWSVKRFKPELWNKVTSKFKK |
Ga0181410_10347022 | 3300017763 | Seawater | MDILIPLGIMVLVIALSMRKFKPELWNKVTSKFKK |
Ga0181425_10332203 | 3300017771 | Seawater | MDILIPLIIVAVVLAWSVKKFKPELWNKITAKFKK |
Ga0181425_11895601 | 3300017771 | Seawater | IMDILIPLIIVTIVLAWSVKRFKPELWNKVTSKFKK |
Ga0181430_10521332 | 3300017772 | Seawater | MDVLIPLGIVAIVVLLSVKRFKPELWEKAVSKFKK |
Ga0181552_101210793 | 3300017824 | Salt Marsh | MEVLIPLAVVVVVIGLSVKRFKPELWEKAVSKFKK |
Ga0181552_101371982 | 3300017824 | Salt Marsh | MEVLIPLTVVAVVIAWSIERFKPELWSKIVAKLPWKK |
Ga0181552_104108442 | 3300017824 | Salt Marsh | MEVLIPLAVVAVVIGWSVKRFKPELWKKVTSKFKK |
Ga0181607_101993194 | 3300017950 | Salt Marsh | MEVLIPLAVVAVVIAWSVKRFKPELWNKIVSKFKR |
Ga0180437_101405654 | 3300017963 | Hypersaline Lake Sediment | MEVLIPLAVVAVVIAWSIERFKPELWDKIVTKFKR |
Ga0180437_104162922 | 3300017963 | Hypersaline Lake Sediment | MEVLIPLAVVAVVIAWSIERFKPELWNKIVAKLPWKK |
Ga0180437_106227112 | 3300017963 | Hypersaline Lake Sediment | MEVLIPLTVVAVVIAWSIERFKPELWSKIVSKFKK |
Ga0180438_102241832 | 3300017971 | Hypersaline Lake Sediment | MDILIPLIIVAVVLAWSVKRFKPELWEKAVSKFKK |
Ga0180438_103529143 | 3300017971 | Hypersaline Lake Sediment | MEVLIPLAVVAVVIAWSVKRFKPELWEKAVSKFKR |
Ga0180438_112330072 | 3300017971 | Hypersaline Lake Sediment | ILKELNMEVLIPLTVVAVVIAWSIERFKPELWSKIVSKFKK |
Ga0180436_105583271 | 3300017990 | Hypersaline Lake Sediment | MEVLIPLAVVAVVIAWSIERFKPELWNKIVTKFKR |
Ga0180433_101903614 | 3300018080 | Hypersaline Lake Sediment | MEVLIPLAVVAVVIAWSIERFKPELWNKIVSKFKK |
Ga0180433_103551043 | 3300018080 | Hypersaline Lake Sediment | MEILIPLAVVAVVIGWSIERFKPELWSKIVSKFKK |
Ga0180433_110716352 | 3300018080 | Hypersaline Lake Sediment | MEVLIPLAVIAAVIGWSVKRFKPELWNKIAAKLPWKK |
Ga0181561_104709132 | 3300018410 | Salt Marsh | MEVLIPLTVVAVVIGWSVKRFKPELWSKIVSKFKK |
Ga0181559_106979802 | 3300018415 | Salt Marsh | MEVLIPLTVVAVVIGWSVKRFKPELWKKVTSKFKK |
Ga0181553_101027653 | 3300018416 | Salt Marsh | MEVLIPLTVVAVVIAWSIKRFKPELWSKIVAKLPWKK |
Ga0181558_100172628 | 3300018417 | Salt Marsh | MEVLIPLAVVAVVIGWSVKRFKPELWSKIVAKLPWKK |
Ga0181563_100169972 | 3300018420 | Salt Marsh | MDILIPLIIVTVVLAWSVKRFKPELWEKAVSKFKK |
Ga0181563_106602331 | 3300018420 | Salt Marsh | MEVLIPLIIVTIVLAWSVKRFTPELWNKVTSKFKK |
Ga0181591_111883132 | 3300018424 | Salt Marsh | MEVLIPLTVVAVVMGWSVKRFKPELWKKVTSKFKK |
Ga0181564_103150111 | 3300018876 | Salt Marsh | MEVLIPLIIVTVVLAWSIKRFKPELWSKIVAKLPWKK |
Ga0181562_102323693 | 3300019459 | Salt Marsh | MEVLIPLAVIAVVIGWSVKRFKPELWEKVTSKFKK |
Ga0194029_10023833 | 3300019751 | Freshwater | MEVLIPLIVLTVVIAWSVNRFKPELWNKVKSKFKK |
Ga0194029_10047702 | 3300019751 | Freshwater | MDILIPLAIVVVVLAWSVKRFKPELWNKVTSKFKR |
Ga0194029_10576952 | 3300019751 | Freshwater | MEILIPLAIIAVIMGWSVKKFKPELWDQVVSKFKK |
Ga0194023_10112582 | 3300019756 | Freshwater | MEVLIPLIVLTVVIAWSVKRFKPELWSKIVFKFKK |
Ga0182044_12034233 | 3300020014 | Salt Marsh | MEVLIPLAVVAVVIGWSVKRFKPELWEKAVSKFKK |
Ga0181555_11370594 | 3300020051 | Salt Marsh | MEVLIPLAVIAVVIAWSVKRFKPELWEKAVSKFKR |
Ga0181597_101565724 | 3300020194 | Salt Marsh | MEVLIPLAVVAVVIAWSVKRFKPELWEKTVSKFKR |
Ga0211521_105045133 | 3300020428 | Marine | MDILIPLIIVTIVLAWSVKRFKPELWDKVTSKLKK |
Ga0211576_102344932 | 3300020438 | Marine | MDILIPLAIIVVVLAWSVKKFKPELWDQVVSKFKK |
Ga0211546_102161652 | 3300020462 | Marine | MDILIPLIIVTVVLAWSVKKFKPELWNKITAKFKK |
Ga0213863_100129074 | 3300021371 | Seawater | MDILIPLIIVAVVLAWSVKRFKPELWNKIVSKFKK |
Ga0213865_1000037829 | 3300021373 | Seawater | MEVLIPLAVLAVVIAWSVKRFKPELWNKVKSKFKK |
Ga0213865_100119778 | 3300021373 | Seawater | MDILIPLVIVVVVLAWSVKKFKPELWNKVTSKFKK |
Ga0213869_100824252 | 3300021375 | Seawater | MDILIPLAIVVVVLAWSVKKFKPELWNKVTSKLKK |
Ga0213869_100917382 | 3300021375 | Seawater | MEVLIPLTVVAVVIGWSVKRFKPELWNKIVSKFKK |
Ga0213869_102613193 | 3300021375 | Seawater | MDILIPLAIVVVVLAWSVKRFKPELWNKVTSKFKK |
Ga0213868_104324732 | 3300021389 | Seawater | MEVLIPLAVIVVVIGLSVKRFKPELWEKAVSKFKK |
Ga0222717_100022689 | 3300021957 | Estuarine Water | MDILIPLAIAVVIIAWSVKKFKPELWNKITAKFKK |
Ga0222717_100824374 | 3300021957 | Estuarine Water | MEVLIPLAVVAVVIGWSVKRFKPELWEKTVSKFKK |
Ga0222717_101221313 | 3300021957 | Estuarine Water | NNMEVLIPLAVVAVVIAWSIERFKPELWNKIVAKLPWKK |
Ga0222717_101378454 | 3300021957 | Estuarine Water | MDILIPLIIVAAVLAWSVKRFKPELWSKIVSKFKK |
Ga0222717_102575403 | 3300021957 | Estuarine Water | MEVLIPLAVVAVVIGWSVKRFKPELWDQVVSKFKK |
Ga0222717_105657052 | 3300021957 | Estuarine Water | MEVLIPLAVVAVVIAWSIKRFNPELWSKIVSKFKK |
Ga0222718_100062887 | 3300021958 | Estuarine Water | MEVLIPLAVVAVVIAWSIERFKPELWSKIVAKLSWKK |
Ga0222718_100236828 | 3300021958 | Estuarine Water | MEALIPLTVVAAVIAWSVKRFKPELWNKIVTKFKK |
Ga0222718_100265656 | 3300021958 | Estuarine Water | MEVLIPLTVVAVVIAWSIERFKPELWKKVTSKFKK |
Ga0222718_100534033 | 3300021958 | Estuarine Water | MEVLIPLAVVAVVIAWSIERFKPELWKKVTSKFKR |
Ga0222718_100625884 | 3300021958 | Estuarine Water | MEVLIPLAVVAVVIAWSIERFKPELWNKIVSKFKR |
Ga0222718_100872383 | 3300021958 | Estuarine Water | MDILIPLIIVTVVLAWSVKRFKPELWSKIVSKFKK |
Ga0222718_100949381 | 3300021958 | Estuarine Water | MEVLIPLAVVAVVIAWSIERFKPELWSKIVSKFKK |
Ga0222718_101311592 | 3300021958 | Estuarine Water | MEVLIPLAVVAVVIAWSIERFKPELWNKIVTKFKK |
Ga0222718_101724652 | 3300021958 | Estuarine Water | MEVLIPLAVVAVVIAWSIERFKPELWEKVTSKFKK |
Ga0222718_102064042 | 3300021958 | Estuarine Water | MEVLIPLAVVAVVIGWSIKRFKPELWDQVVSKFKN |
Ga0222718_102293562 | 3300021958 | Estuarine Water | MDILIPLAVVAVVIGWSVKRFKPELWEKAVSKFKK |
Ga0222718_102293591 | 3300021958 | Estuarine Water | MEVLIPLAVVAVVIGWSVKRFKPELWNKIVSKFKK |
Ga0222718_104115022 | 3300021958 | Estuarine Water | MEVLIPLAVIVVVIGWSVKRFKPELWEKAVSKFKK |
Ga0222718_105181442 | 3300021958 | Estuarine Water | KPRNNSMEVLIPLAVVAVVIAWSIERFKPELWNKIVAKLPWKK |
Ga0222716_105003223 | 3300021959 | Estuarine Water | MDILIPLIIVAVVLTWSVKKFKPELWKKAISKFKK |
Ga0222715_101763123 | 3300021960 | Estuarine Water | MEVLIPLAVVAVVIGWSVKRFKPELWEKAISRFKK |
Ga0222715_106046802 | 3300021960 | Estuarine Water | MEVLIPLTVVAVVIGWSVKRFKPELWEKAVSKFKK |
Ga0222719_100718293 | 3300021964 | Estuarine Water | MEILIPLAVVAVVIAWSIKRFKPELWSKIVSKFKK |
Ga0222719_103037631 | 3300021964 | Estuarine Water | MEVLIPLAVVAVVIGWSVKRFKPELWSKIVSKFKK |
Ga0222719_105483142 | 3300021964 | Estuarine Water | MEVLIPLTVVAVVIAWSIERFKPELWNKIVAKLPWKK |
Ga0222719_105902042 | 3300021964 | Estuarine Water | MEVLIPLTVVAVVIGWSIKRFKPELWDQVVSKFKK |
Ga0222719_106372722 | 3300021964 | Estuarine Water | MELLIPLAVVAVVIAWSIERFKPELWSKIVSKFKK |
Ga0222719_107526362 | 3300021964 | Estuarine Water | MEVLIPLIIVAVVLAWSVKRFKPELWNKVTSKFKK |
Ga0196883_10399253 | 3300022050 | Aqueous | MEVVIPLGILAVVVALSVRRFKPELWNKVTSKFKK |
Ga0212030_10010202 | 3300022053 | Aqueous | MEVLIPLTVVAVVIGWSIERFKPELWSKIVSKFKK |
Ga0212030_10121632 | 3300022053 | Aqueous | MDILIPLIIVTIVLAWSVKRFKPELWEKVTSKIKK |
Ga0212030_10262201 | 3300022053 | Aqueous | ILKEFNMEVLIPLAVLAVVIAWSVKRFKPELWNKVKSKFKK |
Ga0212023_10002726 | 3300022061 | Aqueous | MDILIPLAIVVVVLAWSVKRFKPEIWNKVTSKFKR |
Ga0212023_10526392 | 3300022061 | Aqueous | MDVLIPLVIVTVVLVWSVKRFKPELWSKVTAKLKK |
Ga0212029_10044021 | 3300022063 | Aqueous | KSSMEVLIPLAVVSAVIAWSVKRFKPELWNKIVSKFKK |
Ga0212029_10169162 | 3300022063 | Aqueous | MEVLIPLVVIAVVIAWSIERFKPELWEKVTSKFKR |
Ga0212021_11008342 | 3300022068 | Aqueous | MEVLIPLAVAAVVIAWSIERFKPELWNKIVAKLPWKK |
Ga0196889_10136722 | 3300022072 | Aqueous | MDILIPLVIVAVVLAWSVKKFKPELWDQVVSKFKK |
Ga0212020_10654683 | 3300022167 | Aqueous | MEVLIPLAVVAVVIAWSIERFKPELWNKVKSKFKK |
Ga0196887_10130546 | 3300022178 | Aqueous | MEVLIPLIVLTVVIAWSVKRFKPELWNKVKSKFKK |
Ga0196887_10745172 | 3300022178 | Aqueous | MDILIPLIIVAVVLAWSVKRFKPELWEKAVSKFKR |
Ga0196899_10210523 | 3300022187 | Aqueous | MEVLIPLAVIAVVIAWSIERFKPELWNKIVAKLPWKK |
Ga0196899_10211808 | 3300022187 | Aqueous | MEVLIPLGIVILVVCLATKRFKPELWKEVTAKFKK |
Ga0196899_11492111 | 3300022187 | Aqueous | ELNMEVLIPLAVVAVVIAWSIERFKPELWKKIVTKFKR |
Ga0196899_11686682 | 3300022187 | Aqueous | MEVLIPLAVIAVVIGWSIERFKPELWKKVTSKFKK |
Ga0196905_10057176 | 3300022198 | Aqueous | MEVLIPLGILAVVVALSVRRFKPELWNKVTSKFKK |
Ga0196901_10032277 | 3300022200 | Aqueous | MEVLIPLAVVSAVIAWSVKRFKPELWNKIVSKFKK |
Ga0196901_10096102 | 3300022200 | Aqueous | MEVLIPLAVVAVVIAWSIERFKPELWKKVTSKFKK |
Ga0196901_10406935 | 3300022200 | Aqueous | MEVLIPLVVIAVVIGWSVKRLKPELWEKVTSKFKK |
Ga0196901_10441572 | 3300022200 | Aqueous | MEVLIPLAIVAVVIAWSVKRFKPELWNKIVSKFKK |
Ga0196901_11090632 | 3300022200 | Aqueous | MEVLIPLAVVAVVIAWSIERFKPELWEKAVSKFKR |
Ga0210003_10377315 | 3300024262 | Deep Subsurface | MEVLIPLTVVAVVLAWSVKKFKPELWNKVTSKFKK |
Ga0244775_110817612 | 3300024346 | Estuarine | MDILVPLAIIAVIIAWSVKKFKPELWNKITAKFKK |
Ga0208667_10070685 | 3300025070 | Marine | MDILIPLTIVVVVLVWSVKRFKPELWSKAVALFKK |
Ga0208298_10366292 | 3300025084 | Marine | MDILIPLIIVTVVLAWSVKRFKPELWEKAVALFKK |
Ga0208157_10066402 | 3300025086 | Marine | METLIPLAVIVVVLTWSVKKFKPELWSKATALFKK |
Ga0208157_10183534 | 3300025086 | Marine | MDILIPLIIVAVVLAWSVKRFKPELWTKVTSKFKK |
Ga0208157_10923653 | 3300025086 | Marine | MDVLIPLGILAIVVLLSVKRFKPELWEKAVSRFKK |
Ga0208669_10037283 | 3300025099 | Marine | MDILIPLVIVTLVLAWSVKKFKPELWNKVTSKLKK |
Ga0208669_10922662 | 3300025099 | Marine | MDILIPLIIITVIAGWSVKKFKPELWSKVTAKFKK |
Ga0208669_11157472 | 3300025099 | Marine | MDVLIPLGIVAIVVLLSVKRFKPELWEKSVSRFKK |
Ga0208666_10248332 | 3300025102 | Marine | MDILIPLIVVVVLAWSVKRFKPELWNKLISFISKN |
Ga0208793_11214862 | 3300025108 | Marine | MDVLIPLAVVAVVIAWSIERFKPELWNKIVAKLPWKK |
Ga0209535_10059624 | 3300025120 | Marine | MDILIPLIIVTVVLAWSVKRFKPELWNKVTSKLKK |
Ga0208919_10032619 | 3300025128 | Marine | MDILIPLTIIVVVLVWSVKKFKPELWQKLISFISKN |
Ga0208919_11614711 | 3300025128 | Marine | MDLLIPLIIVAVVLAWSVKRFKPELWNKVTSKFKK |
Ga0209232_10166844 | 3300025132 | Marine | MEVLIPLAVIVVVIGWSVKRFKPELWEKAVSKFKR |
Ga0209634_10413732 | 3300025138 | Marine | MDVLIPLIIITLVLGWSVKRFKPLLWSKITSILKK |
Ga0209645_10815953 | 3300025151 | Marine | MDVLIPLGIVAIVVLLSVKRFKPELWEKAVSRFKK |
Ga0209645_11857002 | 3300025151 | Marine | MDVLIPLGIVVIVVLLSVKRFKPELWEKAVSKFKK |
Ga0208182_10985422 | 3300025251 | Deep Ocean | MDVLIPLGIIAIVVLFSVKRFKPELWKKAVSKFKK |
Ga0208148_10043997 | 3300025508 | Aqueous | MDILIPLIIVTIVLAWSVKKFKPELWNKVTSKLKK |
Ga0208148_10993362 | 3300025508 | Aqueous | MDVFIPLIIVAVVLAWSVKKYKPELWNKITSKLKK |
Ga0208303_100341212 | 3300025543 | Aqueous | MEVLIPLAVLAVVIAWSVKRFKPELWNKVKFKFKK |
Ga0208303_10384923 | 3300025543 | Aqueous | MEVIIPLAVVVVVLAWSVKRFKPELWKEVTAKFKK |
Ga0209304_100076212 | 3300025577 | Pelagic Marine | MDILIPLTIIVVVLVWSVKKFKPELWNKLISFISKN |
Ga0208149_10034872 | 3300025610 | Aqueous | MEVVIPLAVVVVVLAWSIKRFKPELWKEVTAKFKK |
Ga0209194_10469334 | 3300025632 | Pelagic Marine | MDILIPLIIVTVVLAWSVKRFKPELWEKAVSKFKR |
Ga0208160_11033241 | 3300025647 | Aqueous | HILKELNMDILIPLIIVAVVLAWSVKRFKPELWNKVTSKFKK |
Ga0208134_10605044 | 3300025652 | Aqueous | MEILIPLAVLAVVIVWSVKKFKPELWNKIVSKFKK |
Ga0208898_11517282 | 3300025671 | Aqueous | MEVLIPLIIVAVVLAWSVKRFKPELWEKTISKFKK |
Ga0208162_10028892 | 3300025674 | Aqueous | MEVLIPLIVVAVVIAWSIERFKPELWNKIVAKLPWKK |
Ga0208019_11371511 | 3300025687 | Aqueous | MEVLIPLAVIIVVIGWSVKRFKPELWEKAVSKFKR |
Ga0209653_10078428 | 3300025695 | Marine | MEVLIPLTVVAVVIAWSIKRFKPELWSKIVSKFKK |
Ga0208150_10247117 | 3300025751 | Aqueous | RKSSMEVLIPLAVVAVVIAWSIERFKPELWDKIVTKFKR |
Ga0208899_11031891 | 3300025759 | Aqueous | MDILVPLAIVVVVLAWSVKRFKPELWTKVTSKFKK |
Ga0208767_12120121 | 3300025769 | Aqueous | MEVLIPLTVVAVVIAWSIERFKPELWNKIISKFKK |
Ga0208767_12517762 | 3300025769 | Aqueous | MEILIPLAVLAVVIAWSVKRFKPELWNKIVSKFKK |
Ga0209193_10073267 | 3300025816 | Pelagic Marine | MDILIPLIIVAVVLAWSVKRFKPELWNKAVSKFKK |
Ga0208547_10267082 | 3300025828 | Aqueous | MDILIPLIIVAVVIGWSVKKFKPELWNKVTSKLKK |
Ga0209308_100246955 | 3300025869 | Pelagic Marine | MDILIPLIIVAVVLAWSVKRFKPELWNKAVSKFKR |
Ga0209962_10319012 | 3300026125 | Water | NMEVLIPLTVVAVVIAWSVKRFKPELWEKAVSKFKK |
Ga0256368_10396442 | 3300028125 | Sea-Ice Brine | MDVLIPLAILAVVVALSVRRFKPELWKEAVSKFKK |
Ga0183755_10100672 | 3300029448 | Marine | MDVLIPLVIITVVLAWSVKKFKPELWNKITAKFKK |
Ga0316204_107303991 | 3300032373 | Microbial Mat | MDVLIPLAILAVVVALSVRRFKPELWKEAASKFKK |
Ga0348335_028361_413_520 | 3300034374 | Aqueous | MEVLIPLAVVAVVIAWSIERFKPELWKKIVTKFKR |
Ga0348335_172381_321_428 | 3300034374 | Aqueous | MDILIPLIIVAVVIGWSVKKFKPELWDQAVSKFKK |
⦗Top⦘ |